Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E028707.351ON26126112900.0
NDAI0E044707.351ON2642638921e-121
YLR201C (COQ9)7.351ON2602618111e-109
Suva_10.2967.351ON2602618071e-108
Skud_12.2657.351ON2602618061e-108
Smik_12.2607.351ON2602617531e-100
TPHA0F029807.351ON2642657333e-97
KAFR0L014807.351ON2642617273e-96
TDEL0C019707.351ON2602627064e-93
KNAG0B026207.351ON2652617058e-93
Kpol_530.307.351ON2602627031e-92
ZYRO0F11726g7.351ON2512496785e-89
KLTH0H01232g7.351ON2572526612e-86
CAGL0A03949g7.351ON2682616605e-86
TBLA0E004507.351ON2792616572e-85
Kwal_56.246447.351ON2582626325e-82
KLLA0D12320g7.351ON2502466264e-81
SAKL0F11396g7.351ON2542476231e-80
Ecym_47227.351ON2532475813e-74
ACL147W7.351ON2462475422e-68
Kwal_47.189433.506ON42391658.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E02870
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   501   0.0  
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   348   e-121
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   317   e-109
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   315   e-108
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   315   e-108
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   294   e-100
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   286   3e-97
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   284   3e-96
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   276   4e-93
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   276   8e-93
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   275   1e-92
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   265   5e-89
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   259   2e-86
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   258   5e-86
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   257   2e-85
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   248   5e-82
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   245   4e-81
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   244   1e-80
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   228   3e-74
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   213   2e-68
Kwal_47.18943 s47 (1034388..1035659) [1272 bp, 423 aa] {ON} YGR1...    30   8.0  

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  501 bits (1290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/261 (93%), Positives = 245/261 (93%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           EMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           EYAWYMFMVSTNLVRARLARS
Sbjct: 241 EYAWYMFMVSTNLVRARLARS 261

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  348 bits (892), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/263 (65%), Positives = 200/263 (76%), Gaps = 2/263 (0%)

Query: 1   MLNRSILKKGLFSY-RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59
           +LNR + K    S  R++H +  EY K ATLSPLTYNK+SVQYKILSNAL KWVPK GF 
Sbjct: 2   LLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFT 61

Query: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCP-D 118
           ++AIT SLNEL  SSSL SV+G+SNSP+IFRSISPAVMEL+KFQLVSKRY+LTEN+ P  
Sbjct: 62  DEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYI 121

Query: 119 TTXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYF 178
            T                +MD+ +  Q+  LF +L  PS  LF+VALPEL  LSDD+IYF
Sbjct: 122 ETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYF 181

Query: 179 SNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNN 238
           SNEKDHHDMAWY KRLGVSCAYVSSKLYM ++N  +F+ T+ FAKDKLHRIM LGEYYNN
Sbjct: 182 SNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNN 241

Query: 239 TEEYAWYMFMVSTNLVRARLARS 261
           TEEYAWY  MVS NLV+ARLAR 
Sbjct: 242 TEEYAWYTLMVSMNLVKARLARG 264

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  317 bits (811), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           ML R+  + G   +R YH +  E+VKP  + PLTY KES QYK+LS AL K+VP+HGF E
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           ++I +SLNELG+ SS++S IGA NSP+ F S S AVMELIKFQLV KRY LTE + PD T
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHS-STAVMELIKFQLVDKRYRLTEGINPDVT 119

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           EMDK IG  +  L ++LA PS+FLF+ A+PELHRLSDDMIYFSN
Sbjct: 120 PQYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSN 179

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           EKDHHD AWY KRL VS  Y+ SKL+MAQD S ++++T +FAKDKLHR+M+LGEYYNNTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTE 239

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           E+AWY  M + NL++++L R 
Sbjct: 240 EFAWYTLMSTVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  315 bits (807), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 190/261 (72%), Gaps = 1/261 (0%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           M +R+ ++K   S R YH +  E+V P  + PL Y K+S QYK+LS AL ++VPKHGF E
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           ++I +SLN+LG+ SS++S IGASNSP+   S S AVMEL+KFQLV KRY LTE + PD T
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHS-STAVMELLKFQLVDKRYRLTEGINPDVT 119

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           EMDK +G+Q+  L ++LA PS FLF+ A+PELHRLSDDMIYFSN
Sbjct: 120 PHYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           EKDHHD AWY KRL VS  Y+ S+L+MAQD S DF +T +FAKDKLHR+M+LGEYYNNTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTE 239

