Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E021507.128ON1851859791e-137
NDAI0E036907.128ON1961925641e-73
Smik_9.1857.128ON1821864735e-60
YIL009C-A (EST3)7.128ON1811874701e-59
Skud_9.1637.128ON1801884571e-57
KAFR0L004807.128ON1801874059e-50
Suva_9.1957.128ON1891943953e-48
Sklu_YGOB_EST37.128ON1961873946e-48
Zrou_YGOB_EST37.128ON1681813901e-47
TDEL0H029007.128ON1881873651e-43
KNAG0L009607.128ON1851883372e-39
CAGL0C03828g7.128ON1801833222e-37
ADL016C7.128ON2021833061e-34
Kpol_1062.557.128ON1821893023e-34
TPHA0C043107.128ON2012063033e-34
Kwal_YGOB_EST37.128ON1921892972e-33
KLLA0D14289g7.128ON1841872572e-27
TBLA0A009607.128ON2151282495e-26
Kthe_YGOB_EST37.128ON1931842277e-23
ZYRO0C05258gsingletonOFF87941883e-18
Sklu_YGOB_Anc_7.128singletonOFF98971744e-16
Kwal_55.20848singletonOFF96971274e-09
KLTH0F12606gsingletonOFF96961021e-05
ZYRO0B13640g4.301ON651110730.54
NCAS0J012604.217ON65180682.2
Ecym_31785.301ON110175639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E02150
         (185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   381   e-137
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   221   1e-73
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   186   5e-60
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   185   1e-59
Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   180   1e-57
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   160   9e-50
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   156   3e-48
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   156   6e-48
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   154   1e-47
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   145   1e-43
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   134   2e-39
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   128   2e-37
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   122   1e-34
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   120   3e-34
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   121   3e-34
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   119   2e-33
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...   103   2e-27
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...   100   5e-26
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    92   7e-23
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    77   3e-18
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    72   4e-16
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    54   4e-09
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    44   1e-05
ZYRO0B13640g Chr2 (1105756..1107711) [1956 bp, 651 aa] {ON} weak...    33   0.54 
NCAS0J01260 Chr10 (217723..219678) [1956 bp, 651 aa] {ON} Anc_4....    31   2.2  
Ecym_3178 Chr3 (339229..342534) [3306 bp, 1101 aa] {ON} similar ...    29   9.3  

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  381 bits (979), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/185 (100%), Positives = 185/185 (100%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120

Query: 121 LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFPF 180
           LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFPF
Sbjct: 121 LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFPF 180

Query: 181 VYSTL 185
           VYSTL
Sbjct: 181 VYSTL 185

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  221 bits (564), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 136/192 (70%), Gaps = 7/192 (3%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MPRVILSSK + +DS+FLQPWI  ++R+ +Q KTYLPGNQ+  +  L+  D+ AP+ S  
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRDMDAPEISET 60

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           +L N+ HF KVTKFF +NNY I ASIRDS +Q+LVEFTP+CV  FER +  R+TSET+NC
Sbjct: 61  ILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQILVEFTPQCVLEFERVYRSRITSETVNC 120

Query: 121 LLVIGDAAIIYKSRDQITTQFGNIDFI-------ISKNVSPLVPILQINQASLFDGDQVQ 173
           L VIGD  +IYK+R QI + F   D          +KN   L P+LQINQASLFD DQVQ
Sbjct: 121 LFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSDQVQ 180

Query: 174 HLRSFPFVYSTL 185
            L  FPF+Y+ L
Sbjct: 181 LLFEFPFIYNKL 192

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  186 bits (473), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 94/186 (50%), Positives = 128/186 (68%), Gaps = 5/186 (2%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MPRV+L S    TDSIFLQPWI+ L+ ++ +   Y P +    +P L E DL+ P  S K
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHV--IPVLTEQDLKLPHMSAK 58

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ-LLVEFTPKCVSNFERRHHRRLTSETLN 119
           +LTN CHF K+T+F+ + +Y + ASIRDS  Q LLVEF+P+CVSNFER H+ R+T+ET+N
Sbjct: 59  ILTNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVN 118

