Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E021407.127ON48148125010.0
NDAI0E036807.127ON44445019330.0
YPL259C (APM1)7.127ON47547519240.0
Suva_16.457.127ON47847819240.0
Skud_16.197.127ON47647619190.0
Smik_6.4667.127ON47647818990.0
KNAG0L009507.127ON46146018500.0
Kpol_1062.567.127ON45045018470.0
ZYRO0C05236g7.127ON44744918430.0
TBLA0A009507.127ON46946718380.0
SAKL0F05346g7.127ON44744918330.0
TDEL0H028907.127ON44244918320.0
CAGL0K00539g7.127ON45645618190.0
KAFR0L004707.127ON46546918140.0
KLTH0F12584g7.127ON44144817920.0
Ecym_83507.127ON44544917930.0
Kwal_55.208437.127ON44144817870.0
ADL017C7.127ON44344917830.0
TPHA0C043207.127ON45445217570.0
KLLA0D14311g7.127ON44344917190.0
Ecym_52393.165ON4644725792e-68
KLTH0F06534g3.165ON4664835461e-63
SAKL0C07414g3.165ON4824985297e-61
Kwal_33.141823.165ON4674785252e-60
KLLA0C03894g3.165ON4754815087e-58
TBLA0F008403.165ON4814945052e-57
TDEL0D045803.165ON4824915026e-57
NCAS0C035803.165ON4914984973e-56
NDAI0G029203.165ON4864274817e-54
ADR315W3.165ON4923894801e-53
SAKL0D13090g2.555ON4995264782e-53
Kpol_1045.443.165ON4694344737e-53
CAGL0C05203g3.165ON4754914622e-51
KLTH0D07502g2.555ON5045384609e-51
ZYRO0B04840g3.165ON4764944581e-50
YOL062C (APM4)3.165ON4915014537e-50
Suva_15.1033.165ON4915014511e-49
Kwal_26.81462.555ON5055354442e-48
Skud_15.913.165ON4915014389e-48
Smik_15.963.165ON4915014362e-47
ABR047W2.555ON4984714328e-47
TPHA0P006603.165ON4734284231e-45
KLLA0F25432g2.555ON5075344082e-43
Ecym_45912.555ON5014863881e-40
KNAG0K011503.165ON4744873562e-36
TDEL0B064302.555ON5253323391e-33
Kpol_1056.132.555ON5413493372e-33
TPHA0I023902.555ON5593423373e-33
ZYRO0E05874g2.555ON5493413222e-31
KAFR0A020602.555ON5403413213e-31
KAFR0C010203.165ON4284703155e-31
CAGL0K03223g2.555ON5983723197e-31
Smik_8.232.555ON6033663153e-30
Skud_8.262.555ON5963663126e-30
KNAG0C055502.555ON5823523054e-29
NCAS0A126502.555ON5883493055e-29
YHL019C (APM2)2.555ON6053703046e-29
Suva_8.332.555ON5963682913e-27
NDAI0B016102.555ON6722442355e-20
TBLA0B067602.555ON6572332133e-17
SAKL0A09218g2.522ON4732731679e-12
AGL061W2.522ON4111371596e-11
KLTH0D06556g2.522ON4563131501e-09
ZYRO0B01738g2.522ON4921501454e-09
TPHA0C041302.522ON5331481455e-09
KAFR0D035602.522ON4551631411e-08
TBLA0I006202.522ON6091531402e-08
TDEL0A029702.522ON4963301393e-08
KLLA0E18789g2.522ON4971511365e-08
Kwal_26.79572.522ON4563081356e-08
Suva_4.5482.522ON4841381152e-05
Kpol_1018.422.522ON5751531062e-04
Skud_2.4192.522ON4841371062e-04
YBR288C (APM3)2.522ON4831421053e-04
Smik_2.4302.522ON4841341035e-04
ZYRO0E09746g3.575ON5381421028e-04
KLLA0D11396g3.575ON5361401010.001
NCAS0A048702.522ON489329940.006
CAGL0L02145g2.522ON543152900.018
NDAI0K019302.522ON612158880.039
KLTH0G00528g3.575ON633140860.057
Ecym_72662.522ON517135860.057
Ecym_60073.575ON537140860.060
TBLA0E001403.575ON543142860.065
NCAS0F040103.575ON547142850.072
Kwal_0.348singletonOFF13285790.11
Kwal_47.192923.575ON538140810.21
KNAG0A069702.522ON505147810.22
Smik_7.3713.575ON598131810.23
AFR274C3.575ON532140810.24
YFR051C (RET2)3.575ON546122800.33
Skud_6.1423.575ON546122790.42
CAGL0A04741g3.575ON536142790.43
SAKL0F00594g3.575ON545140751.1
TDEL0D064303.575ON536142751.2
CAGL0J08888g7.323ON46559751.4
TPHA0D016402.266ON56536741.8
Suva_12.63.575ON546122741.8
TPHA0G037003.575ON539148732.2
Kpol_1052.324.296ON1878113732.4
KLTH0H11770g1.388ON15695693.2
SAKL0D08074g1.388ON15687684.5
Kpol_380.133.575ON535146696.7
KAFR0L019708.853ON93271689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E02140
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   967   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   749   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   745   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   745   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   743   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   736   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   717   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   716   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   714   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   712   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   710   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   710   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   705   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   703   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   694   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   695   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   692   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   691   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   681   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   666   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   227   2e-68
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   214   1e-63
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   208   7e-61
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   206   2e-60
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   200   7e-58
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   199   2e-57
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   197   6e-57
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   196   3e-56
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   189   7e-54
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   189   1e-53
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   188   2e-53
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   186   7e-53
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   182   2e-51
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   181   9e-51
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   181   1e-50
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   179   7e-50
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   178   1e-49
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   175   2e-48
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   173   9e-48
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   172   2e-47
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   171   8e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   167   1e-45
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   161   2e-43
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   154   1e-40
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   141   2e-36
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   135   1e-33
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   134   2e-33
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   134   3e-33
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   128   2e-31
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   128   3e-31
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   125   5e-31
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   127   7e-31
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   125   3e-30
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   124   6e-30
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   122   4e-29
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   122   5e-29
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   121   6e-29
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   116   3e-27
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    95   5e-20
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    87   3e-17
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    69   9e-12
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    66   6e-11
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    62   1e-09
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    60   4e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    60   5e-09
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    59   1e-08
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    59   2e-08
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    58   3e-08
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    57   5e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    57   6e-08
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    49   2e-05
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    45   2e-04
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    45   2e-04
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    45   3e-04
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    44   5e-04
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    44   8e-04
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    44   0.001
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    41   0.006
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.018
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    39   0.039
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    38   0.057
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    38   0.057
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    38   0.060
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    38   0.065
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    37   0.072
Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88...    35   0.11 
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    36   0.21 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    36   0.22 
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    36   0.23 
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    36   0.24 
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    35   0.33 
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    35   0.42 
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    35   0.43 
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    33   1.1  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    33   1.2  
CAGL0J08888g Chr10 complement(877386..878783) [1398 bp, 465 aa] ...    33   1.4  
TPHA0D01640 Chr4 complement(343171..344868) [1698 bp, 565 aa] {O...    33   1.8  
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     33   1.8  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    33   2.2  
Kpol_1052.32 s1052 complement(96248..98302,98305..98313,98317..9...    33   2.4  
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    31   3.2  
SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {O...    31   4.5  
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    31   6.7  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...    31   9.0  

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/481 (97%), Positives = 470/481 (97%)

Query: 1   MKTRHLKLFNSYVPYQSENPRNLVTNKVISIMASAVYFCDSKGYPLLARRYRDDIPISAI 60
           MKTRHLKLFNSYVPYQSENPRNLVTNKVISIMASAVYFCDSKGYPLLARRYRDDIPISAI
Sbjct: 1   MKTRHLKLFNSYVPYQSENPRNLVTNKVISIMASAVYFCDSKGYPLLARRYRDDIPISAI 60

Query: 61  EKFPTLLSDLEEETNLVPPCLSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLV 120
           EKFPTLLSDLEEETNLVPPCLSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLV
Sbjct: 61  EKFPTLLSDLEEETNLVPPCLSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLV 120

Query: 121 DVLGNYLKTVEEESIRDNFVIIYELLDETMDYGIPQITETKMLKQYITQKSFKLVXXXXX 180
           DVLGNYLKTVEEESIRDNFVIIYELLDETMDYGIPQITETKMLKQYITQKSFKLV     
Sbjct: 121 DVLGNYLKTVEEESIRDNFVIIYELLDETMDYGIPQITETKMLKQYITQKSFKLVKAAKK 180

Query: 181 XXXXXXPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKS 240
                 PPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKS
Sbjct: 181 KRNAARPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKS 240

Query: 241 RLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLS 300
           RLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLS
Sbjct: 241 RLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLS 300

Query: 301 KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKS 360
           KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKS
Sbjct: 301 KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKS 360

Query: 361 TATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSI 420
           TATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSI
Sbjct: 361 TATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSI 420

Query: 421 GNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           GNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 GNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480

Query: 481 T 481
           T
Sbjct: 481 T 481

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/450 (79%), Positives = 399/450 (88%), Gaps = 8/450 (1%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASA+YFCD KG PLL+R+YRDDIP++AI+KF +LL+DLEEE++++PPCL+YN  QYLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QH+D+YLVAI N +  N A++FAFLYK++DVLG+YLKTVEEESIRDN+VIIYELLDE MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKLV           PP ALT+SVSWRS  IKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINMLMTQKGQILRSEI+G VK+KSRLSGMPDLKLGINDKGIFSK + +D  NN  
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNNNA 240

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
                  T KK+N IELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL
Sbjct: 241 -------TSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 293

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCDMN+QVHS SRIEIHCRAKAQIKKKSTATNV+I+IPVPEDADTP FKYSHGSIK+VP
Sbjct: 294 IWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVP 353

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-IEEHKAKRPVQIKFQIPYFTTSGIQVKY 450
           EK+ I+WKIRSFPGGKEYSM+A++ LPS  +  EE + K+PVQ+KFQIPYFTTSGIQV+Y
Sbjct: 354 EKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRY 413

Query: 451 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           LKINEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 414 LKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/475 (76%), Positives = 405/475 (85%), Gaps = 25/475 (5%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFP LLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y+VAI  S+SANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDD------ 265
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DDD      
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 266 ----SLNN-----EGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGD 316
               S NN     + +  +SS T+KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 317 FELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDAD 376
           F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+I+IPVP+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 377 TPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKA-------- 428
           TP FKYSHGS+KYVPEK+ I+WKIRSFPGGKEYSMSA++ LPSI N E+           
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 429 --KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
             K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 475