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           E+AWY  M + NLV+++LAR 
Sbjct: 240 EFAWYTLMSTVNLVKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  315 bits (806), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           M  R++ + G   +R YH +  E+VKP  + PLTY K+S QYK+LS AL ++VPKHGF E
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           ++I +SLN+LG+ SS++S IGASNSP+ F S S AVMEL+KFQLV KRY LTE + PD T
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHS-STAVMELVKFQLVDKRYRLTEGINPDVT 119

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           EMDK IG Q+  L ++LA PS  LF+ A+PELHRLSDDMIYFSN
Sbjct: 120 SRYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSN 179

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           E+DHHD AWY KRL VS  Y+ SKL+MAQD S DF++T +FAK+KLH++M+LGEYYNNTE
Sbjct: 180 EEDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTE 239

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           E+AWY  M + NLV+++LAR 
Sbjct: 240 EFAWYTLMSTVNLVKSQLARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  294 bits (753), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 156/261 (59%), Positives = 191/261 (73%), Gaps = 1/261 (0%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           ML R+IL+KG  S+R YHP+  E+VK   + PLTY KES QYK+LS AL ++VPKHGF E
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           ++I +SLNELG+ SS++S I ASNSP+ F S S AVMELIKFQLV KRY LTE + PD T
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHS-STAVMELIKFQLVDKRYRLTEAINPDVT 119

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           EMDK IG  +  L ++LA PS FLF+ A+PELHRLSDDMIYFSN
Sbjct: 120 PQYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           EKDHHD AWY KRL VS  Y+ SKL+MAQD S +++DT  FAK KL+R+M+LGEYYNNTE
Sbjct: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           E+AWY  M + NLV+++L R 
Sbjct: 240 EFAWYTLMSTVNLVKSQLVRG 260

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  286 bits (733), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 143/265 (53%), Positives = 185/265 (69%), Gaps = 5/265 (1%)

Query: 1   MLNRS--ILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGF 58
           M+NR   I +K   + R +HP+  EYV P  LSP TY K+S Q+KILS+A+   V K GF
Sbjct: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60

Query: 59  KEKAITDSLNELGF--SSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLC 116
            E+AI +++ EL     S++LS IG+SNSP+   S SP+VMEL+KF LV KRY + E L 
Sbjct: 61  SERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHS-SPSVMELLKFNLVLKRYRMIEGLD 119

Query: 117 PDTTXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMI 176
           P T                 EMD  IGK I    ++L  P  FL D ALPELHRL+DDMI
Sbjct: 120 PLTMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179

Query: 177 YFSNEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYY 236
           YFSNEKDHHD AWY+KRLGVS AY+SSKL+MAQDNS ++++TL FAKDKL ++M+LG+YY
Sbjct: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239

Query: 237 NNTEEYAWYMFMVSTNLVRARLARS 261
           NNTEEYAWY+ + S N+V++R++R+
Sbjct: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  284 bits (727), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 145/261 (55%), Positives = 188/261 (72%), Gaps = 8/261 (3%)

Query: 2   LNRSILKKGLFSY--RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59
           LN+S+L+   F    R YHP+  EYV P T+SPLTY+ +S+Q KILS++L ++VP  GF 
Sbjct: 9   LNKSLLRTTQFKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFN 68

Query: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119
           EK+I  S+N+LG+SSS++SVIGASNSP+ F   SPAV+ELIK+ LVSKR ELT+      
Sbjct: 69  EKSILKSINDLGYSSSMMSVIGASNSPS-FAHSSPAVLELIKYNLVSKRIELTK-----D 122

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
           T                EMD  I  Q+  LFA+LATP  F+FDV+LPEL +L+DDMI+FS
Sbjct: 123 TNDNTTTTLKELLLKRLEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFS 182

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
           NEKDHHDMAWY+KRL VS AYV+SK++M QD S +F+ T+ FA DK+ R+M LGEYYNN 
Sbjct: 183 NEKDHHDMAWYSKRLAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNV 242

Query: 240 EEYAWYMFMVSTNLVRARLAR 260
           EEYAW+  M S NLV+++ +R
Sbjct: 243 EEYAWFTLMNSINLVKSQFSR 263

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  276 bits (706), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 135/262 (51%), Positives = 182/262 (69%), Gaps = 3/262 (1%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPA-TLSPLTYNKESVQYKILSNALTKWVPKHGFK 59
           M+++ ++       R Y P+  EY+ P  +  PL Y K+S QYK+LS+ L K VP +GF 
Sbjct: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60