Query: 120 CLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFP 179
           CL++IGDA++I  +  ++ + F      IS N   LVP+LQINQ ++FD DQV  L +FP
Sbjct: 119 CLMIIGDASLINATSSRVKSHFKIRLSSISSN--DLVPVLQINQVTIFDIDQVGSLSAFP 176

Query: 180 FVYSTL 185
           FVY  L
Sbjct: 177 FVYKYL 182

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  185 bits (470), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 125/187 (66%), Gaps = 8/187 (4%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MP+VIL S    TDS+FLQPWI+ L+ ++ +   Y P      +PSL + DL  P  SP 
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHV--IPSLTKQDLALPHMSPT 58

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           +LTN CHF K+TKF+ + +Y + ASIRDS  Q+LVEF+ +CVSNFER H+ R+TSET NC
Sbjct: 59  ILTNPCHFAKITKFYNVCDYKVYASIRDSSHQILVEFSQECVSNFERTHNCRITSETTNC 118

Query: 121 LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSP--LVPILQINQASLFDGDQVQHLRSF 178
           L++IGDA ++Y +  +  + F     I   N+S   +VP+L +NQA++FD DQV  L +F
Sbjct: 119 LMIIGDADLVYVTNSRAMSHFK----ICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTF 174

Query: 179 PFVYSTL 185
           PFVY  L
Sbjct: 175 PFVYKYL 181

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  180 bits (457), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 132/188 (70%), Gaps = 11/188 (5%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MPR+IL S     DSIFLQPWI+ L++++  +  + P   +R +PSL   DL  P  S +
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQ--HRPS--ERVIPSLTRQDLLVPHMSAQ 56

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ-LLVEFTPKCVSNFERRHHRRLTSETLN 119
           +LTN CHFTK+T+F+ ++NY + ASIRDS  Q LLVEF+ +CVS+FER H+ R+TSET+N
Sbjct: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116

Query: 120 CLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSP--LVPILQINQASLFDGDQVQHLRS 177
           CL++IGDA +IY + +Q+  +F     I   ++SP  ++P+L+INQ ++FD DQV  L +
Sbjct: 117 CLMIIGDADLIYVTSNQVMARFK----IRVSSISPNEILPVLKINQTTIFDIDQVGSLST 172

Query: 178 FPFVYSTL 185
           FPFVY  L
Sbjct: 173 FPFVYKFL 180

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  160 bits (405), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 91/187 (48%), Positives = 122/187 (65%), Gaps = 11/187 (5%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCS-P 59
           MP V L+S+ ++ DSIF+  WI+ LL E+ Q    L     R +P +N  ++R P  S P
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQG---LLRPIYRAIPPINNTNVRNPLSSRP 57

Query: 60  KVLTNH--CHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSET 117
            +LT    CHFTK+ KF+K+ N+ I ASIRD+RFQ+LVEFTP CVS FER +  RLTS+T
Sbjct: 58  SLLTTKVKCHFTKIVKFYKVENFKIFASIRDTRFQILVEFTPHCVSTFERTNRCRLTSDT 117

Query: 118 LNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRS 177
            NC L+IGD +I YKS  +I+  +  ++F   +    L+P+L INQAS+ D DQ   L  
Sbjct: 118 TNCTLLIGDCSIEYKSSHEISQNY-RLNFPNKR----LLPVLTINQASILDRDQATLLEQ 172

Query: 178 FPFVYST 184
           FPFVYST
Sbjct: 173 FPFVYST 179

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  156 bits (395), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 86/194 (44%), Positives = 124/194 (63%), Gaps = 14/194 (7%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MPRV L S   Q DSIFLQPWI+ L+ ++  +  ++P +    +P+L + DL  P   P+
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDN-SEHHHIPSDHV--IPALAQQDLALPHMCPQ 57

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ---------LLVEFTPKCVSNFERRHHR 111
           +LTN  HF ++T+F+ + +Y + AS+RDS  Q         +LVEF+ KCVS+FER ++ 
Sbjct: 58  ILTNPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNF 117