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/478 (75%), Positives = 405/478 (84%), Gaps = 28/478 (5%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFPTLLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+YLVAIA S+SANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DD S     
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 272 AS------------------VASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313
           AS                   +SST  K+K NIELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373
           DG F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+I+IPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-------IEEH 426
           DADTP FKYSHGS+KYVPEK+ I+WK+RSFPGGKEYSMSA++ LPSI N       I ++
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 427 KA---KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
            A   K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 478

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/476 (76%), Positives = 404/476 (84%), Gaps = 26/476 (5%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD  G PLL+RRYRDDIP+SAI+KFPTLLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+YLVAI  S+ ANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQI ETKMLKQYITQKSFKLV           PP ALTNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++DDDS     
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 272 ASVASS----TTDKK------------KNNIELEDLKFHQCVRLSKFETEKIITFIPPDG 315
            S A+S     TDKK            K NIELEDLKFHQCVRLSKFE EKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 316 DFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDA 375
            F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+IIIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 376 DTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGN-IEEHKA------ 428
           DTP FKYSHGS+KYVPEK+ I+WK+RSFPGGKEYSMSA++ LPSI N IE H+A      
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 429 ---KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
              K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/478 (74%), Positives = 405/478 (84%), Gaps = 30/478 (6%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD  G PLL+RRYRDD+P+SAI+KF TLLSDLEE++NL+PPCL++NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+YLVAI  S++ANAA IF FL+KLV+VL +YLKTVEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKLV           PP ALTNSVSWR   I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINMLMTQKGQ+LRSEIIG+VKV S+LSGMPDLKLGINDKGIFSK++D+DS  N  
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDS--NIP 238

Query: 272 ASVASSTTD------------------KKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313
           ++V+++T+D                  K+K NIELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 239 SAVSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 298

Query: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373
           DG F+LMNYRLST+IKPLIWCD+N+QVHS SRIEIHC+AKAQIK+KSTATNV+I+IPVP+
Sbjct: 299 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 358

Query: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKA----- 428
           DADTP FKYSHGS+KYVPEK+ I+WK+RSFPGGKEYSMSA++ LPSI   ++        
Sbjct: 359 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKS 418

Query: 429 -----KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
                K PVQIKFQIPYFTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIRLT
Sbjct: 419 NAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 476

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/460 (73%), Positives = 400/460 (86%), Gaps = 11/460 (2%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD KG PLL+RRY+DD+P+SAI+KF TLL+DLE+E+ ++PPC+++NG++YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y+VA+A S++ N A++FAFL+KL+ VLG YLKTVEEESIRDNFVIIYEL+DE MD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITE +MLK+YITQKSFKL            PP  L NSVSWR+  IKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLN--- 268
           DI+ESINML+TQKGQ+LRSEIIG VK+KSRLSGMPDLKLGIND+GIF+K+++ +++    
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 269 ----NEGASVASS--TTD--KKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 320
                 G+ VA S  T D  K+K NIELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 321 NYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEF 380
           NYRL+TSIKPLIWCD++IQVHS+SRIEI CRAKAQIKKKS A NVQI+IPVP+DADTP F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 381 KYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPY 440
           KYSHGSIKYVPE++ I+WKI+SFPGGKEY+M A+M LPS+ + EE K KRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 441 FTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           FTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/450 (75%), Positives = 391/450 (86%), Gaps = 2/450 (0%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M S VYFCD+ G P+L+RRYRDDIP+SAI+KF  +L + EEE+++VPPCL Y G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QH+D+Y+VA+  S   N AQIF FL++LV VLG+YLK+VEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWR   IKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DIIESINMLM Q+GQ+LRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSK+++++   ++ 
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 272 ASVAS--STTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK 329
             + +  STT+ KK+NIELEDLKFHQCVRLSKFE EKIITFIPPDG+FELMNYRL+T IK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 330 PLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKY 389
           PLIWCD+NIQVHS+SRIEIHCRAKAQIKKKS A NV+I+IPVP+DADTP FKYSHGSIK+
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 390 VPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVK 449
           +PEKN I+WK+RSF GGKEYSM+AQ+ LPS+  IE  K KRPVQIKFQIPYFTTSGIQV+
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 450 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 479
           YLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/449 (74%), Positives = 390/449 (86%), Gaps = 4/449 (0%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M SAVYFCD KG P+L+RRYRDDIPISAI+KF  LL  LEEE++++PPCLS++G+QYLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y+VA+A S++ N AQ+FAFL+KL++VL  YLK+VEEES+RDNF+IIYELLDE MD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKL+           PP  +TNSVSWR+ +I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINMLM Q+GQ+LRSEIIG++KVKS+LSGMPDLKLGINDKGIFSK+++ DS     
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS----D 236

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
               + T  KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDG FELMNYRLS  +KPL
Sbjct: 237 PVTTAVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPL 296

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD+N+QVHSQSRIEIHCRA+AQIKK+S A +V+I+IPVP+DADTP FKY+HGS+K+VP
Sbjct: 297 IWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVP 356

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           +KN I+WKIRSF GGKEYSMSAQM LPSI  +++ K KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 357 QKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYL 416

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KI EPKL YKSYPWVRYITQSGDDYTI+L
Sbjct: 417 KITEPKLLYKSYPWVRYITQSGDDYTIKL 445

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/467 (72%), Positives = 394/467 (84%), Gaps = 18/467 (3%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M S++ FCDSKG  LL+R+YRDDIP++AI+ F TLL  LEEE+++VPPCL++NG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y+VA+  S+S NA+Q+F FL+KLV+V+  YLK VEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKLV           PP+ALTNSVSWR   IKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDD------ 265
           DI+ESINMLMTQ+GQ+LRSEIIGEVKV+SRLSGMPDLKLGINDKGIFSK+++        
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 266 ------SLNNEGASVASSTT------DKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313
                  +N+  +S    +T       +K +N+ELEDLKFHQCVRLSKFE EKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 314 DGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPE 373
           DG+FELM+YRL+T IKPLIWCD+NI VHS+SR+EIHCRAKAQIKKKS A NV+I+IPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 374 DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQ 433
           DADTP F+YSHGSIK+VPEKN I+WKIRSF GGKEYSM+AQ+ LPSI + E+ K KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 434 IKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           IKFQIPYFTTSGIQV+YLK+NEPKLQYKSYPWVRYITQSGDDYTIRL
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/449 (73%), Positives = 389/449 (86%), Gaps = 3/449 (0%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MAS +YFCDSKG  +L+RRY+DDIP +AI+KFP LL + E+E++++PPCL++NG+QYLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y++ +  S+S N AQ+FAFLYK+V+VL  Y+K VEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKL+           PP ALTNSVSWR   I YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D++ESINML+TQ+GQ+LRSEI+G+VKVKS LSGMPDLKLG+NDKGIFS H+   S   E 
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHV---SGGVED 237

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
            +   S T KKK NIELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRL+T IKPL
Sbjct: 238 EADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPL 297

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD+ IQVHS+SRIE+HCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHGSIK+ P
Sbjct: 298 IWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAP 357

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EKN I+WKI+SFPGGKEYSM+AQ+ LPS+ + EE   KRPVQ+KFQIPYFTTSGIQV+YL
Sbjct: 358 EKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYL 417

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KINEPK+QY+SYPWVRYITQSGDDYTIR+
Sbjct: 418 KINEPKMQYQSYPWVRYITQSGDDYTIRM 446

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/449 (73%), Positives = 389/449 (86%), Gaps = 8/449 (1%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M S +YFCD KG P+L+RRYRDDIP+SAI++F  LL+DLEEE++++PPCL++ G+QYLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           +H D+Y+VA++ S++ NAAQ+F FL+KLV+ LG+YLKTVEEES+RDNFVIIYELLDE MD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKSFKL+           PP  LTNSVSWR+  I YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           DI+ESINM+M Q+GQ+LRSEIIG+V V+SRLSGMPDLKLGINDKGIF++    D    E 
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR----DPETGE- 235

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
              +  T  KKK++ ELEDLKFHQCVRLSKFE EKIITFIPPDG+FELM+YRL+T +KPL
Sbjct: 236 ---SQVTAGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPL 292

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD+N+QVHS+SRIEIHCRAKAQIKKKS A NV+I+IPVP+DADTP F+YSHGSIK+VP
Sbjct: 293 IWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVP 352

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EKN I+WKIRSF GGKEYSM+AQM LPSI  +E+ K KRPVQ+KFQIPYFTTSGIQV+YL
Sbjct: 353 EKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYL 412

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KINEPKLQYKSYPWVRYITQ+GDDYTIRL
Sbjct: 413 KINEPKLQYKSYPWVRYITQNGDDYTIRL 441

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/456 (76%), Positives = 394/456 (86%), Gaps = 6/456 (1%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASA+YFCD+KG PLL+R+YRDDIP SAI++FP LLS+ EEETNL+PPC+ +NG+Q+LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+YLVAIA S+S NAA IF+FL+K+++VL  YLK VEEESIRDNFVIIYELLDE MD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITE KMLKQYITQKSFKL            PP +LTNSVSWR   IK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDS----L 267
           DIIESINMLMTQKGQ+LRSEIIGEVKVKS+LSGMPDLKLGINDKG+FSK+++ D     +
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 268 NNEGASVASSTTDKKK-NNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLST 326
             + +SV  S   KK+ NN+ELEDLKFHQCVRLSKFE EK ITFIPPDGDFELM+YRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 327 SIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGS 386
           +IKPLIWCD+NI+ HS+SRIEI CRAKAQIKKKSTATNV+I+IPVPEDADTP FKYSHGS
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 387 IKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEE-HKAKRPVQIKFQIPYFTTSG 445
           IKYVPEKN I+WKIR+FPG KEYSM+A+M LPS    EE  K KRPVQ+KFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 446 IQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
           IQV+YLKI E  LQYKSYPWVRYIT+SGDDYTIRL+
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/469 (71%), Positives = 397/469 (84%), Gaps = 24/469 (5%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MASAVYFCD KG PLL+R+YRDDIP+SAI+KF +LLSD EEE+NL+PPC+S+NG+QY+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+YL A+A S+ AN + IFAFL+K++DVL  YLKTVEEESIRDNF+IIYELLDE MD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YG+PQITETKMLK+YIT KSFKL            PP  LTNSVSWR   IKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHM--------- 262
           DIIESINML+TQKGQ+LRSEI+G V+VKSRLSGMPDLKLGIND+GIF+K++         
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 263 -----DDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDF 317
                D D  NNE +S+ S  ++K+K NIELEDLKFHQCVRLSKFE EKII+FIPPDG+F
Sbjct: 241 NGDDEDADDTNNE-SSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEF 299

