Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E028507.353ON28128113490.0
NDAI0E044507.353ON2212286142e-79
KAFR0L015007.353ON2792876151e-78
Skud_12.2637.353ON2742826097e-78
Suva_10.2947.353ON2752835922e-75
YLR199C (PBA1)7.353ON2762845862e-74
Smik_12.2587.353ON2742855836e-74
TDEL0C019507.353ON2732845765e-73
Kpol_530.287.353ON2742855681e-71
TPHA0F030007.353ON2822915681e-71
ZYRO0F11770g7.353ON2722845081e-62
TBLA0E020707.353ON2522934764e-58
KNAG0B026007.353ON2792894776e-58
CAGL0A03993g7.353ON2722854766e-58
SAKL0F11440g7.353ON2722893828e-44
KLTH0H01188g7.353ON2672913801e-43
Kwal_56.246507.353ON2522672953e-31
Ecym_47207.353ON2612842133e-19
KLLA0D12276g7.353ON2582872114e-19
ACL145W7.353ON2341591682e-13
KAFR0C055705.511ON26149760.37
Kwal_33.148905.85ON97537712.3
Ecym_61494.180ON86166693.6
ACL187W4.180ON86158684.3
Suva_7.1241.90ON122048659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E02850
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   524   0.0  
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   241   2e-79
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   241   1e-78
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   239   7e-78
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   232   2e-75
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   230   2e-74
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   229   6e-74
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   226   5e-73
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   223   1e-71
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   223   1e-71
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   200   1e-62
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   187   4e-58
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   188   6e-58
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   187   6e-58
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   151   8e-44
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   150   1e-43
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   118   3e-31
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    87   3e-19
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...    86   4e-19
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    69   2e-13
KAFR0C05570 Chr3 (1111854..1112639) [786 bp, 261 aa] {ON} Anc_5....    34   0.37 
Kwal_33.14890 s33 complement(860237..863164) [2928 bp, 975 aa] {...    32   2.3  
Ecym_6149 Chr6 (273459..276044) [2586 bp, 861 aa] {ON} similar t...    31   3.6  
ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homo...    31   4.3  
Suva_7.124 Chr7 complement(237479..241141) [3663 bp, 1220 aa] {O...    30   9.9  

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/281 (94%), Positives = 265/281 (94%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60
           MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60

Query: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFE 120
           PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSW                RENQQQAFNFE
Sbjct: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAFNFE 120

Query: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVKEIND 180
           FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVKEIND
Sbjct: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVKEIND 180

Query: 181 HTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLTVIQ 240
           HTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLTVIQ
Sbjct: 181 HTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLTVIQ 240

Query: 241 DLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           DLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI
Sbjct: 241 DLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  241 bits (614), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 120/228 (52%), Positives = 161/228 (70%), Gaps = 9/228 (3%)

Query: 56  MNPLFPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQ 115
           MNPLFPE L+   ++  I T LTL  DQ   NE  HSW                 ++ ++
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEK 60

Query: 116 AFNFEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASV 175
           +++F FP+FA+ + ++ISIQ+NFLKISPIFSN+IS+ L++ LP   + LILG+SDR+A +
Sbjct: 61  SYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQALPLNKEILILGTSDRVAVM 120

Query: 176 KEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLN 235
           ++I++   TL PPEF+TGFI SL+TEL +HN        K+ FDAI+VPSEGP GFEKLN
Sbjct: 121 RKISNEIDTLEPPEFVTGFIGSLITELNLHNA-------KYNFDAIIVPSEGPTGFEKLN 173

Query: 236 LTVIQDLIDLFKEEWP--NLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           LT++QDLID+FK EW   N+D KVY E+ YR+WKLAG+ +GAQSGLYI
Sbjct: 174 LTIMQDLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  241 bits (615), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 187/287 (65%), Gaps = 14/287 (4%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNPL 59
           MLFKQWNE +EPRHQLD P++ KN+ESLQ SP+P+V  PS + F +Y+KII+TT++MNPL
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPL 60

Query: 60  FPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNF 119
           FP+ L++ ++LG IET L LTE +   +E  H                         F+F
Sbjct: 61  FPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNNFSF 120