Query: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119
           E+AI +SLNELG+ S++LSVIG+SN P+ F S SPA+MEL+KF LV KR  LTEN+  +T
Sbjct: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHS-SPALMELLKFHLVDKRLNLTENISLET 119

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
                            EM+  + K +  L ++L+ P  FL D ++PELHRLSDDMIYFS
Sbjct: 120 PVDQLPSLEHLVIKRL-EMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFS 178

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
            EKDH+D AWY+KRL VSCAYVSS+L+MAQD S D+++T  FA++KLHR+  LGEYYNNT
Sbjct: 179 TEKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNT 238

Query: 240 EEYAWYMFMVSTNLVRARLARS 261
           EE+AWY  + + NLV+++LAR 
Sbjct: 239 EEFAWYTLLSTINLVKSQLARG 260

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  276 bits (705), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 177/261 (67%), Gaps = 2/261 (0%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           +L  S+ ++ L S R YHP+  EY     ++PLTY  +S Q +IL++ L   VP  GF E
Sbjct: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCP-DT 119
           +A+  S+  +G+ SS++SV+GASNSP+IF S SPAVMEL+KF LV KR+ LTE+L     
Sbjct: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHS-SPAVMELVKFNLVKKRHALTESLAAAGL 123

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
                            +MD  + KQ+  LF +LA PS F+ +VA+PEL RLSDDMIYFS
Sbjct: 124 GSPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFS 183

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
           NEKDH D AWY+KRLGVS AY +SKL+MAQDNS + +DT+ FA+DKLHRIM LGEYYNN 
Sbjct: 184 NEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNV 243

Query: 240 EEYAWYMFMVSTNLVRARLAR 260
           EEYAWY  M + N  +A  +R
Sbjct: 244 EEYAWYSIMTTVNRAKAGFSR 264

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  275 bits (703), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 181/262 (69%), Gaps = 3/262 (1%)

Query: 1   MLNRSILKKGLFSY-RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59
           ML   + K+  F   R YHP+ KEYV   TL PL Y K+S QYKILS++L   VP+ GF 
Sbjct: 1   MLKNFVPKRTAFGLTRFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFN 60

Query: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119
           E+AI +S+N LG+ SS+LSVIG+SN+P+   S S A+MEL+KF LV+KRY+L+E++ P  
Sbjct: 61  ERAIVNSINLLGYPSSILSVIGSSNTPSFLHS-STALMELLKFNLVAKRYQLSEDI-PLD 118

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
           T                +MD  IG  +  L A+L+ P  FL D +LPELHRL+DDMIYFS
Sbjct: 119 TPVEELPSLEDLLIKRLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFS 178

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
           +EKDH D AWY KR+GVS AY+SSKL+MAQD S  + DT  FAKDKL RIMKLG+YYNN 
Sbjct: 179 SEKDHPDFAWYAKRMGVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNA 238

Query: 240 EEYAWYMFMVSTNLVRARLARS 261
           EEYAWY+ M S N+ +++ AR 
Sbjct: 239 EEYAWYVLMNSINMAKSKAARG 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  265 bits (678), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 171/249 (68%), Gaps = 6/249 (2%)

Query: 13  SYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGF 72
           S R YHPS  E++  + L PL Y  +S QY +LS+AL   VP  GF E+AI  SLN+L +
Sbjct: 9   SLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68

Query: 73  SSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTXXXXXXXXXXXX 132
            S++LSVIGASNSP++  S SPAVMEL+KF LV KR +L+++L  +              
Sbjct: 69  PSTMLSVIGASNSPSLLHS-SPAVMELVKFHLVQKRLQLSQDLSSEEKPSLEDLFIKRL- 126

Query: 133 XXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTK 192
               E++  I   +  L + ++ P  F  D ALPELHRLSDD+IY+SNEKDHHD AWY+K
Sbjct: 127 ----ELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSK 182

Query: 193 RLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTN 252
           RLG+SCAYVSS+L+MAQD S ++E+T  FA+DKL R M+LGEYYNNTEE+ WY  + S N
Sbjct: 183 RLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSIN 242

Query: 253 LVRARLARS 261
           L ++++AR 
Sbjct: 243 LAKSQMARG 251

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  259 bits (661), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 128/252 (50%), Positives = 169/252 (67%), Gaps = 2/252 (0%)

Query: 11  LFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNEL 70
           + + R YHPS  E+    + +PLTY   S Q+K+L +AL K VP +GF E+A+  SLN+L
Sbjct: 7   ILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDL 66

Query: 71  GFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPD-TTXXXXXXXXX 129
               SLLSVIGASNSP+ F + SPAV+ELIKF LV+KRY LT+ L P  T+         
Sbjct: 67  DLGPSLLSVIGASNSPS-FLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALE 125