Query: 112 RLTSETLNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQ 171
           R+TSET NCL++IGDA + Y +  Q   +F  +  + S + S  VPIL INQA++FD DQ
Sbjct: 118 RITSETTNCLMIIGDADLAYVTSTQALARF--MIRLSSISTSETVPILIINQATIFDIDQ 175

Query: 172 VQHLRSFPFVYSTL 185
           V  L +FPFVY  L
Sbjct: 176 VGSLNNFPFVYKYL 189

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  156 bits (394), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 121/187 (64%), Gaps = 4/187 (2%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAP-QC 57
           MP+V LSS+  ++DSI+L  WI   +   +++K  +   G+ +  VPSL++ D+ +    
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 58  SPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSET 117
           S K++ NH HF K+TKF+++NNY + AS RDS   +LVEFT  CVSNFER HH R+TSET
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSILVEFTACCVSNFERLHHSRITSET 120

Query: 118 LNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRS 177
            N L VIGD  +++  +  ++ +FG ID         LVPIL++NQA ++D DQV+  R 
Sbjct: 121 TNTLFVIGDVKLVFMDKASVSQKFG-IDITQFNPQLNLVPILRVNQAFVYDMDQVESNRK 179

Query: 178 FPFVYST 184
           FPF Y +
Sbjct: 180 FPFFYQS 186

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  154 bits (390), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (64%), Gaps = 15/181 (8%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MP+ I+S K    DS+FLQPWI+  L E      + P    R +P +   DL  P+ S K
Sbjct: 1   MPQAIVSVK--PFDSVFLQPWIQTALAE------HDPRLGDRLIPPVPTQDLSQPELSSK 52

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           VL+N  HF KVT+FF +++Y + ASIRDS+ QLLVEFTP+CVS+FERR++ R+T+ET NC
Sbjct: 53  VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLLVEFTPQCVSDFERRYYTRITAETTNC 112

Query: 121 LLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFPF 180
           + +I D  +IY S   I   +     I+++  +   P+L++NQ ++FD DQV+ L ++P 
Sbjct: 113 VFIIADCQLIYHSPSYIENHYK----IVTRGET---PVLRVNQTAIFDWDQVESLETYPL 165

Query: 181 V 181
           V
Sbjct: 166 V 166

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  145 bits (365), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 74/187 (39%), Positives = 109/187 (58%), Gaps = 4/187 (2%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MP+ ILSS   Q D++FL PWIE  +   +  ++ +       +P L   DLR PQ SP+
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           +L N  HF KV KF  +N + + A++RDS  Q+LVEFTP+CVS FER H  R+T ET + 
Sbjct: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQILVEFTPQCVSEFERTHRSRITLETEHS 120

Query: 121 LLVIGDAAIIYKSRDQITTQFG----NIDFIISKNVSPLVPILQINQASLFDGDQVQHLR 176
           L +I D  + ++ R+ I   FG    N     +      +P+L +NQAS F+ DQ++   
Sbjct: 121 LFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESFE 180

Query: 177 SFPFVYS 183
            FP++Y+
Sbjct: 181 HFPYLYT 187

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  134 bits (337), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 115/188 (61%), Gaps = 12/188 (6%)

Query: 1   MPRVILSSKLSQT-----DSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAP 55
           MP V    KLSQT     + IF  PWI+ L++   ++ + +   +Q  +P L   DL+ P
Sbjct: 1   MPAV----KLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQI-IPKLTTNDLKNP 55

Query: 56  QCSPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTS 115
             S +VL N  HF KV KF+ ++NY + A IRDS  QLLVEF P+CVS FER HH R+TS
Sbjct: 56  TRSKRVLKNKTHFAKVMKFYSVHNYKVFACIRDSECQLLVEFHPECVSYFERFHHCRITS 115

Query: 116 ETLNCLLVIGDAAIIYKSRDQITTQFGNIDFIISK-NVSPLVPILQINQASLFDGDQVQH 174
            T+NCL VIG+  + Y+S  ++  +F  I+ +  K  +   +P+L INQA++ D  Q++ 
Sbjct: 116 GTVNCLFVIGNCDLEYRSVARVNDEF-RINILPRKQKLMDQIPVLVINQATVADWGQMEA 174