Query: 120 EFPVFAVGK--VVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKP-LILGSSDRIA-SV 175
           +FP++ +     ++ISI +NFLK+SPIF N+ISKKL   +       L+LG+SD+I+ ++
Sbjct: 121 KFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNI 180

Query: 176 KEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLN 235
           K + +  C++ PPEFITGFI SLL EL      L+ G + F+   I+VPSEGP+GFEKL+
Sbjct: 181 KTVTNKNCSINPPEFITGFIGSLLYEL------LEIGTDNFE--CIIVPSEGPIGFEKLS 232

Query: 236 LTVIQDLID-LFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           L+ +++LI+  F E    +D K Y +E +RNWKL GS    QSGLYI
Sbjct: 233 LSTMEELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  239 bits (609), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 121/282 (42%), Positives = 182/282 (64%), Gaps = 11/282 (3%)

Query: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61
           FKQWN+  EPRHQLDFP +SKN +SL+  PIP+V  P  +    Y  +IITT++MNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFEF 121
           + L++  ++G++++ LT+       + D +SW                  +++  +NF F
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120

Query: 122 PVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLI-LGSSDRIASVKEIND 180
           P+++ G+ ++ SI++NF+ ISPIF N+IS+ ++ QL +T   +I +GSSDRI+++K++  
Sbjct: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180

Query: 181 HTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLTVI 239
             CTL PPEFITGFI S+LT+L I       GENK   F  ++VPSEGP GFEK++L+ +
Sbjct: 181 SECTLQPPEFITGFIGSVLTQLII-------GENKGMNFKCLIVPSEGPNGFEKISLSDM 233

Query: 240 QDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
             LID+   +W   D   Y++E YR W+   + +GAQSGLYI
Sbjct: 234 GSLIDVCS-QWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  232 bits (592), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 180/283 (63%), Gaps = 12/283 (4%)

Query: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61
           FKQWN+  EPRHQLDFP +SKN +SL+  P+PKV  P  +    Y +++ITT++MNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXX-XXXXXRENQQQAFNFE 120
           + L++  ++G+I+T L + E       D HSW                   N++  +NF 
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKP-LILGSSDRIASVKEIN 179
           FP+++ GK ++ SI++NF+ ISPIF N+IS+ +  QL +T    +I+G+SDRI+++K + 
Sbjct: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180

Query: 180 DHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLTV 238
           +  CTL PPEF+TGFI S+LT+L         G NK  +F  ++VPSEGP GFEK +L+ 
Sbjct: 181 EDECTLQPPEFVTGFIGSVLTQLI-------TGANKGMKFKCLVVPSEGPNGFEKFSLSD 233

Query: 239 IQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           +  LID+   +W  LD   Y+EE +R W+   + +GAQSGLYI
Sbjct: 234 MGSLIDVCS-QWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  230 bits (586), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 179/284 (63%), Gaps = 11/284 (3%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPL 59
           MLFKQWN+  EP+H LD P +SKN +SL+  P+PKV FP  +    Y   +ITT++MNPL
Sbjct: 1   MLFKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPL 60

Query: 60  FPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNF 119
           FP+ L++  ++G+I+T LT+       +   HSW                    +  + F
Sbjct: 61  FPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGF 120

Query: 120 EFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPR-TIKPLILGSSDRIASVKEI 178
            FP+++ GK ++ S+++NF+ ISPIF N+IS+ +I QL + +   +++G+SD+IAS+K +
Sbjct: 121 SFPIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVM 180

Query: 179 NDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNLT 237
            ++ CTL PPEFITGFI S+LT+L +       G +K  +F  ++ PSEGP GFEKL+L+
Sbjct: 181 TENECTLQPPEFITGFIGSVLTQLIV-------GPSKGLKFKCLVAPSEGPNGFEKLSLS 233

Query: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
            +  L+DL   +W   +P  Y+EE YR W+   + +GAQSGLYI
Sbjct: 234 DMGSLVDLCG-QWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  229 bits (583), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 122/285 (42%), Positives = 174/285 (61%), Gaps = 17/285 (5%)