Query: 318 ELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADT 377
           +LMNYRLSTSIKPLIWCD++IQ +   RIEIHC+AKAQIKKKS ATNV+I+IPVPEDAD+
Sbjct: 300 DLMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADS 356

Query: 378 PEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEE------HKAKRP 431
           P FKYSHG IKY+PEKN+++WKI SFPGGKEYSM+AQM LPSI   ++      +++K+P
Sbjct: 357 PIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKP 416

Query: 432 VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           VQ+KF+IPYFTTSGIQV+YLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 417 VQVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  694 bits (1792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/448 (72%), Positives = 384/448 (85%), Gaps = 9/448 (2%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MAS +YFCD+KG  +L+RRYRDD+P SAIEKFP+LL + E+E+++VPPCL++NG+QYLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y++ ++ S+S N AQ+F+FLYKLV+VL  Y+KTVEEESIRDNFVIIYELLDE +D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKS+KL+           PP  LT SVSWR   I YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D+ ESINML+T  GQ+LRSEI+G+V V+SRLSGMPDLKLG+NDKGIF+            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVE--------- 231

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
           ++ +S  T+ KK+NIELEDLKFHQCVRLSKFE EKIITFIPPDGDFELMNYRLST IKPL
Sbjct: 232 SASSSEATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPL 291

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD  IQVHSQSRIEIHCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHGS+KYVP
Sbjct: 292 IWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVP 351

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EK+ I+WKI++F GGKEYS +AQ+ LPS+ + E  +AKRP+Q+KFQIPYFTTSGIQV+YL
Sbjct: 352 EKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYL 411

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIR 479
           KINEPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 412 KINEPKLQYQSYPWVRYITQSGDDYTIR 439

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/449 (71%), Positives = 389/449 (86%), Gaps = 4/449 (0%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S +YFCD+KG  LL+RRY+DDIPISAIE+FP LL + E+E+N++PPC S+NG+QYLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y++ +  SM AN AQ+F+FL+ LVDVL  Y+K VEEESI+DNFVIIYELLDE MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
            GIPQIT+TKML+QYITQKSFKL+           PP +LT +VSWR   IKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D+IESINM+MTQ+GQ+LRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF++  +++   +E 
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEE--EDEP 238

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
           +S  S T  +KK+NIELEDLKFHQCVRLSKFE EKIITFIPPDGDFELM+YRLST IKPL
Sbjct: 239 SSQPSIT--RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPL 296

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD  IQVHS+SR+E+HCRAKAQIK KSTA NV+I+IPVP DAD+P+F+YSHGSIK+VP
Sbjct: 297 IWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVP 356

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EKN I+WKI+SFPGGK+YSM+A+M LPS+ +I ++  KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 357 EKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYL 416

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 417 KINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/448 (71%), Positives = 384/448 (85%), Gaps = 9/448 (2%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MAS +YFCD+ G  +L+RRYRDD+P SAIE+FP LL + E+E+++VPPCL++NG+QY+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y++ ++ S+S N AQ+F+FLYKLV+VL  YLKTVEEESIRDNFVIIYELLDE +D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           YGIPQITETKMLKQYITQKS+KL+           PP  LT SVSWR   I YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D+ ESINML+T  GQ+LRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF+   ++   N EG
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS--EEGGNNAEG 238

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
            S        KK+NIELEDL+FHQCVRLSKFE EKII+FIPPDGDF+LMNYRLST IKPL
Sbjct: 239 GS-------GKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPL 291

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD  IQVHSQSRIEIHCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHGS+KYVP
Sbjct: 292 IWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVP 351

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EK+ I+W+I++F GGKEYS +AQ+ LPS+ ++E  KAKRP+Q+KFQIPYFTTSGIQV+YL
Sbjct: 352 EKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYL 411

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIR 479
           K++EPKLQY+SYPWVRYITQSGDDYTIR
Sbjct: 412 KVHEPKLQYQSYPWVRYITQSGDDYTIR 439

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 386/449 (85%), Gaps = 6/449 (1%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M S +YFCDSKG  LL+RRY+DDIP +AIE+FP LL + E+E++++PPC S+NG+QYLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           QHND+Y++ +  SMS N AQ+F++L+KL++VL  Y+K VEEESI+DNFVIIYELLDE MD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
           +GIPQIT+TKML+QYITQKSFKL+           PP  LTNSVSWR   I YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D++ESINML+TQ+GQ+LRSEI+G+VKVKSRLSGMPDLKLG+NDKGIF++        ++ 
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGD------DDD 234

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
               +S   KKK+NIELEDLKFHQCVRL+KFE EKIITFIPPDGDFELM+YRLST IKPL
Sbjct: 235 DEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPL 294

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD+ +QVHS+SRIEIHCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHG+IK+VP
Sbjct: 295 IWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVP 354

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
            +N I+WKI+SFPGGK+YSM+A+M LPS+ +  +HK KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 355 SQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYL 414

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 415 KINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/452 (70%), Positives = 380/452 (84%), Gaps = 3/452 (0%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M S +YFCD+ G P+LARRYRDDI I+AI+ F  LL  LEEET ++PPC+ + G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           +H+D+Y+VA+  S   N AQIF FL++LV+VL  Y+K V EES+RDNFVIIYELLDE MD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXX--XXXPPEALTNSVSWRSADIKYKKNEA 209
           +GIPQITETKMLK+YITQKSFKL+             PP  LTNSVSWR   I YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 210 FLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNN 269
           FLDIIESINML+TQ+GQ+LRSEI+G V+V+SRLSGMPDLKLGIND+GIFS ++++++++ 
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 270 EGASVA-SSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSI 328
             +S       + KK  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LMNYRL+T I
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 329 KPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIK 388
           KPLIWCD+NIQVHS+SRIEIHCRAKAQIKKKS A NV+I+IPVP+DADTP+F+YSHGSIK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 389 YVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQV 448
           ++PEKN I+WK+RSF GGKEYSMSAQ+ LPS+  +E  K +RPVQ+KFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 449 KYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           +YLK+NEPKLQYKSYPWVRYITQSG+DYTIRL
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/449 (70%), Positives = 372/449 (82%), Gaps = 6/449 (1%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           MAS V FCDSKG PLL+RRY+DD+  SA+E F  LL + E+E++++PPC  +NG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
           Q+NDVY++A+  S+S NA  +FAF+YKL++V+  Y+K VEEESIRDN++IIYELLDE MD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 152 YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFL 211
            G+PQ+TETKMLKQYITQKSFKL            PP  LTNSVSWR   IKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271
           D+IESINMLMTQ+GQ+LRSEI+G VKV+SRLSGMPDLKLG+NDKGIF+ +  +DS     
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDS----P 236

Query: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331
             V SS   KK +NIELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM YRLST IKPL
Sbjct: 237 EPVVSS--KKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPL 294

Query: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391
           IWCD+ +QVHS SRIEIHCRAKAQIKKKS A NV+I+IP+PEDAD+P FKYS G+IK+VP
Sbjct: 295 IWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVP 354

Query: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451
           EKN I+WK  SF GGKEYSM+AQ+ LPS+ + E  K KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 355 EKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYL 414

Query: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           KI EPKLQY SYPWVRYITQSGDDYTIRL
Sbjct: 415 KIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  227 bits (579), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/472 (31%), Positives = 240/472 (50%), Gaps = 33/472 (6%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M SA++    +G  ++++  +D+I +   E F   ++++L+  +    P L+     +  
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 91  IQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM 150
           I+ N    +   +  + ++A I+ FLY    +L  Y     E+S++ +F++ YE+LD  +
Sbjct: 57  IRSNGGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 151 DYGIPQITETKMLKQYITQKSFK---------------LVXXXXXXXXXXXPPEALTNSV 195
           D GIP+ TE   +  YI++K                  LV                 +  
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 196 SWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDK 255
            WRS  I+YKKNE +LD+ E I++L+ + G IL+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFND- 234

Query: 256 GIFSKHMDDDSLNNEGASVASSTTDKKKNNIE----LEDLKFHQCVRLSKFETEKIITFI 311
              S   +  S  N+G +   + T   KN I     LED KFHQCV+L KF+ E++I F+
Sbjct: 235 -YLSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFV 293

Query: 312 PPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIP 370
           PPDG FELM Y +  ++  P     M   +  +S +E     K+    K  A +V++ IP
Sbjct: 294 PPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAKDVELYIP 352

Query: 371 VPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIE---EHK 427
            P D    +   S G  K++PE+N I+WKI  + G  E   SA +     GN     E  
Sbjct: 353 APPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQW 412

Query: 428 AKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIR 479
           ++ P+ ++F+I  F+ SG+ V+YLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 413 SRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  214 bits (546), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/483 (30%), Positives = 251/483 (51%), Gaps = 53/483 (10%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M SA++    +G  L+++  R  +P S  E F   ++++L+  +    P L+     +  
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQH-NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149
           ++   ++++VA++ S +A++A I+ FLYKL  +L  +    E E ++++F+  YELLD  
Sbjct: 57  VKSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAFGLHSENE-LKEDFMTCYELLDIV 114

Query: 150 MDYGIPQITETKMLKQYITQK---------SF---------------KLVXXXXXXXXXX 185
           ++ G+P  TE   +   ++ K         +F               + +          
Sbjct: 115 LEDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLH 174

Query: 186 XPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGM 245
                + +++ WR   IKYKKNE FL++ E I++L+++ G IL+S + G V+  + LSGM
Sbjct: 175 DSHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGM 234

Query: 246 PDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKK------KNNIELEDLKFHQCVRL 299
           P  + G+ND    S    D+          S TT+KK        ++ LED KFHQCV+L
Sbjct: 235 PVCRFGLNDSLSVSTPFGDNE---------SPTTNKKAIPKAAAGSVMLEDCKFHQCVQL 285

Query: 300 SKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKK 359
            KF++E+ I FIPPDG FELM Y +  ++         + +   + I+     K+    K
Sbjct: 286 DKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSK 345

Query: 360 STATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLP- 418
            TA +VQ+ IPVP +        S+G  K+VPE++ IIWK   + G  E S+SA   +P 
Sbjct: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSAT-AVPM 404

Query: 419 --SIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDY 476
             S  NI++  +K P+ +KF+I  F+ SG+ V++  ++E    YK   W++Y+++SG  Y
Sbjct: 405 KDSALNIDQW-SKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AY 462

Query: 477 TIR 479
            +R
Sbjct: 463 EVR 465

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  208 bits (529), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 148/498 (29%), Positives = 250/498 (50%), Gaps = 67/498 (13%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M +A++    KG  ++++  RD I  S  E F   ++++L+  +    P L+     +  
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQHN-DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149
           I+ + ++++VA+  S +A++A I+ FLYK   +L  Y     EES+++ F+  YELLD  
Sbjct: 57  IRSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVV 114