Query: 175 LRSFPFVY 182
             +FPFV+
Sbjct: 175 QTTFPFVH 182

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  128 bits (322), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 108/183 (59%), Gaps = 7/183 (3%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
           MP  I  S+ +  +S++L  W+  +L ES   KT         +P ++  +   P  S +
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDMLLES---KT---SQNIAVIPRVDPDEASIPLLSRR 54

Query: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNC 120
           +  N  HF K+TKFF+++NY++ AS++DS+ Q+L +FTPKCVS FE R+  R+TS+T+N 
Sbjct: 55  IYANRRHFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESRNRSRITSDTVNT 114

Query: 121 LLVIGDAAIIYKSRDQITTQFGN-IDFIISKNVSPLVPILQINQASLFDGDQVQHLRSFP 179
           L +IGDA +     D++   FG  I  + +    P +P L INQA + D DQV+  +  P
Sbjct: 115 LFMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFKMTP 174

Query: 180 FVY 182
           FVY
Sbjct: 175 FVY 177

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  122 bits (306), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 64/183 (34%), Positives = 107/183 (58%), Gaps = 6/183 (3%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQRE--VPSLNEADLRAPQCS 58
           MP+V+L+S+  + DSIFL+ W+   +  +L++          E  +P+L  A        
Sbjct: 1   MPKVVLASRAHKADSIFLREWLVDAVVPALERSGACAPWAGVECFIPALPPATATL-SLE 59

Query: 59  PKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETL 118
           P V+ N   F ++ +F +++++A+ A  RD+   +LVEFTP CVSNFERR+H+R+TS T+
Sbjct: 60  PTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCILVEFTPHCVSNFERRYHQRITSSTV 119

Query: 119 NCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSF 178
           N L VIG+ ++++ +R      F   +     N S  +P+L++   ++FD DQV+  R F
Sbjct: 120 NSLFVIGNTSLLFYARSDAAAAF---EVPALMNGSSTLPVLRVGDCAIFDQDQVESHRRF 176

Query: 179 PFV 181
           P V
Sbjct: 177 PLV 179

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  120 bits (302), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 105/189 (55%), Gaps = 14/189 (7%)

Query: 1   MPRVIL-SSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSP 59
           MP++IL S+K S  DS +LQ WI+ ++  +         N    +P L+E      Q   
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRNYD-------NTGEVIPILDEYGFNDSQSYM 53

Query: 60  KVLTNHC-----HFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLT 114
             + N       HF KVT FF + +Y++ ASIRD +FQ+L EFT  CVS+FER ++ R+T
Sbjct: 54  SSVINLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVLSEFTSNCVSSFERLYNSRIT 113

Query: 115 SETLNCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQH 174
             T+NCL +IGD  + + +  +I  +   +D     N + L P+L INQA +FD  Q++ 
Sbjct: 114 ENTINCLFLIGDCKLKFMTYWEI-KELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKS 172

Query: 175 LRSFPFVYS 183
              F ++Y+
Sbjct: 173 FEKFDWIYN 181

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  121 bits (303), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 111/206 (53%), Gaps = 28/206 (13%)

Query: 1   MPRVILSSKLSQT-DSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSP 59
           MP++IL SK++ + DSIFL+PWI+  + +  +      GN       LN  +++      
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGKKNSIGKIGNLDE---LLNNTNVKLQL--- 54

Query: 60  KVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLN 119
            +L       K+T  + I NY +  SIRD++ QLLVEFT  CVSNFER +  R+T +T N
Sbjct: 55  -ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQLLVEFTSNCVSNFERNYKIRITDQTKN 113

Query: 120 CLLVIGDAAIIYKSRDQITT-------QFGN------------IDFIIS-KNVSPLVPIL 159
           CL +IGD  I Y + D++         QF N              +I+S +  + L PIL
Sbjct: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173

Query: 160 QINQASLFDGDQVQHLRSFPFVYSTL 185
           Q+NQ  +FD DQV    ++PFVYS +
Sbjct: 174 QVNQVMIFDWDQVVTFENYPFVYSQI 199