Query: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61
           FKQWNE  EPRH LDFP +SKN  SL+A P+PKV  P  +    Y  ++ITT++MNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFEF 121
           + L++   +GKIET LT+    +  +   HSW                  + +  ++F F
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120

Query: 122 PVFAVGKVVIISIQDNFLKISPIFSNIISK----KLIEQLPRTIKPLILGSSDRIASVKE 177
           P+++ GK ++ SI++NFL ISPIF N+IS+    +L+E  P  I   ++G+SD+IA++K 
Sbjct: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEII---VIGTSDKIANMKV 177

Query: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNL 236
           +    C+L PPEFITGFI S+LT+L         G NK  +F  ++VPSEGP G+EKL+L
Sbjct: 178 MTKDECSLKPPEFITGFIGSVLTQLV-------GGVNKGMKFKCLVVPSEGPNGYEKLSL 230

Query: 237 TVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           + +  L+ L   +W   D   Y EE YR W+   + +GAQSGLYI
Sbjct: 231 SDMGSLVSLCG-QWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  226 bits (576), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 177/284 (62%), Gaps = 14/284 (4%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60
           MLFKQWNE  EPRHQLD P++  N+ +LQ S +P+V  P I  QN+ ++I+T+ +MNPLF
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLPPIDLQNFSRVILTSAIMNPLF 60

Query: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFE 120
           PEKL++S  LG ++  L L+  + A++   HSW                 E + + F   
Sbjct: 61  PEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEE-RSKTFELC 119

Query: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTI---KPLILGSSDRIASVKE 177
            P+ + G+ ++IS+++NFLK SPIF N I+K ++ +L +     + ++LG+SD+I  +K 
Sbjct: 120 APIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELKP 179

Query: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237
           ++D   TL PPEF+T F+ +++T+L          E    F  ++ PSEGP+GFEKLNL 
Sbjct: 180 VSDKETTLNPPEFVTSFVGAVITQLI---------EKSLPFQGLIAPSEGPVGFEKLNLV 230

Query: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
            +++LI L   +W + + ++Y  E YR W+L G+ LGAQSGLYI
Sbjct: 231 TMEELITLC-HQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  223 bits (568), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 114/285 (40%), Positives = 175/285 (61%), Gaps = 15/285 (5%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60
           MLFKQWNEF+ PRH+LD PI+++ND+SLQ   +P+V  P      Y+ +++TT++M+PLF
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPETDLSKYKNVVLTTKIMDPLF 60

Query: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFE 120
           P KL+ ++ +  I T L + E Q+    + HSW                  N ++  +F 
Sbjct: 61  PSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRD--SNNRRLLSFS 118

Query: 121 FPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKP----LILGSSDRIASVK 176
            P+FA    +II I++NF+K+S IFSN+I++++I  L     P    + +G+SDRI ++K
Sbjct: 119 SPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNIK 178

Query: 177 EINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNL 236
           ++    C+L PPEF+TGFI S+LT+L      +        F  IL PSEGP+GFEK+ L
Sbjct: 179 KLTQDHCSLEPPEFVTGFIGSILTQLISKEVNV--------FTGILAPSEGPIGFEKMTL 230

Query: 237 TVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
            VI++LID+  +E  ++    Y+ +  R W+L G+ +GAQSGLYI
Sbjct: 231 DVIKELIDIC-QELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  223 bits (568), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 179/291 (61%), Gaps = 19/291 (6%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60
           MLFKQWN+  EPRHQL  P LS N ESLQ   IP+V   ++ ++++E +I+TT+ MN LF
Sbjct: 1   MLFKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSMTNLKYEDFENVIVTTKTMNALF 60

Query: 61  PEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXX------XXXXXXXXXXXXXRENQQ 114
           P K +    +G++ + L L E++     + +SW                        N+ 
Sbjct: 61  PNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNES 120

Query: 115 QAFNFEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQL----PRTIKPLILGSSD 170
           + +NF+ P+ A  K ++ISI++NF+K+SPIFSN+ ++K+++ +       I  L LG+SD
Sbjct: 121 KKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSD 180

Query: 171 RIASVKEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLG 230
           R+A+++++     TLV PEFITGF+ S +++L I             + A++VPSEGP+G
Sbjct: 181 RVAAIRKLTPENSTLVAPEFITGFVGSFISQLVILEVP--------NYKAVIVPSEGPIG 232