Query: 150 MDYGIPQITETKMLKQYITQKSFK-----------LVXXXXXXXXXXXPPEALTNSVS-- 196
           ++ G+P  TE   +   ++++              L+            P+ L       
Sbjct: 115 LENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSS 174

Query: 197 -------------------WRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVK 237
                              WRS+ IKYKKNE FLD+ E IN+L+++ G IL+S + G V 
Sbjct: 175 SSVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVD 234

Query: 238 VKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKK-------NNIELED 290
           + + LSG P  + G+ND    S  +D  +L+ +   ++      KK        +++LED
Sbjct: 235 LTTHLSGTPLCQFGLND----SLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLED 290

Query: 291 LKFHQCVRLSKFETEKIITFIPPDGDFELMNYR------LSTSIKPLIWCDMNIQVHSQS 344
            KFHQCV+L++F T++II F+PPDG FELM Y       L   I P+     N       
Sbjct: 291 CKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSN-----NG 345

Query: 345 RIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFP 404
            +E     K+    K TA +V + IPVP      +   S+G  ++VPE+N ++WK   + 
Sbjct: 346 AVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQ 405

Query: 405 GGKEYSMSA---QMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYK 461
           G  E ++SA    M   S  N+++  ++ P+ + F+I  F+ SG+ V++ K++E    Y 
Sbjct: 406 GLTENTLSALTVPMDNQSSLNLQQW-SRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYH 464

Query: 462 SYPWVRYITQSGDDYTIR 479
           +  WV+YI++SG  Y +R
Sbjct: 465 TVKWVKYISRSG-AYEVR 481

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  206 bits (525), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 143/478 (29%), Positives = 247/478 (51%), Gaps = 42/478 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M +A++    +G  L+++  +  +  S  E F   ++++L+  +    P L+     +  
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQH-NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDET 149
           I+   ++++VA++ S +A++A I+ FLY+L ++L  +     E  +++ F+I YELLD  
Sbjct: 57  IKSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIV 114

Query: 150 MDYGIPQITETKMLKQYITQK------SFKLVXXXXXXXXXXXPP--------------- 188
           ++ G+P  TE   +   ++ K      +F +             P               
Sbjct: 115 LEDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQ 174

Query: 189 ----EALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSG 244
               EA +N + WR   IKYKKNE FL++ E I++L+++ G IL+S + G V+  + LSG
Sbjct: 175 DIASEAPSN-IPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSG 233

Query: 245 MPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET 304
           MP  + G+ND    S    DD  +    +   +       ++ LED KFHQCV+L KF++
Sbjct: 234 MPVCRFGLNDALSVSTPFGDD--DEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 291

Query: 305 EKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATN 364
           E+ I FI PDG FELM Y +  ++         + V   + I+     K+    K TA +
Sbjct: 292 ERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAKD 351

Query: 365 VQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLP---SIG 421
           VQ+ IPVP +  +     S+G  K+VPE++ I+WK   + G  E S+SA   +P   S  
Sbjct: 352 VQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISAT-AVPMKDSTL 410

Query: 422 NIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIR 479
           NIE+   + P+ +KF+I  F+ SG+ V++  ++E    YK   W++Y+++SG  Y +R
Sbjct: 411 NIEQW-PRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  200 bits (508), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 131/481 (27%), Positives = 247/481 (51%), Gaps = 40/481 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M SA++  ++KG  L+++  +D +  S  + F T +++D    + ++   L     Q++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 91  IQHND---VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
            + +D   ++LVA++ S + +++ I+ +L+KL  ++  +    +E+ ++D F+++YE+L+
Sbjct: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEILE 116

Query: 148 ETMDYGIPQITETKMLKQYITQKSFK-------------------LVXXXXXXXXXXXPP 188
            T++ GIPQ T+   +   +++K  +                   L              
Sbjct: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIA 176

Query: 189 EALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDL 248
            +  +   WR + +KYKKNE +LDI E I +L+ + G I++S + G V   S LSGMP  
Sbjct: 177 LSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236

Query: 249 KLGINDKGIFSKHMDDDS-------LNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSK 301
           +LG+ND   +S H ++ S       ++        +  +    ++ LED KFHQCV+L+K
Sbjct: 237 QLGLNDT--YSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNK 294

Query: 302 FETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKST 361
           +E   +I F+PPDG F+LM YR+  +I         +++   S +      ++      +
Sbjct: 295 YEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVS 354

Query: 362 ATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIG 421
           A +V + IPVP      +F  S G  KY   +  ++WK   + G  E ++S ++ +P+  
Sbjct: 355 AKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATS 414

Query: 422 NIEE---HKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTI 478
           +        ++ P+ + F+I  F+ SG+ V++LK  EP+L Y+   W++YI+ SG  Y I
Sbjct: 415 HDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AYEI 473

Query: 479 R 479
           R
Sbjct: 474 R 474

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  199 bits (505), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 142/494 (28%), Positives = 244/494 (49%), Gaps = 60/494 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDI--PISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYL 89
           M +AV     +G  L+ + ++  +   IS I +   + +D     N+  P L+     + 
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND-----NIRSPILTLGSTTFH 55

Query: 90  FIQ---HNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELL 146
           FI+    + ++LVA+  S +A++  I+ +LYKL  ++  Y  T  E+ ++D F++ +ELL
Sbjct: 56  FIRTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELL 113

Query: 147 DETMDY-GIPQITETKMLKQYITQKSFK-----------LVXXXXXXXXXXXP---PEAL 191
           D T+   G+P  TE   +   +T K  +           L            P   P+ L
Sbjct: 114 DITLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFL 173

Query: 192 T-----------------NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIG 234
           +                 +++ WRS DIKYKKNE  +++IE IN+L+ +   ILR+ + G
Sbjct: 174 SRNSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDG 233

Query: 235 EVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFH 294
            + + + LSGMP  ++G+ND        +    N + AS   +  D   + + LE  KFH
Sbjct: 234 TIDITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFH 293

Query: 295 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRA-- 352
           QCV L K+  + +I FIPPDG FELM Y +S ++      ++  ++  Q  +  H  A  
Sbjct: 294 QCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNL------NLPFRITPQVTLTSHGTALS 347

Query: 353 -----KAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGK 407
                K+   +K +A NV + IPVP      +   S G  K++PE+N ++W    F G  
Sbjct: 348 YAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGST 407

Query: 408 EYSMSAQ-MQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPW 465
           E  ++AQ +   SI +    +  R P+ + F++  F+ +G+ V+YLK+ E  + Y +  W
Sbjct: 408 ENHLNAQTVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKW 467

Query: 466 VRYITQSGDDYTIR 479
           ++YI+ +G  Y +R
Sbjct: 468 IKYISAAG-SYEVR 480

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  197 bits (502), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 248/491 (50%), Gaps = 53/491 (10%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M SA+    S+G  ++A+  +  +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 91  IQHN---DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+ +    ++LVA++ S +AN+  I+ FLYKL +V+ +     +E ++++NF+  YE+LD
Sbjct: 57  IRSDGSDSLWLVAVSRS-NANSGAIWEFLYKL-NVIMDVYGLTKEGTLKENFMNCYEILD 114

Query: 148 ETMD-YGIPQITE-----TKML----KQ----------YITQKSFKLVXXXXXXXXXXXP 187
             ++  GIP  TE     +KM     KQ           +T  S  L            P
Sbjct: 115 TVLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMP 174

Query: 188 PEALTNS--------------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII 233
                N+              +SWR   IKYKKNE  L++ E I++L+++ G IL+S + 
Sbjct: 175 KFLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVD 234

Query: 234 GEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNN-EGASVASSTTDKKKNNIELEDLK 292
           G + + + LSGMP  + G+ND    S    DDS++  E  +   +        + LED K
Sbjct: 235 GTIDLTTHLSGMPICQFGLNDS--LSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCK 292

Query: 293 FHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCR 351
           FHQCV L KF  +++I F+PPDG  ELM Y +  ++  P     +   +   + I+    
Sbjct: 293 FHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVT 352

Query: 352 AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSM 411
            K+    K +A +V + IPVP      E   S+G  K+VPE++ +IWK   + G  E ++
Sbjct: 353 LKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTL 412

Query: 412 SAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRY 468
           SA + +PS    +   +   + P+ + F+I  F+ SG+ V+Y K+++   +Y++  W++Y
Sbjct: 413 SA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKY 471

Query: 469 ITQSGDDYTIR 479
           I++SG  Y IR
Sbjct: 472 ISKSG-SYEIR 481

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  196 bits (497), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 138/498 (27%), Positives = 252/498 (50%), Gaps = 58/498 (11%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M +A+    ++G  ++++ ++  +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 91  IQH---NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+    +++++VA++ + + ++A I+ FLYKL  +L +Y     EE +++ F+I++ELLD
Sbjct: 57  IKSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLD 114

Query: 148 ETM--DYGIPQITETKMLKQYITQKSFKLVXXXXXX------------------XXXXXP 187
             M    GIP +TE  ++   ++ K  K +                             P
Sbjct: 115 VMMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGP 174

Query: 188 PEALTNSVS------------WRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGE 235
                NS S            WR   I +KKNE  L + E IN+L+++ G +L++ + G 
Sbjct: 175 KLLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGS 234

Query: 236 VKVKSRLSGMPDLKLGINDK----GIFSKHMDDDSLNNEGASVASSTTDKKK------NN 285
           + +++ LSG P  + G+ND     G+ S      + N+    V    TDKK+       +
Sbjct: 235 IDLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGS 294

Query: 286 IELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQS 344
           + LED KFHQCV L KF+ ++II F+PPDG  ELM Y +  ++  P     +     + +
Sbjct: 295 VILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGT 354

Query: 345 RIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFP 404
            +E     K+    + +A NV + IPVP +    +   ++GS K++PE++ +IW+   F 
Sbjct: 355 ALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFN 414

Query: 405 GGKEYSMSAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYK 461
           G  E ++SA + +P+  N +   +  +K P+ + F+I  F+ SG+ V+Y  I E   +YK
Sbjct: 415 GLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYK 473

Query: 462 SYPWVRYITQSGDDYTIR 479
           +  W++YI++SG  Y IR
Sbjct: 474 AVKWIKYISRSG-SYEIR 490

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  189 bits (481), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 131/427 (30%), Positives = 216/427 (50%), Gaps = 44/427 (10%)