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  119 bits (297), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAP-QC 57
           MP+     K  Q +S FL+ WI+  + E ++    LP     +R VPS+  +D   P Q 
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQL 58

Query: 58  SPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSET 117
           S ++L N  HF K+T F KI+N+A+ AS RD   Q+LVEFTPKCVS FERRH  R+T+ T
Sbjct: 59  SSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQILVEFTPKCVSQFERRHGLRITART 118

Query: 118 LNCLLVIGDAAI----IYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQ 173
           +N + +IG   I    IY+ R+       ++D  I     P++P+L +N+ ++FD DQV+
Sbjct: 119 VNTIFLIGAVTIKYIPIYEVRETWCWA-SDLDTRI-----PVLPVLVVNECTVFDLDQVE 172

Query: 174 HLRSFPFVY 182
             R F ++Y
Sbjct: 173 SRRKFNYLY 181

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score =  103 bits (257), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 101/187 (54%), Gaps = 7/187 (3%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQK--KTYLPGNQQREVPSLNEADLRAPQCS 58
           MP V+LSS+L+  DS+FLQ WI+  +R    K  KT     Q+  V  L E D+      
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 59  PKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETL 118
             +      F ++ KF ++N+Y + A+IRDS   +L  FT  CV ++E  ++ R+T  TL
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDSTALILCYFTVDCVLDYETINNDRITLNTL 120

Query: 119 NCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSF 178
           N L VIG+  + + +  +    F N DF   +    +VP+L+I +A +FD DQ+     F
Sbjct: 121 NTLFVIGNVTLQFWNHRECKLWF-NQDFPGLR----MVPVLKIEKARMFDRDQISSNVQF 175

Query: 179 PFVYSTL 185
            +VY TL
Sbjct: 176 EWVYDTL 182

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score =  100 bits (249), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 78/128 (60%), Gaps = 12/128 (9%)

Query: 67  HFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNCLLVIGD 126
           H  K+TKFFK+NNY I AS++D+  Q+LVE TP CV+ +ER+   R+TS TL+CL VIGD
Sbjct: 91  HIIKITKFFKVNNYKICASVQDAECQILVELTPICVTEYERKTRDRMTSNTLDCLFVIGD 150

Query: 127 AAIIYKSRDQITTQFGNIDFIISKNVSP---------LVPILQINQASLFDGDQVQHLRS 177
             + +++++++   F    F   +N+ P         L+P+L INQ    D    + L +
Sbjct: 151 CRLYFQNKNEVLHNFNCNTF---RNIIPGLNALDRDSLIPVLVINQIICVDRHPSKSLST 207

Query: 178 FPFVYSTL 185
            PF++S L
Sbjct: 208 LPFLHSYL 215

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 92.0 bits (227), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 105/184 (57%), Gaps = 5/184 (2%)

Query: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAPQCS 58
           M +++ S+K  Q +S+FL+ WI   +   +++   LP        VP L +     P  S
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 59  PKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETL 118
            ++L N  HF K+T F ++  +A+ AS RD+  ++LVEFTP+CVS FER +  R+T++T+
Sbjct: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRILVEFTPQCVSAFERLNSIRITAKTV 119

Query: 119 NCLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSPLVPILQINQASLFDGDQVQHLRSF 178
           N +L+IG   + Y    +  TQ+     I      P+VP+L + Q ++FD DQV+   SF
Sbjct: 120 NTILLIGSGTLKYLPVHEAYTQWSLS--IPLDPRVPVVPVLVVEQCAVFDLDQVEARPSF 177

Query: 179 PFVY 182
            ++Y
Sbjct: 178 DYLY 181

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 77.0 bits (188), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 58/94 (61%), Gaps = 8/94 (8%)

Query: 1  MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60
          MP+ I+S K    DS+FLQPWI+  L E      + P    R +P +   DL  P+ S K
Sbjct: 1  MPQAIVSVK--PFDSVFLQPWIQTALAE------HDPRLGDRLIPPVPTQDLSQPELSSK 52

Query: 61 VLTNHCHFTKVTKFFKINNYAISASIRDSRFQLL 94
          VL+N  HF KVT+FF +++Y + ASIRDS+ QLL
Sbjct: 53 VLSNIRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 71.6 bits (174), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (63%), Gaps = 3/97 (3%)