Query: 231 FEKLNLTVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           FEKL++  I +LID+ KE     DPK Y+ ES+R WK+AGS +GAQ+GLYI
Sbjct: 233 FEKLSIETISELIDICKENLNINDPK-YSNESHRLWKVAGSAMGAQTGLYI 282

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  200 bits (508), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 166/284 (58%), Gaps = 15/284 (5%)

Query: 1   MLFKQWNEFIEPRHQLDFPI-LSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPL 59
           MLFKQWNE  EPRH LD P+ +  +DESLQ   +P V  P+I +  + KI +TT +M+PL
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELPNINWNKFHKIFLTTGIMDPL 60

Query: 60  FPEKLIESKNLGKIETQLTLTEDQNAVNEDG-HSWXXXXXXXXXXXXXXXXRENQQQAFN 118
           FP++L+    LG I T  TLT D+N  +E+G +SW                  +  Q+  
Sbjct: 61  FPKELLGVMKLGDIRT--TLTIDRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLT 118

Query: 119 FEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPL-ILGSSDRIASVKE 177
           F   V A G  +++ +++NFLK+SPI  N I++ L+     T   L +LG+SDRI  +K 
Sbjct: 119 FVTTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELKS 178

Query: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237
           I+     L PPEF+TGFI S+LT+LT+ N           F+  + PSEG +GFEK+++ 
Sbjct: 179 ISHLRSDLQPPEFVTGFIGSILTQLTVKN---------IPFEGFIAPSEGAIGFEKMSMN 229

Query: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
            + +LID+   +W N + + Y  E YR+W+L    +G+ SGLY+
Sbjct: 230 TMPELIDICG-QWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  187 bits (476), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 166/293 (56%), Gaps = 53/293 (18%)

Query: 1   MLFKQWNEFIEPRHQLD----FPILSKNDESLQASPIPKVLFPSIAFQN---YEKIIITT 53
           MLFKQW+E+ EPRH +D     P   +N +SLQ +P+P V  P    Q+   YE+II+ T
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPD-TLQDITIYEQIIVAT 59

Query: 54  QLMNPLFPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQ 113
           +++ PLFP++++   +LG IE +L ++E                                
Sbjct: 60  RVLMPLFPKEILNFTSLGNIEVKLNVSE-------------------------------- 87

Query: 114 QQAFNFEFPVFAVG-KVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRI 172
             A   + P++    + +II + +N +++ PIF N+ISK +       +K LI G+SDRI
Sbjct: 88  ATAHLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRI 147

Query: 173 ASVKEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFE 232
           + +K IN   CTL+PPEFITGFI S++++L++   +        +F+  LVPSEGPLGFE
Sbjct: 148 SKIKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--------KFNGFLVPSEGPLGFE 199

Query: 233 KLNLTVIQDLID----LFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           KL L  ++ LI     + K    NL+ ++Y +E YRNW+L G+ +G QSGLYI
Sbjct: 200 KLTLETMEFLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  188 bits (477), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 159/289 (55%), Gaps = 18/289 (6%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNPL 59
           MLFK WNEF+EPRH LD P++  N ESLQA P+P V  P+   +          ++MNPL
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPL 60

Query: 60  FPEKLIESKNLGKIETQLTLTED--QNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAF 117
           F      +   G++ T L L E     A  E    W                RE+ + + 
Sbjct: 61  FNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTK-SI 119

Query: 118 NFEFPVFAVGKV--VIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASV 175
               P+  +  +  ++IS+ +NFLK+SPIF+N++++KL   L    K L++GSSD+I S 
Sbjct: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179

Query: 176 KEINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQ-FDAILVPSEGPLGFEKL 234
           K ++ + CTL PPEFITGF+  ++ EL          +N+F  F   +V SEGP GFEKL
Sbjct: 180 KMVSLNECTLQPPEFITGFLGGMIDELV---------KNRFSNFKGFIVQSEGPTGFEKL 230