Query: 94  NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM-DY 152
           ++++LVA A   +AN+A I+ FLYKL  +L  Y    +EE +++ F+I++ELLD  +   
Sbjct: 64  DNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLDVMLGSC 121

Query: 153 GIPQITETKMLKQYITQKSFKLVXXXXXX----------XXXXXPPEALT---------- 192
           GIP  TE   +   ++ K  KL                       P+ L           
Sbjct: 122 GIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHDS 181

Query: 193 ----NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDL 248
               N  SWR  DIK+KKNE  L + E IN+L+ + G IL++ + G + +++RLSG P  
Sbjct: 182 NFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPVC 241

Query: 249 KLGINDKGIFSKH------MDDDSLNNEGASVASSTTDK-----KKNNIELEDLKFHQCV 297
           + G+ND      +       +  + NN+ + + S+ ++K        N+ LED KFHQCV
Sbjct: 242 QFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFHQCV 301

Query: 298 RLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQI 356
            L KF+ E+II F+PPDG  ELM Y +  ++  P     +     +   ++     K+  
Sbjct: 302 SLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALKSLF 361

Query: 357 KKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQ 416
             + +A  V + IPVP          S+G+ K+VP +N ++WK   + G  E ++SA + 
Sbjct: 362 PGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA-VT 420

Query: 417 LPSI---GNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSG 473
           +PS        +  A+ P+ + F+I  F+ SG+ V+Y  I+E    YK+  W++Y+++SG
Sbjct: 421 VPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKAVKWIKYVSKSG 480

Query: 474 DDYTIRL 480
             Y +R 
Sbjct: 481 -SYEVRF 486

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  189 bits (480), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 198/389 (50%), Gaps = 32/389 (8%)

Query: 79  PCLSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDN 138
           P L+     +  I+ +    + +    +A++A I+ FLY +  +L  Y    EE ++ D+
Sbjct: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103

Query: 139 FVIIYELLDETMDYGIPQITETKMLKQYITQK--------------SFKLVXXXXXXXXX 184
           F++ YELLD  +D G+PQ TE   +   +++K              S +L          
Sbjct: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163

Query: 185 XXPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSG 244
                   +   WR   IKYKKNE +LD+IE +++L+ + G IL++ + G V+  + LSG
Sbjct: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223

Query: 245 MPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET 304
           MP    G ND    S+ +   S   + A     T +++  ++ LED KFHQCV+L+KF+ 
Sbjct: 224 MPLCHFGFND----SQSLRQRSPRRQYAPRVFGTDERE--SVVLEDCKFHQCVQLNKFDQ 277

Query: 305 EKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATN 364
           E++I F+PPDG+FELM Y +   ++P       +   ++  IE     ++    K +A +
Sbjct: 278 ERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKD 337

Query: 365 VQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIE 424
           V++ IP P    + +   S G  K+VPE+N IIWKI  F G  E ++SA     +I + +
Sbjct: 338 VELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAV----TIADEQ 393

Query: 425 EHKA-------KRPVQIKFQIPYFTTSGI 446
            H A       + P+ +K +I  F+T+ +
Sbjct: 394 GHYAQVLDQWPRPPISMKLEIMMFSTAAL 422

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  188 bits (478), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 144/526 (27%), Positives = 245/526 (46%), Gaps = 104/526 (19%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S +Y  D    PL+ + ++    IS  E+   L      +  +VP    Y G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 92  QHNDVY------LVAIANSMSA--NAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVI 141
           + +  Y      LVA A++  +  N   I  +L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 142 IYELLDETMDYGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEAL---------- 191
           IYELLDE++D+G+PQ+T+  +++ YI +    L              E L          
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYI-KVQVNLHDELADSSKKISKKEDLHGFEDDESYM 175

Query: 192 --------TNSVSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRL 242
                   T+++SWR   I Y KNE FLD+IE I   M   K +I ++ + G ++ +S L
Sbjct: 176 NSFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYL 235

Query: 243 SGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKF 302
           SGMP LK+G+                    S  +S+  K++    + + KFHQCV L   
Sbjct: 236 SGMPKLKIGL--------------------SKITSSLPKEREQF-MNNAKFHQCVSLEDL 274

Query: 303 ETEKIITFIPPDGDFELMNYRLSTSIK-----PLIWCDMNIQVHSQSRIEIHCRAKAQIK 357
           + + I++FIPPDG+F+L  Y+L   ++      L+  D+  +   + +I I        K
Sbjct: 275 Q-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFK 333

Query: 358 KKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGK-- 407
            +++ + + I IP+         + A  P FK   G++ +    ++++W++ S  GG   
Sbjct: 334 SQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQ 393

Query: 408 -EYSMSAQMQL-------------------------PSIGNI-------EEHKAKRPVQI 434
            E+SM  + +L                         P +  +       E     R V +
Sbjct: 394 TEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSM 453

Query: 435 KFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
           +F+IPY+T SG++V+YLKI E +LQY S+PWVRY T + ++Y  ++
Sbjct: 454 EFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  186 bits (473), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 133/434 (30%), Positives = 218/434 (50%), Gaps = 43/434 (9%)

Query: 79  PCLSYNGMQYLFIQHND---VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESI 135
           P L+     +  I+ N    ++LVA+  S +AN+  I+ FLYK  D L N      E ++
Sbjct: 45  PILTLGSTTFHHIRSNSRDHLWLVAVTRS-NANSGAIWEFLYKF-DSLLNAFGLDNETTL 102

Query: 136 RDNFVIIYELLDETMDY-GIPQITETKMLKQYITQKSFK-----------------LVXX 177
           ++ F+  YELLD  ++  G+P  TE   +   ++ K                     +  
Sbjct: 103 KEEFMTCYELLDLMLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISK 162

Query: 178 XXXXXXXXXPPEALTNSVS---WRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIG 234
                      + +    S   WR   IKYKKNE FL+I E I++L+++   IL++ + G
Sbjct: 163 FLNRNNRSMSVDTMNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDG 222

Query: 235 EVKVKSRLSGMPDLKLGINDKGIFSK----HMDDDSLNNEGASVASSTTDKKKNNIELED 290
            V + S LSG P  + G+ND     +    + DD+   N+  ++  +T       + LED
Sbjct: 223 TVDLTSHLSGTPTCQFGLNDSLSVDEPNYYNSDDNGFRNQ-QNIPRATA----GTVVLED 277

Query: 291 LKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHC 350
            KFH+CV L KF  ++II F+PPDG  ELM Y +  +I        N+ ++S+SR  +  
Sbjct: 278 CKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV-INSRSRTGLDY 336

Query: 351 R--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKE 408
           R   K+    K +A +V + IPVP      +   S+G  ++VPE++ IIWK   + G  E
Sbjct: 337 RITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTE 396

Query: 409 YSMSAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPW 465
             +SA + + S    +   +  A+ P+ + F+I  F+ SG+ V+YLKI E   +Y++  W
Sbjct: 397 NKLSA-VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKW 455

Query: 466 VRYITQSGDDYTIR 479
           ++YI++SG  Y +R
Sbjct: 456 IKYISRSG-SYEVR 468

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  182 bits (462), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 143/491 (29%), Positives = 247/491 (50%), Gaps = 60/491 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M SAV    S+G  ++++ +++++  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS----PILTLGSTTFQH 56

Query: 91  IQHN----DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELL 146
           I+ N    D++LV++  S + N   ++ FLYK   +L  Y     EE +++ F++ YELL
Sbjct: 57  IRSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELL 114

Query: 147 DETM-DYGIPQITETKMLKQYITQK-------SFKLVXXXXXXXXXXXPP---------- 188
           D  + + G P  T+   + + ++ K       +F +            P           
Sbjct: 115 DVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLN 174

Query: 189 -EALTNS---------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKV 238
            E+  NS         + WR   I +KKNE FL + E I++L++++G IL+S + G + +
Sbjct: 175 QESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDL 234

Query: 239 KSRLSGMPDLKLGINDKGIFSKHMDD-----DSLNNEGASVASSTTDKKKNNIELEDLKF 293
            + LSG P  + G+ND    S   DD     D + N+ A   ++       ++ LED KF
Sbjct: 235 VTHLSGTPVCQFGLNDS--LSVKNDDYGDSFDYIKNKKAIPKAAA-----GSVLLEDCKF 287

Query: 294 HQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRA 352
           HQCV L KF+ ++II F+PPDG  ELM Y + ++I  P     +     S + +E     
Sbjct: 288 HQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITL 347

Query: 353 KAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMS 412
           K+    K TA NV + IPVP +    +   S+GS K+ PE+  ++W    + G  E ++S
Sbjct: 348 KSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLS 407

Query: 413 A----QMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRY 468
           A        P + NI++ + K P+ + F+I  F+ SG+ V+Y  I E + +YK+  W+RY
Sbjct: 408 AVTITSKDAPRL-NIQQWQ-KPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRY 464

Query: 469 ITQSGDDYTIR 479
           +++SG  Y IR
Sbjct: 465 VSKSG-SYEIR 474

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  181 bits (460), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 150/538 (27%), Positives = 240/538 (44%), Gaps = 123/538 (22%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S V+  D +  PL+ R  +    I+  E +      +  ++    P +   G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKS---IAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 92  QHNDVYLVAIANS-MSANAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVIIYELLDE 148
             + +Y V+++N  +  N   I A+L     +L  YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 149 TMDYGIPQITETKMLKQYITQKSF--KLVXXXXXXXXXXXPPEAL--------------- 191
           ++DYGIPQ+T+  +++  I  ++   K+             PE L               
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 192 --------------TNSVSWRSADIKYKKNEAFLDIIESINMLMTQK-GQILRSEIIGEV 236
                         T ++SWR   I Y KNE F+DIIE  + LM  K  Q+ ++ + G++
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 237 KVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQC 296
             +S LSGMP +++ IN      K + D  L      + SS              KFHQC
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDKDL-----FLGSS--------------KFHQC 270

Query: 297 VRLSKFETEKIITFIPPDGDFELMNYRLSTSIK--PLI-WCDMNI-QVHSQSRIEIHCRA 352
           V L    ++  I FIPPDGDF+L  Y+L   I   P+I   D  I +   + R+ +    
Sbjct: 271 VSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQKKHRLHLSVTI 330

Query: 353 KAQIKKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFP 404
           +   K +++AT ++I IP          +    P FK  HGS+ +     +++W  +   
Sbjct: 331 QPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQGIK 390

Query: 405 GGK---EYSMSAQMQLPSIGNIEEHKAKRPVQIK-------------------------- 435
           GG     YSM  +  L      EE  A++  QIK                          
Sbjct: 391 GGHGETSYSMHVEFALFD----EEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKE 446