Query: 1  MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAP-QC 57
          MP+V LSS+  ++DSI+L  WI   +   +++K  +   G+ +  VPSL++ D+ +    
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 58 SPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLL 94
          S K++ NH HF K+TKF+++NNY + AS RDS   +L
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 53.5 bits (127), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (55%), Gaps = 5/97 (5%)

Query: 1  MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAP-QC 57
          MP+     K  Q +S FL+ WI+  + E ++    LP     +R VPS+  +D   P Q 
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSD--GPMQL 58

Query: 58 SPKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLL 94
          S ++L N  HF K+T F KI+N+A+ AS RD   Q+L
Sbjct: 59 SSQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 1  MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLP--GNQQREVPSLNEADLRAPQCS 58
          M +++ S+K  Q +S+FL+ WI   +   +++   LP        VP L +     P  S
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 59 PKVLTNHCHFTKVTKFFKINNYAISASIRDSRFQLL 94
           ++L N  HF K+T F ++  +A+ AS RD+  ++L
Sbjct: 61 -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95

>ZYRO0B13640g Chr2 (1105756..1107711) [1956 bp, 651 aa] {ON} weakly
           similar to uniprot|Q06411 Saccharomyces cerevisiae
           YLR424W SPP382 Essential protein present in native
           splicing complexes identified as a suppressor of prp38-1
           a spliceosomal maturation mutation cold sensitive
           alleles accumulate pre-mRNA
          Length = 651

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 8/110 (7%)

Query: 80  YAISASIRDSRFQLLVEFTP-KCVSNFERRHHRRLTSETLNCLLVIGDAAIIYKSRDQIT 138
           + +S  I D   Q L E    K  + F++ HHRR      + L+VI D     K  D I 
Sbjct: 362 FDLSFLILDETLQKLEEIVESKLYAYFDKWHHRRSKVIRRSDLMVIQDLLGEEKFVDIIR 421

Query: 139 TQF--GNIDFIISKNVSPLVPILQINQASLFDGD--QVQHLRSFPFVYST 184
           T F    ID +  K      P+L++   SL DG     Q LR +  +++T
Sbjct: 422 TNFLPKFIDQLWDKYFD---PVLELEDPSLDDGSLYYYQRLREYRLLFNT 468

>NCAS0J01260 Chr10 (217723..219678) [1956 bp, 651 aa] {ON} Anc_4.217
          Length = 651

 Score = 30.8 bits (68), Expect = 2.2,   Method: Composition-based stats.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 14  DSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEA--DLRAPQCSPKVLTNHCHFTKV 71
           D++ +   +E  L+++       PG Q+  V +  E    LR    + K+  +H H TKV
Sbjct: 256 DNVIINHLVETFLKDN-------PGCQKETVINSKETMQRLREAAETAKIELSHVHTTKV 308

Query: 72  TKFFKINNYAISASIRDSRF 91
              F +NNY ++  +++   
Sbjct: 309 EIPFLVNNYHLNMELKEEEL 328

>Ecym_3178 Chr3 (339229..342534) [3306 bp, 1101 aa] {ON} similar to
           Ashbya gossypii AAL080W
          Length = 1101

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 74  FFKINNYAISASIRDSRFQLLVEFTPKCVSNFERRHHRRLTSETLNCLLVI--GDAAIIY 131
           FFK+N +    +    R  +L  F        E+  HR L  E LN ++V+  GDA + Y
Sbjct: 42  FFKLNTFY---TFLIGRKHVLTSFET-LKGPIEQSIHRELKIEDLNKIVVLMPGDAVLKY 97

Query: 132 KSRDQITTQFGNIDF 146
              +QI T+    DF
Sbjct: 98  VDMNQICTETKIFDF 112

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,401,321
Number of extensions: 714696
Number of successful extensions: 1908
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1898
Number of HSP's successfully gapped: 30
Length of query: 185
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 82
Effective length of database: 41,670,801
Effective search space: 3417005682
Effective search space used: 3417005682
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)