Query: 235 NLTVIQDLIDLFKEEWP--NLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           +L  + +LID   +EW   N++   + E  ++ WKL G+ + AQSGLYI
Sbjct: 231 SLESMDELIDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  187 bits (476), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 111/285 (38%), Positives = 164/285 (57%), Gaps = 17/285 (5%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQ--NYEKIIITTQLMNP 58
           MLFKQWNE  EPR+ LD P L  N ESLQ  P+P V  P   F+  N +++I+TT+ M+ 
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDT 60

Query: 59  LFP-EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAF 117
            F  +K ++ K L  I   L + ++    +E  H+W                ++ +Q+ F
Sbjct: 61  FFLLDKTMKVKKLADITCSLEIPKNLQT-HEATHTWDFGENFPNEVEPL---QDEEQRTF 116

Query: 118 NFEFPVFAV-GKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVK 176
           +  FP++ +  + + +SI +NFL +SPIF+  IS  + ++L R  + +ILG SDRI   K
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEIVILGCSDRIEDTK 176

Query: 177 EINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNL 236
              ++ C+LVPPEF+TGF+ SL+++LT  N+ L        F A + PSEGP GFEKL+ 
Sbjct: 177 ICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQL--------FTAAIFPSEGPQGFEKLSS 228

Query: 237 TVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           T +  +ID F  +  + D   Y EE Y+ WK   S  GAQSGLY+
Sbjct: 229 TTVDSIID-FCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  151 bits (382), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 154/289 (53%), Gaps = 25/289 (8%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSK-NDESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNP 58
           MLFK WNE  EPRHQLD P     N ESLQ +P+P V+    I    + +I++ T+++ P
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 59  LFPEKLIESKNLGKIETQLTLTEDQNAVNE-DGHSWXXXXXXXXXXXXXXXXRENQQQAF 117
           LFP  +     +   E Q+T+     A+ +  G S+                 + + +  
Sbjct: 61  LFPSTICPMTTIS--EFQVTIPPQPTAIKKAHGSSYGDEDYEQESLP------DKKPEEI 112

Query: 118 NFEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIE--QLPRTIKPLILGSSDRIASV 175
              F V     ++ I I++NFL +SPI  N++S+++I   +   T++ ++LG+SDRI ++
Sbjct: 113 IVSFQVEKFNDILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTL 172

Query: 176 KEINDHTC--TLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEK 233
           K +        L PPEF+T   ASL+T L +H+           F +++ PSEGP GFEK
Sbjct: 173 KSVGSTLGLPDLEPPEFVTNCTASLITTLILHD---------LPFKSLIAPSEGPSGFEK 223

Query: 234 LNLTVIQDLID-LFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           L+L  +  L +  F+   P  +   Y EE +R W+L G+ +GAQ+GLYI
Sbjct: 224 LSLVSMDQLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  150 bits (380), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 152/291 (52%), Gaps = 34/291 (11%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKND-ESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNP 58
           MLFKQWNE+ EPRH LD P+    D +SLQ +P+P+V+    I    +++  I T +   
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 59  LFPEKLIESKNLGK-IETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAF 117
           LF ++L  ++ +   +    T   +Q+   ED  +                   +  +  
Sbjct: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQT--------------QEDSRSTDETK 106

Query: 118 NFEFPVFAVGK-VVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVK 176
             EFPV  +    + I ++++FL + PI  N++S++ I +L   ++ L+ GSSDR+  VK
Sbjct: 107 RLEFPVHKLDDGTLFICVREDFLHVPPISINLLSRE-IAKLCGGLEVLLFGSSDRVERVK 165

Query: 177 ------EINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLG 230
                  +      L PPE IT F AS++T+L           NK +FD  + PSEGP G
Sbjct: 166 YVGFPGNVGKGLPLLTPPELITNFTASIMTQLL---------SNKVRFDGYVAPSEGPSG 216

Query: 231 FEKLNLTVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           +EKL++  +  LIDL   E    + + Y +  +RNW+L G+V+GAQ+GLY+
Sbjct: 217 YEKLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 136/267 (50%), Gaps = 33/267 (12%)