Query: 436 -------------FQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
                        F++PY+T+SG++V+YLKI+E  L+Y+S+ WVRY T +  +Y  ++
Sbjct: 447 GKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  181 bits (458), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 134/494 (27%), Positives = 236/494 (47%), Gaps = 65/494 (13%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M +A++   ++G  ++++ + + +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS----PILTLGSTTFHH 56

Query: 91  IQHN--DVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDE 148
           I+ N  D   +   +  +AN+  I+ FLYK   +L  Y  T +EE ++++F+I YE+LD 
Sbjct: 57  IRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 149 TMDYG-IPQITETKMLKQYIT---QKSFKLVXXXXXXXXXXXPPEALTNS---------- 194
            +  G IP  TE   +   I+    KS               P   L+ S          
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 195 ----------------VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKV 238
                             WR   IKYKKNE FL + E IN+L+++ G IL++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 239 KSRLSGMPDLKLGINDKGIF----SKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFH 294
            + LSG P  + G+ND        S  +D    +N+ A   ++       ++ LED KFH
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAA-----GSVMLEDCKFH 290

Query: 295 QCVRLSKFETEKIITFIPPDGDFELMNY------RLSTSIKPLIWCDMNIQVHSQSRIEI 348
           QCV L KF  E+II F+PPDG+ ELM Y       L   I P++           S +E 
Sbjct: 291 QCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEY 343

Query: 349 HCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKE 408
               K+    K +A +V + IPVP      +   S+G  K+  E+N ++W+   + G  E
Sbjct: 344 RITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTE 403

Query: 409 YSMSAQMQLPSIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPW 465
            ++SA + +P+    +   +   + P+ + F+I  F+ SG+ V+Y ++++   +Y+   W
Sbjct: 404 NTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKW 462

Query: 466 VRYITQSGDDYTIR 479
           ++YI++SG  Y +R
Sbjct: 463 IKYISKSG-SYEVR 475

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  179 bits (453), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 144/501 (28%), Positives = 239/501 (47%), Gaps = 64/501 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M S V    S+G  +L + +++ +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQ--HND-VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+  H D ++LV I  S +AN+A I+ FLYKL D + N  +   EE++++ F+I++E+LD
Sbjct: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKL-DAVMNAYRLDREEALKEEFMIVHEMLD 114

Query: 148 ETMD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXP------------------- 187
             +   GIP  TE   L   I Q S K V                               
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHF 171

Query: 188 PEALT-------------------NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228
           P+ LT                   N ++WR   I +KK+E FL + E IN+L+++ G IL
Sbjct: 172 PKFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSIL 231

Query: 229 RSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKK------ 282
           +S + G + + + LSG P  + G+ND        +   L  +     S   +K       
Sbjct: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAA 291

Query: 283 KNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHS 342
             ++ LED KFH+CV L KF    II F+PPDG  ELM Y +  +I  L +    I  HS
Sbjct: 292 AGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHS 350

Query: 343 QSRIEIHCR--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKI 400
               EI  R   K+    K +A +V + IPVP      +   S+G  K+VPE+N +IW+ 
Sbjct: 351 TRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRF 410

Query: 401 RSFPGGKEYSMSA-QMQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKL 458
             + G  E ++SA  +       +   +  R P+ ++F++  F+ SG+ V+Y  I+    
Sbjct: 411 NKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKDS 470

Query: 459 QYKSYPWVRYITQSGDDYTIR 479
           ++++  W++YI+++G  Y +R
Sbjct: 471 KHRAVKWIKYISKAG-SYEVR 490

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  178 bits (451), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 139/501 (27%), Positives = 243/501 (48%), Gaps = 64/501 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M S V    S+G  +L + +++ +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQH---NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+    ++++LV I  S +AN+A I+ FLYKL  V+  Y +   EE++++ F+I++E+LD
Sbjct: 57  IRSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLD 114

Query: 148 ETMD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALT-------------- 192
             +   GIP  TE   L   I Q S K +             + L+              
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHF 171

Query: 193 ------------------------NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228
                                   N ++WR   I +KK+E FL + E +N+L+++ G IL
Sbjct: 172 PKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 229 RSEIIGEVKVKSRLSGMPDLKLGINDK-GIFSKHMDD-----DSLNNEGASVASSTTDKK 282
           +S + G + + + LSG P  + G+ND  G+ S+  ++     D  ++ G    +      
Sbjct: 232 KSYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAA 291

Query: 283 KNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHS 342
             ++ LED KFH+CV + KF    II F+PPDG  ELM Y +  +I  L +    I  HS
Sbjct: 292 AGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVAHS 350

Query: 343 QSRIEIHCR--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKI 400
               E+  R   K+    K +A +V + IPVP      +   S+G+ K+VPE+N +IW+ 
Sbjct: 351 ARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRF 410

Query: 401 RSFPGGKEYSMSA-QMQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKL 458
             F G  E ++SA  +       +   +  R P+ + F++  F+ SG+ V+Y  I+    
Sbjct: 411 NKFNGLTENTLSAVTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTISSRDS 470

Query: 459 QYKSYPWVRYITQSGDDYTIR 479
           ++++  W++YI++SG  Y +R
Sbjct: 471 KHRAVKWIKYISKSG-SYEVR 490

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  175 bits (444), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 137/535 (25%), Positives = 244/535 (45%), Gaps = 116/535 (21%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S+++  D +  PL+ + ++    +   E F     ++ + +N+  P + + G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 92  QHNDVYLVAIA-NSMSANAAQIFAFLYKLVDVLGNYLK--TVEEESIRDNFVIIYELLDE 148
             + +Y V+++  S+ ++      +L     +L  YL+   ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 149 TMDYGIPQITETKMLKQYI--------------------------------TQKSFKLVX 176
           ++D+GIPQ+T+  +++  I                                 +KS K   
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 177 XXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQK-GQILRSEIIGE 235
                          T ++SWR   I Y KNE F+D+IES   +M  K  Q+ ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 236 VKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQ 295
           +  +S LSGMP +K+ IN             L +    ++S+              KFHQ
Sbjct: 236 IICRSYLSGMPVVKICIN-----------KMLKDRDQFLSSA--------------KFHQ 270

Query: 296 CVRLSKFETEKIITFIPPDGDFELMNYRLSTSI--KPLIWCDMN--IQVHSQSRIEIHCR 351
           CV L    ++  I FIPPDGDF+L  Y++   I   P+I       ++   + +++I  +
Sbjct: 271 CVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKHKLQISMK 330

Query: 352 AKAQIKKKSTATNVQIIIPVPEDADT--------PEFKYSHGSIKYVPEKNVIIWKIRSF 403
            +   K +++AT + I +P+ +  +T        P FK   GSI +      ++WK    
Sbjct: 331 IQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGM 390

Query: 404 PGGKE---YSMSAQM-------------------------------QLPSIGNIEEHKAK 429
            GG     +SM  +                                +L ++ + E+ +  
Sbjct: 391 KGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQIN 450

Query: 430 RPVQ----IKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480
            PV+     +F++PYFT+SG++V+YLKI E +LQY+S+PWVRY T +  +Y  ++
Sbjct: 451 NPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  173 bits (438), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 138/501 (27%), Positives = 239/501 (47%), Gaps = 64/501 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M S V    S+G  +L + +++ +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQ--HND-VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+  H D ++LV I  S +AN+A I+ FLYKL D + N  +   EE++++ F+I++E+LD
Sbjct: 57  IRSKHGDNLWLVTITRS-NANSAAIWEFLYKL-DAVMNAYRLDREEALKEEFMIVHEMLD 114

Query: 148 ETMD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEAL--------------- 191
             +   GIP  TE   L   + + S K +             + L               
Sbjct: 115 IMLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHF 171

Query: 192 -----------------------TNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228
                                  +N ++WR+  I +KK+E FL + E +N+L+++ G IL
Sbjct: 172 PKFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 229 RSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKK------ 282
           +S + G + + + L+G P  + G+ND        + + L  +     S   +K       
Sbjct: 232 KSYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAA 291

Query: 283 KNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHS 342
             ++ LED KFH+CV + KF    II FIPPDG  ELM Y +  +I  L +    I  HS
Sbjct: 292 AGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHS 350

Query: 343 QSRIEIHCR--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKI 400
               EI  R   K+    K +A +V + IPVP      +   S+G  K+VPE+N +IW+ 
Sbjct: 351 TRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRF 410

Query: 401 RSFPGGKEYSMSAQ-MQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKL 458
             + G  E ++SA  +       +   +  R P+ + F++  F+ SG+ V+Y  I+    
Sbjct: 411 NKYNGLTENTLSAATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKDS 470

Query: 459 QYKSYPWVRYITQSGDDYTIR 479
           ++++  W++YI++SG  Y +R
Sbjct: 471 KHRAVKWIKYISKSG-SYEVR 490

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  172 bits (436), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/501 (28%), Positives = 240/501 (47%), Gaps = 64/501 (12%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M S V    S+G  +L + +++ +  S  + F   ++++L+  +    P L+     +  
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRS----PVLTLGSTTFHH 56

Query: 91  IQ--HND-VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLD 147
           I+  H D ++LV I  S +AN+A I+ FLYKL D + N  +   EE++++ F+I++E+LD
Sbjct: 57  IRSRHGDNLWLVTITRS-NANSAAIWEFLYKL-DFVMNAYRLDREEALKEEFMIVHEMLD 114

Query: 148 ETMD-YGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXXPPEALT-------------- 192
             +   GIP  TE   L   I Q S K V             + L+              
Sbjct: 115 IMLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHF 171

Query: 193 ------------------------NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228
                                   N ++WR   I +KK+E FL + E +N+L+++ G IL
Sbjct: 172 PKFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSIL 231

Query: 229 RSEIIGEVKVKSRLSGMPDLKLGINDK-GIFS----KHMDDDSLNNEGASVASSTTDK-K 282
           +S + G + + + LSG P  + G+ND  G+ S    K +     ++ G   + +   K  
Sbjct: 232 KSYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAA 291

Query: 283 KNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHS 342
             ++ LED KFH+CV L KF     I F+PPDG  ELM Y +  +I  L +    I  HS
Sbjct: 292 AGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHS 350

Query: 343 QSRIEIHCR--AKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKI 400
               EI  R   K+    K +A +V + IPVP      +   S+G  K+VPE+N ++W+ 
Sbjct: 351 TRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRF 410

Query: 401 RSFPGGKEYSMSA-QMQLPSIGNIEEHKAKR-PVQIKFQIPYFTTSGIQVKYLKINEPKL 458
             + G  E ++SA  +       +   +  R P+ + F++  F+ SG+ V+Y  I     
Sbjct: 411 NKYNGLTENTLSAVTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKDS 470