Query: 130 XXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAW 189
                  E++K I   +  L + L+ P  FL   ALPELHRLSDDM+YFS E D +D AW
Sbjct: 126 TLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAW 185

Query: 190 YTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMV 249
           Y+KR+ +SCA+VSS+L+MAQD S ++ DT  FA +KLH + KLG+YYNNTEEY WY  ++
Sbjct: 186 YSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLM 245

Query: 250 STNLVRARLARS 261
           S NL +++L RS
Sbjct: 246 SVNLAKSQLTRS 257

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  258 bits (660), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 170/261 (65%), Gaps = 3/261 (1%)

Query: 1   MLNRSILKKGLFS-YRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59
           ++ R     GL S  R YHP+  EYV P    PLTY  ES ++K+LS+ +   VP+HGF 
Sbjct: 9   LVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFT 68

Query: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119
           EKAI +SLN +   S +L+ IGASNS A F   SPAVMELIKFQLV KR+ + E +  + 
Sbjct: 69  EKAIVNSLNAMKMPSGMLTTIGASNS-ATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EI 126

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
                            +MD  I   +  + A+L  PSSF+ +V+LPEL RL+DDMIY+S
Sbjct: 127 AEASKLPSLESLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYS 186

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
           NEKDHHD AWYTKR  ++  Y++SK +MAQD S +F +T+ FA+DKLH++M LG+YYNN 
Sbjct: 187 NEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNV 246

Query: 240 EEYAWYMFMVSTNLVRARLAR 260
           EE+ W+  M + NL ++++AR
Sbjct: 247 EEFGWFTLMSAVNLTKSQMAR 267

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  257 bits (657), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 127/261 (48%), Positives = 181/261 (69%), Gaps = 7/261 (2%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           +L++ I   G+   R+Y+    +  K   L PL Y K+S QY+IL +A+   VP  GF E
Sbjct: 26  LLSKHIKNNGI---RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTE 82

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120
           +AI +S+N+LG++SS++SV+G+SN+  I  S SPAV+EL+KF LVSKR +L+E + P+T 
Sbjct: 83  RAIINSINKLGYNSSMISVLGSSNTHNILHS-SPAVLELLKFNLVSKRLKLSEGIDPET- 140

Query: 121 XXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180
                           +MDKAI  ++  +  +L+ P +FL + ++PEL RLSDDMIYFSN
Sbjct: 141 --KDLPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSN 198

Query: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240
           EKDHHDMAWY+KRL VS  Y++S+++MAQD S D   TL FA+DKL+++M LGEYYNNTE
Sbjct: 199 EKDHHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTE 258

Query: 241 EYAWYMFMVSTNLVRARLARS 261
           E+ W+  M S N+V+++LARS
Sbjct: 259 EFLWFTLMTSVNIVKSQLARS 279

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  248 bits (632), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 165/262 (62%), Gaps = 5/262 (1%)

Query: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60
           ML RS    G    R Y P+  EY     L+PL Y  +S+Q+K+L +AL   VP +GF E
Sbjct: 1   MLARSFRTLG---RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57

Query: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENL-CPDT 119
           +A+  SLN+LG  S +LS IGA NSP +  S SPAV+EL+KF LV+KRY LT++L     
Sbjct: 58  RALVASLNDLGLGSQVLSSIGAPNSPPLLNS-SPAVLELVKFHLVTKRYALTKDLDIARC 116

Query: 120 TXXXXXXXXXXXXXXXXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179
                            E++  I + +  L A LA P  FL   ALPELHRLSDDMIYFS
Sbjct: 117 ASPAEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFS 176

Query: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239
            E D +D AWY+KR  +SCA+VSS+L+MAQD S ++ DT  FA DKLH + KLG+YY NT
Sbjct: 177 KEPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNT 236

Query: 240 EEYAWYMFMVSTNLVRARLARS 261
           EEY WY  ++S NL ++++ RS
Sbjct: 237 EEYMWYTLLMSVNLAKSQITRS 258

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  245 bits (626), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 171/246 (69%), Gaps = 3/246 (1%)

Query: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74
           R YHP+  E+  P  + PLTY  +SVQ+K+LSNAL K VP++GF E+AI  SLNELG  S
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTXXXXXXXXXXXXXX 134
           S LSV+G+SNSP+ F ++SP+V+EL+KF LVSKR +L  +L  D+               
Sbjct: 67  SYLSVLGSSNSPSFF-NVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTLFLQRL 125