Query: 24  NDESLQASPIPKV-LFPSIAFQNYEKIIITTQLMNPLFPEKLIESKNLGKIETQL-TLTE 81
           +  SLQ +P+P+V L   +   +++++ I T++   LF  KL  ++ +   E +  T   
Sbjct: 10  DSNSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTFEVKWQTKGR 69

Query: 82  DQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFNFEFPVFAVGK-VVIISIQDNFLK 140
           +Q+   ED                    +EN+  +     PV  + +   ++ + ++FL 
Sbjct: 70  EQHLYRED------------FQVQEDCTKENE--SCGLSIPVLKIDEDTFLLCVAEDFLH 115

Query: 141 ISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVKEIN------DHTCTLVPPEFITGF 194
           + PI  N++S+++  +L R ++ L++G+SDRI  VK +       +    L PPE IT F
Sbjct: 116 VPPIVGNLLSQEMA-KLCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSF 174

Query: 195 IASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLTVIQDLIDLFKEEWPNLD 254
            AS+ T+L +          K  FD  + PSEGP G+EKL++  +  LIDL   E    +
Sbjct: 175 TASITTQLLL---------CKVPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGN 225

Query: 255 PKVYAEESYRNWKLAGSVLGAQSGLYI 281
              Y +E++RNW+L G+  G Q+GLY+
Sbjct: 226 RDEYVKETHRNWRLHGTSTGTQTGLYL 252

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 80/284 (28%), Positives = 134/284 (47%), Gaps = 26/284 (9%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFPSIAFQNYEKIIITTQLMNPLF 60
           M+FKQW     PRHQ+   I S +  SL  SP P +   +   + YEK I     +  L 
Sbjct: 1   MIFKQWEFDRIPRHQVQ-SINSADPTSLLLSPEPVITLDNDINKGYEKAIALPSSLTWLL 59

Query: 61  PEKLIESKNLGKIETQLTLTEDQNAVN-EDGHSWXXXXXXXXXXXXXXXXRENQQQAFNF 119
           P  LI  K +  +   L  + + + V  ED ++                  +   +    
Sbjct: 60  PADLIHFKQISCLTAVLKQSSNPDPVEIEDVNT----------SGFYEVDVKPSTKEVRA 109

Query: 120 EFPVFAVG-KVVIISIQDNFLKISPIFSNIISKKLIEQLPRTI-KPLILGSSDRIASVKE 177
            +P++ +    +++ I+++ L+  PI  N ++  L + L   I K  +L +SD+I   K 
Sbjct: 110 SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKIIGFKS 169

Query: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237
           +++    L PPEFI G +A+++T L       Q+   +FQ + ++V SEGP G+E  N+T
Sbjct: 170 LSE----LQPPEFIAGALAAIVTALNS-----QSSSKEFQHEIMVVQSEGPRGYEIHNIT 220

Query: 238 VIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
           V+  L++  K      +   Y   +YR WK + S    QSGLY+
Sbjct: 221 VVDLLVEYMKSTLGYSEE--YVTSAYRRWK-SNSASQFQSGLYL 261

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 128/287 (44%), Gaps = 36/287 (12%)

Query: 1   MLFKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP--SIAFQNYEKIIITTQLMNP 58
           + FKQW     PRHQ+D P++  +  SL     P V     S+    Y   I+    +  
Sbjct: 2   LTFKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKW 60

Query: 59  LFPEKLIESKNLGKIETQLTLTEDQNAVNEDGHSWXXXXXXXXXXXXXXXXRENQQQAFN 118
           L P+ +I   ++G I   L+   +  ++      +                  N  + F 
Sbjct: 61  LLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMI-----------NSTEQFV 109

Query: 119 FEFPVFAVGKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPL-ILGSSDRIASVKE 177
             + ++ +   +I  I +N +K   I +N +++ L  QL R IK + IL +SD+I  +K+
Sbjct: 110 IHYNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQ 168

Query: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLT 237
           ++     LVPPEFITG I + +  L            + +   I+VPSEGP+GFEK N  
Sbjct: 169 LS----YLVPPEFITGSITNFILALP-----------RKELKVIVVPSEGPIGFEKYNFP 213