Query: 459 QYKSYPWVRYITQSGDDYTIR 479
           ++++  W++YI++SG  Y +R
Sbjct: 471 KHRAVKWIKYISRSG-SYEVR 490

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  171 bits (432), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/471 (25%), Positives = 217/471 (46%), Gaps = 106/471 (22%)

Query: 79  PCLSYNGMQYLFIQHNDVYLVAIANSM-SANAAQIFAFLYKLVDVLGNYL-KTVEEESIR 136
           P LS+ G  Y++IQ + +Y ++++  + +     +FA+L +L  +   YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 137 DNFVIIYELLDETMDYGIPQITETKMLKQYITQK-------------SFKLVXXXXXXXX 183
           DNF ++YEL+DE++D GIPQ+T+  +++ Y+  +               K          
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 184 XXXPPEAL-------------TNSVSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILR 229
               P A              T+++SWR   I Y KNE FLD++E +  LM  ++ Q+  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 230 SEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELE 289
           +++ G +  +S LSGMP L +G+N   + ++  D  S                       
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNK--MVAQDRDFTS----------------------- 255

Query: 290 DLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSI--KPLI---WCDMNIQVHSQ- 343
            + FHQCV L +  T++ ITF+PPDG+F+L +Y+L+     +PLI    C   ++   + 
Sbjct: 256 QVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRP 315

Query: 344 ---SRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADT--------PEFKYSHGSIKYVPE 392
               R+ +        K +   + +++ +P+    +         P FK   G + +   
Sbjct: 316 ADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNIT 375

Query: 393 KNVIIW---KIRSFPGGKEYSMSAQMQL--------------PSIGNIEEH--------- 426
            + ++W   K +   G + ++M +Q  L               S+  +  H         
Sbjct: 376 DDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALY 435

Query: 427 ---------KAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRY 468
                     A   +++ F++PY T SG++V++LKI EP+LQY+S+PW+RY
Sbjct: 436 NQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  167 bits (423), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 127/428 (29%), Positives = 202/428 (47%), Gaps = 64/428 (14%)

Query: 96  VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM-DYGI 154
           +++VAI  S +AN+  I+ FLYKL  +L  Y     EE + + F++ YE++D  +    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 155 PQITETKMLKQYITQKSFKLVXXXXXXXXXXXP----PEALT---------------NSV 195
           P  TE   +   I+ +  K +                P+ LT               + +
Sbjct: 123 PINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQSDI 182

Query: 196 SWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGIND- 254
            WR   IKYKKNE FL + E IN+L+++   IL++ + G + + S LSG P  + G+ND 
Sbjct: 183 PWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGLNDY 242

Query: 255 ----------KGIFSKH--MDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKF 302
                     +G   +H  MDD+ L         ST     +++++ED  FHQCV L KF
Sbjct: 243 LSMTGNNISNRGDEFRHDFMDDEDL---------STGRSSSSSVKIEDCTFHQCVSLDKF 293

Query: 303 ETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEI---HCRAKAQIKKK 359
             E++I F+PPDG FELM Y +          D+NI      R+ I    C  + +I  K
Sbjct: 294 NDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIILK 345

Query: 360 S------TATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSA 413
           S      +A +  + IP+P      +   S G   +    N  IWK   + G  E  +  
Sbjct: 346 SLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELIL 405

Query: 414 QMQLPSIGNI--EEHKAKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQ 471
           +    S  +I   +   + P+ + F+I  F+ SG+ VKYLK+ E   +Y+   W++Y+++
Sbjct: 406 ETVPSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSK 465

Query: 472 SGDDYTIR 479
           SG  Y IR
Sbjct: 466 SG-SYEIR 472

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  161 bits (408), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 137/534 (25%), Positives = 232/534 (43%), Gaps = 112/534 (20%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIE-KFPTLLSDLEEETNLVPPCLSYNGMQYLF 90
           M+S     D    PL+ R  R   PI  ++     L ++L+       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 91  IQHNDVYLVAIAN-SMSANAAQIFAFLYKLVDVLGNYLKT-VEEESIRDNFVIIYELLDE 148
           I  +++Y   I   + S +   +  +L ++  +   ++   + + ++RDNF +I+E+++E
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVRDNFHLIFEVIEE 117

Query: 149 TMDYGIPQITETKMLKQYITQKSFKL--VXXXXXXXXXXXPP-------------EALTN 193
           + DYGI Q+T   ++  +I  +  K               PP               +T+
Sbjct: 118 SSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYILRTMTS 177

Query: 194 SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGI 252
           +VSWR   I Y KNE FLD+IE +  +M  +  ++R+ +I G +  +S LSGMP L +G+
Sbjct: 178 AVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMPQLSIGL 237

Query: 253 NDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKF--ETEKIITF 310
           N      K M                   +KN   ++ LKFH+CV L     E   +I F
Sbjct: 238 N------KLM-------------------QKNVHFMKRLKFHECVDLHTLIKEESPVIKF 272

Query: 311 IPPDGDFELMNYRLSTSI--KPLIWCDM-------NIQVHSQSRIEIHCRAKAQIKKKST 361
           IPPDG+FEL NY+L+  +  +P+I                +Q ++ +        K + +
Sbjct: 273 IPPDGEFELCNYKLNRPLLDEPVIKLQSFGLSQKPRKNQETQDKLLLKAAITTHFKAQDS 332

Query: 362 ATNVQIIIPVPE-------DADTPE-FKYSHGSIKYVPEKNVIIWKIRSFPGG---KEYS 410
           A  + I IP+         D + P  FK   G + +      IIWKI +  GG   K Y 
Sbjct: 333 AKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKINNLKGGHGNKNYG 392

Query: 411 MSAQMQL-------------------------PSIGNI-EEHKAKRP------------- 431
           +    ++                         P +  I +++  K               
Sbjct: 393 LKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTTEYDGNENQKEDVD 452

Query: 432 ----VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRLT 481
               + + F+IPY+  SG++V+Y KI EP+L Y+S+PWVRY T + ++Y  +++
Sbjct: 453 KFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDNEYIYQVS 506

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  154 bits (388), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 121/486 (24%), Positives = 220/486 (45%), Gaps = 109/486 (22%)

Query: 79  PCLSYNGMQYLFIQHNDVYLVAIANSMS-ANAAQIFAFLYKLVDVLGNYL-KTVEEESIR 136
           P L      Y+FIQ + +Y ++++  ++      +F++L +L  +   YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 137 DNFVIIYELLDETMDYGIPQITETKMLKQYITQKSFK----------------------- 173
            NF +I+EL+DE++  G PQ+T+  +++ YI  +  K                       
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDS 160

Query: 174 -----LVXXXXXXXXXXXPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQIL 228
                                  T+++SWR   I Y KNE +LD+IE +  L+  +   +
Sbjct: 161 KKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNI 220

Query: 229 RSEII-GEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIE 287
           +S  + G ++ +S LSGMP L +G+N             LN+E             N   
Sbjct: 221 KSNTVYGYIQCRSYLSGMPMLTIGLN------------KLNSE-------------NEYF 255

Query: 288 LEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIK--PLIW---CDMNIQVHS 342
           +    FHQCV L +  T+K+I+F PPDG+F+L NY+L+ ++   P+I    C + ++   
Sbjct: 256 MRRANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRK 315

Query: 343 Q----SRIEIHCRAKAQIKKKSTATNVQIIIPVPE-----DAD---TPEFKYSHGSIKYV 390
                 R+ +        K + + + + I +P+ +     D D    P FK   G + + 
Sbjct: 316 TKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFN 375

Query: 391 PEKNVIIWKIRSFPGG----------------KEYSMSAQMQL------------PSIGN 422
              + ++W++    GG                +E+    + QL            P +  
Sbjct: 376 ITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEK 435

Query: 423 I--EEHKAKRP------VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGD 474
           +  + H+   P      ++++F+IPY+T SG++V++LKI E +LQ++S+PWVRY T + D
Sbjct: 436 LYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHD 495

Query: 475 DYTIRL 480
            Y  +L
Sbjct: 496 IYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  141 bits (356), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/487 (23%), Positives = 231/487 (47%), Gaps = 53/487 (10%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPT-LLSDLEEETNLVPPCLSYNGMQYLF 90
           M +AV    ++G  ++++ ++  +  S  + F   +++ L+  + ++   L      Y+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 91  IQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETM 150
                +++V+++ + + N+A  + FLYK   +L  Y +   EE +++ F++ +ELLD  +
Sbjct: 59  TPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 151 DYG-IPQITETKML--------------------KQYITQKSFKLVXXXXXXXXXXXPPE 189
           + G IP  T+   +                    +Q  T  +                P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPG 176

Query: 190 ALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLK 249
            ++          + K+NE  + + ESI++L+++ G IL++ + G + + ++L G    +
Sbjct: 177 GISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQ 236

Query: 250 LGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIE----------LEDLKFHQCVRL 299
            G+ND         D+S N++   + S  T  +  N+E          L D KFHQCV L
Sbjct: 237 FGLNDS-----LSTDNSSNSKWDPLRSKET--QGTNLEMKNAHVGTVLLRDCKFHQCVSL 289

Query: 300 SKFETEKIITFIPPDGDFELMNYRLSTSIK-PLIWCDMNIQVHSQSRIEIHCRAKAQIKK 358
            +F+ ++II F PP+G  ELM Y +  ++  P     M I   + +  +     K+    
Sbjct: 290 ERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPT-ANNETDYRVTIKSLFPG 348

Query: 359 KSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLP 418
           K +A NV + IPVP      +   S+G+ K++PE+N ++WK   + G  E  +SA + +P
Sbjct: 349 KLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITVP 407

Query: 419 SIGNIE---EHKAKRPVQIKFQIPYFTTSGIQVKYLKI---NEPKLQYKSYPWVRYITQS 472
           +    +   +  ++ P+ + F+I  ++ +G+ V+Y  +   +    ++K+  W++Y++ S
Sbjct: 408 TRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVSHS 467

Query: 473 GDDYTIR 479
           G  Y +R
Sbjct: 468 G-SYEVR 473

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  135 bits (339), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 155/332 (46%), Gaps = 76/332 (22%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGIN 253
           VSWR+  I Y +NE FLD++E +  LM     I++  +I G++  KS LSGMP LK+  N
Sbjct: 216 VSWRAKGIHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN 275

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313
                        L+ +     S +             KFHQCV       EK I FIPP
Sbjct: 276 ------------KLSQKDEQFISHS-------------KFHQCVTWPS-SNEKEIEFIPP 309