Query: 135 XXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194
             ++++ +   +  L + ++ P  FL   AL ELH+L+DDMI++SNE+DH+D AWY+KR+
Sbjct: 126 --KLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRI 183

Query: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254
            +S AYVSS+L+MAQD S +F++T+ FA+ KL+++ +LG  YNNTEEY W+  + S NL 
Sbjct: 184 ALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLA 243

Query: 255 RARLAR 260
           ++++ R
Sbjct: 244 KSQITR 249

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  244 bits (623), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 130/247 (52%), Positives = 172/247 (69%), Gaps = 4/247 (1%)

Query: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74
           R YHP+  E+     L PL Y+K+S Q+KIL+NAL + VPK+GF E+A+T S ++LG+SS
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTXXXXXXXXXXXXXX 134
           S LSV+GASNSP+ F S   AV+EL+KF LVSKRY LT+ +   T               
Sbjct: 72  SFLSVLGASNSPSFFNSSP-AVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLKRL- 129

Query: 135 XXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194
             EM+K I   +  L + LA P +FL + A+PELHRLSDDM+YFSNE DH+D AWY+KRL
Sbjct: 130 --EMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187

Query: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254
            +S AYVSS+L+MAQD S D++DT+ FAK+KL  I +LGE YNN EEYAWY  + S +L 
Sbjct: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247

Query: 255 RARLARS 261
           ++++ RS
Sbjct: 248 KSQMTRS 254

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  228 bits (581), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 166/247 (67%), Gaps = 8/247 (3%)

Query: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74
           R YH +  EY    TL PL Y + S QYK+L+ AL K+VP  GFK+ AI D+ NELG++S
Sbjct: 15  RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYNS 74

Query: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTXXXXXXXXXXXXXX 134
           ++L+ IGA+NSPA+F ++S +V EL+KF LV+KRY L E+     T              
Sbjct: 75  AVLAAIGANNSPAMF-NVSTSVQELVKFHLVTKRYGLQEDQEGTKTLEELFLKRL----- 128

Query: 135 XXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194
             E +K++G  +  + + LA P  FL +  LPEL +L+DDMIY+S EKD +D+AWY+KRL
Sbjct: 129 --EANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRL 186

Query: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254
            VS AY+S++L+MA+D+S +F+ T+ FAK ++++I ++G  YNN EE+AW+  + + NL 
Sbjct: 187 AVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLA 246

Query: 255 RARLARS 261
           R++L R 
Sbjct: 247 RSQLVRG 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  213 bits (542), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 105/247 (42%), Positives = 151/247 (61%), Gaps = 7/247 (2%)

Query: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74
           R YHP+  E+     L PL Y ++S QYK+L  AL   VP  GF E+AI  +  +LG+ S
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTXXXXXXXXXXXXXX 134
           ++LS + A NSPA+  ++  AV+EL+KF LV+KR  L +                     
Sbjct: 67  AVLSALAAPNSPALL-NVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQRV---- 121

Query: 135 XXEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194
             E D+ +  Q+  L + L+ P  FL + A+PEL RLSDD+IY+S EKDH D+AWY+KR 
Sbjct: 122 --EADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179

Query: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254
            V+ AYVS+ L+MA+D S   E+TL FA+ +L ++  LG  YNN EE+AWY  +++ NLV
Sbjct: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239

Query: 255 RARLARS 261
           +++L R 
Sbjct: 240 KSQLTRG 246

>Kwal_47.18943 s47 (1034388..1035659) [1272 bp, 423 aa] {ON} YGR142W
           (BTN2) - Gene/protein whose expression is elevated in a
           btn1 minus/Btn1p lacking yeast strain. [contig 188] FULL
          Length = 423

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 38/91 (41%), Gaps = 12/91 (13%)

Query: 177 YFSNE---KDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFA---------KD 224
           +F NE   +DH D   + +    +      K  +A+   RD+E TLS           KD
Sbjct: 100 FFGNEYYVQDHEDEEMFMRHAIANLDLAPIKRQVAKKVFRDYEITLSHGGDELVIASRKD 159

Query: 225 KLHRIMKLGEYYNNTEEYAWYMFMVSTNLVR 255
           +LH+   LG   ++     + M   S  ++R
Sbjct: 160 RLHKAFSLGVEVDDVRVNGFDMISESVGVLR 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,045,295
Number of extensions: 1062395
Number of successful extensions: 3129
Number of sequences better than 10.0: 25
Number of HSP's gapped: 3156
Number of HSP's successfully gapped: 25
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)