Query: 238 VIQDLIDLFKE---EWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281
            +  L+D   +    +P+   + Y  E  + WKL       Q GLYI
Sbjct: 214 TVDALVDEMSKLLCSYPS-QTEYYVSECLKLWKL-DECTTTQGGLYI 258

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 93/159 (58%), Gaps = 25/159 (15%)

Query: 127 GKVVIISIQDNFLKISPIFSNIISKKLIEQLPRTI--KPLILGSSDRIASVKEINDHTCT 184
           G++V++ +++N LK  PI  N ++++L E+L R +  +  +L +SD+   VK++ +    
Sbjct: 97  GQLVVV-VEENDLKYPPIVHNRLAQQLAEKL-RAVGAETTVLVNSDKSTGVKDLEE---- 150

Query: 185 LVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLGFEKLNLTVIQDLID 244
           LVPPEFITG +A+L+  L        +G  +     ++V SEGP GFEK NLTV+  L++
Sbjct: 151 LVPPEFITGALAALVCALA------PSGAGRV----LVVQSEGPHGFEKHNLTVVDALVE 200

Query: 245 LFKEEWPNLD-PKVYAEESYRNWKL-AGSVLGAQSGLYI 281
             ++    LD P  Y     R+WKL AGS    Q GLY+
Sbjct: 201 RVRQ---ILDQPPEYVAACTRHWKLQAGSQF--QGGLYL 234

>KAFR0C05570 Chr3 (1111854..1112639) [786 bp, 261 aa] {ON} Anc_5.511
           YML041C
          Length = 261

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 137 NFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVKEINDHTCTL 185
           N L  S IF+N+ +KK  + LP      I G  D I+S    ND  C+L
Sbjct: 199 NQLDKSIIFNNVYNKKYFKVLPLITTCSICGGYDSISSCVNCNDKICSL 247

>Kwal_33.14890 s33 complement(860237..863164) [2928 bp, 975 aa] {ON}
           YGR240C (PFK1) - phosphofructokinase alpha subunit
           [contig 100] FULL
          Length = 975

 Score = 32.0 bits (71), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 8/37 (21%)

Query: 244 DLFKEEWPNL------DPKVYAE--ESYRNWKLAGSV 272
           DLF+ EWP+L      D K  AE  E YRN K+ G V
Sbjct: 307 DLFRSEWPSLVEELVQDGKFTAEQVEPYRNLKIVGLV 343

>Ecym_6149 Chr6 (273459..276044) [2586 bp, 861 aa] {ON} similar to
           Ashbya gossypii ACL187W
          Length = 861

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 112 NQQQAFNFEFPVFAVGKVVIIS--IQDNFLKISPIFSNIISKKLIEQ-LPRTIKPLILGS 168
           NQ Q+   +  V AVG +  IS  ++D+F K +P F N++   +  Q   R +KP +L  
Sbjct: 649 NQVQS---QVSVTAVGLIADISNSLEDDFKKFAPAFMNVLGTMISSQEAKRELKPAVLSV 705

Query: 169 SDRIAS 174
              IAS
Sbjct: 706 FGDIAS 711

>ACL187W Chr3 (30322..32907) [2586 bp, 861 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR347C (KAP95)
          Length = 861

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 120 EFPVFAVGKVVIIS--IQDNFLKISPIFSNIISKKLIEQLPRT-IKPLILGSSDRIAS 174
           +  V AVG +  IS  ++D+F K +P F N++   +  Q  R  +KP +L     IAS
Sbjct: 654 QVSVTAVGLIADISNSLEDDFKKFAPAFMNVLGSMISSQDARMELKPAVLSVFGDIAS 711

>Suva_7.124 Chr7 complement(237479..241141) [3663 bp, 1220 aa] {ON}
           YGL140C (REAL)
          Length = 1220

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 15  QLDFPILSKNDESLQASPIPKVLFPS---IAFQNYEKIIITTQLMNPL 59
           QL+F +L++ND  L++  +  +  P    I+F N EK++     ++P+
Sbjct: 309 QLEFILLARNDNKLKSDDVAALTLPKNKEISFANAEKLLKVIDKLHPV 356

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,645,218
Number of extensions: 1265215
Number of successful extensions: 3806
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3806
Number of HSP's successfully gapped: 33
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)