Query: 314 DGDFELMNYRLSTSIK--PLI-WCDMNIQVH-SQSRIEIHCRAKAQIKKKSTATNVQIII 369
           DGDF L  Y L   +K  P++      ++    + +I++ C  +   K +++ + + + I
Sbjct: 310 DGDFVLCQYELKRHVKDQPMLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKI 369

Query: 370 PVPE-------DADTP-EFKYSHGSIKYVPEKNVIIWKIRSFPGGK---EYSMSAQMQL- 417
           P+         D   P  FK   G + +    + ++W I    GG    + SM+A+  L 
Sbjct: 370 PLARLFQEYQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLF 429

Query: 418 ------------------PSIGN---IEE-----HKAKRP-------VQIKFQIPYFTTS 444
                             P + +   +EE     H  K P       + +KF+IPY T S
Sbjct: 430 NKKEFEEEQEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCS 489

Query: 445 GIQVKYLKINEPKLQYKSYPWVRYITQSGDDY 476
           G+QV+YLKI+E +LQY+S+PWVRY T + ++Y
Sbjct: 490 GLQVEYLKIDEEQLQYQSFPWVRYKTVNDEEY 521

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 73/144 (50%), Gaps = 11/144 (7%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEE-ETNLVPPCLSYNGMQYLF 90
           M+S ++  D    PL+++       I AI     +L   +   T    P +S +   ++ 
Sbjct: 1   MSSCIFITDENLEPLISKN------IKAIPNLQGILRLFKSVYTPESQPVISASSFHFVH 54

Query: 91  IQHNDVYLVAI--ANSMSANAAQIFAFLYKLVDVLGNYL--KTVEEESIRDNFVIIYELL 146
           I+ + +  V++  A   SAN   I  FL +   +L  YL    +++  + DN ++I EL+
Sbjct: 55  IKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELI 114

Query: 147 DETMDYGIPQITETKMLKQYITQK 170
           DE++D+G+ QIT+  +++ YI  K
Sbjct: 115 DESIDFGVIQITDASIMRDYIRVK 138

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 104/349 (29%), Positives = 163/349 (46%), Gaps = 92/349 (26%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           VSWR+  I Y KNE FLD+IE +  LM    G+I ++ I GE+K K  LSGMP LK+ +N
Sbjct: 216 VSWRTKGIYYAKNEFFLDVIEKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN 275

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETE-------- 305
                        + N+   +++S              KFHQCV ++  + E        
Sbjct: 276 -----------KLIKNDEQFISNS--------------KFHQCVSINSLKREINNEEEEN 310

Query: 306 ----KIITFIPPDGDFELMNYRLSTSIK--PLIWCDMNIQVH---SQSRIEIHCRAKAQI 356
               K I FIPPDG+F L  Y L   ++  P+I    NI++     + +I+IH   +   
Sbjct: 311 TYHGKEIEFIPPDGEFVLCKYELKRHVRDVPVIKLS-NIEIKPKLKKYKIQIHVTIETHF 369

Query: 357 KKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGG-- 406
           KK+++ + + I IP+         +    P FK   G + +    + +IW++ S  GG  
Sbjct: 370 KKQNSTSVLTIKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNG 429

Query: 407 ---------------KEYS-----MSAQMQLPSI--------------GNIEEHK----A 428
                          +EY      M   M  P +               N +EH     +
Sbjct: 430 ESKNNMVAEFFIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGIS 489

Query: 429 KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
           ++ + +KF++PY T SG++V+YLKI E ++ Y+S+PWVRY T + D+Y 
Sbjct: 490 QQLLTMKFEVPYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEYA 538

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 72/145 (49%), Gaps = 12/145 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S ++  D    PL+++  +    ++ I +F  L  + +E     PP  +     Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL--NYKENG---PPVFTVLEWHYVFI 55

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKT------VEEESIRDNFVIIYEL 145
           + + ++ +   +        + A  + L D L   LKT      ++   + DN ++I EL
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYL-DQLYLLLKTYFNRSSLDRNIVLDNVLLIIEL 114

Query: 146 LDETMDYGIPQITETKMLKQYITQK 170
           +DE+MD+GI Q+T+  ++K YI  K
Sbjct: 115 IDESMDFGIVQLTDPSIIKDYIRVK 139

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  134 bits (337), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 105/342 (30%), Positives = 166/342 (48%), Gaps = 61/342 (17%)

Query: 192 TNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKL 250
           T +VSWR+  I Y KNE FLD++ES+  LM  K +++R  +I G++K KS LSGMP L++
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELE-DLKFHQCVRLSKFETEKIIT 309
            +N      K + DD      A      +    N  +LE DL+    +    F  +K I 
Sbjct: 282 ALN------KILQDDKQFLGHAKFHQCVSLNSINIKDLEKDLEGPNDISNKNFVNKKEIE 335

Query: 310 FIPPDGDFELMNYRLSTSIK--PLI-WCDMNIQVH-SQSRIEIHCRAKAQIKKKSTATNV 365
           FIPPDG+F L  Y L   +K  P+I     +I+ +  + R++I  + +   K++++ + +
Sbjct: 336 FIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQISLKIETHFKRQNSTSLM 395

Query: 366 QIIIPVPE--------DADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGG---KEYSMSAQ 414
            I IP+ +         +  P FK   G + +   ++ +IW+I +  GG    E  M A+
Sbjct: 396 TIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAE 455

Query: 415 -------------------MQLPSIGN----------------IEEHKAKRPVQ---IKF 436
                              M  P + N                 E+   K   Q   ++F
Sbjct: 456 FFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKTQYVFMQF 515

Query: 437 QIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTI 478
           +IPY T SG++V+YLKI E  L+Y+S+PWVRY T + D+Y  
Sbjct: 516 EIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEE-TNLVPPCLSYNGMQYLF 90
           M+S ++  D    PL+++  +       +   P ++   +E  T   PP ++ +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 91  IQHNDVYLVAIANSM---SANAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVIIYEL 145
           ++ + ++ VA  + M     N   I  +L +L  +L NY K   + +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 146 LDETMDYGIPQITETKMLKQYITQK 170
           +DE++D+GI Q+T+  +++ YI  K
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYIRVK 139

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  128 bits (322), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 155/341 (45%), Gaps = 82/341 (24%)

Query: 192 TNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKL 250
           T  VSWR+  I Y KNE FLD++E +  L   K +++R  +I G++  KS LSGMP LK+
Sbjct: 233 TMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKI 292

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITF 310
            +N             L    A   S +             KFHQCV L     EK + F
Sbjct: 293 ALN------------KLLQRDAQFMSHS-------------KFHQCVALETL-NEKELEF 326

Query: 311 IPPDGDFELMNYRL-----STSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNV 365
           IPPDG+F L  Y L      T I  +   ++  Q+  + ++ I    +   K +++ + +
Sbjct: 327 IPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSIL 385

Query: 366 QIIIPVPE-------DADTP-EFKYSHGSIKYVPEKNVIIWKIRSFPGGK---EYSMSAQ 414
            + IP+ +       D   P  FK + G + +    + ++W+I    GG    ++SM A+
Sbjct: 386 NVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAE 445

Query: 415 MQL-------------------------PSIGNI--EEHKAKRP-----------VQIKF 436
             L                         P +  +  + H  K P           V + F
Sbjct: 446 FSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDF 505

Query: 437 QIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
           +IPY T SG++V+YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 506 EIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 11/141 (7%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M+S +Y  D    PL+++       I +I    TL+   +E  +   P + +N   Y   
Sbjct: 1   MSSCLYILDENLEPLISKN------IKSIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 92  QHND--VYLVAI-ANSMSANAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVIIYELL 146
              D  ++L AI     SANA  I  ++ +   +L  YL    ++   + DN +++ ELL
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNLVLDNVLLVLELL 114

Query: 147 DETMDYGIPQITETKMLKQYI 167
           +E+ ++G+PQ+TE  ++K YI
Sbjct: 115 EESSEFGVPQMTEPSVMKDYI 135

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  128 bits (321), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 155/341 (45%), Gaps = 82/341 (24%)

Query: 194 SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGI 252
           SVSWR+  I+Y KNE FLD+IE +   M     I++  +I GE+  KS LSGMP LK+ +
Sbjct: 222 SVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSL 281

Query: 253 NDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIP 312
           N K I+                     DK+     L   KFHQCV     +  K++ F+P
Sbjct: 282 N-KIIYQ--------------------DKQF----LSSCKFHQCVMPDSVDEGKVLEFVP 316

Query: 313 PDGDFELMNYRLSTSIKPLIWCDM-NIQVH---SQSRIEIHCRAKAQIKKKSTATNVQII 368
           PDGDF L  Y L   +  L    + + +V     + ++++    ++  KK ++ T + I 
Sbjct: 317 PDGDFVLCKYELKRHVNDLPLLKLISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNIK 376

Query: 369 IPV-----PEDADTP---EFKYSHGSIKYVPEKNVIIWKIRSFPGG-------------- 406
           IP+       D D     + +   G I +    + ++W+I +  GG              
Sbjct: 377 IPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFN 436

Query: 407 KEYSMSAQMQLPSIGN----------------IEEHKAK--------------RPVQIKF 436
           +E  +  Q +L +  N                I E K                  +++ F
Sbjct: 437 EEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDF 496

Query: 437 QIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
           +IPY T+SG++V+YLKI EP LQY+++PWVRY T S D Y 
Sbjct: 497 EIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 14/142 (9%)

Query: 32  MASAVYFCDSKGYPLLARRYRD----DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQ 87
           M+S +Y  +     LL++  +     DIP+S  +K          +  +  P + Y    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLSLFKK-------QFHKHQVTTPVIIYEDYI 53

Query: 88  YLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNY--LKTVEEESIRDNFVIIYEL 145
           +  IQ + +Y V+  +    N  +   +L +   +L NY  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVSSIDC-KTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 146 LDETMDYGIPQITETKMLKQYI 167
           ++E++D+GI QIT++ ++K YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  125 bits (315), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 116/470 (24%), Positives = 217/470 (46%), Gaps = 63/470 (13%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           M SA+     +G  ++++ YR++I  S  E F   + +     N+  P L+     +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVIN---NFNVRSPILTLGSTTFHHI 57

Query: 92  QH-------NDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYE 144
           +        ++++LV + N  +AN+A I+ FL KL  +L  Y  T  E  ++D F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCV-NRNNANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHE 115

Query: 145 LLDETM-DYGIPQITETKMLKQYITQKSFKLVXXXXXXXXXXX-----------PPEALT 192
           +LD  +   GI Q T+   LK  + + S K +                       P A  
Sbjct: 116 ILDNMLLGTGIIQNTD---LKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANF 172

Query: 193 NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGI 252
           + +     D  +KKNE F  + ES+N+L+++ G IL++ + G++++KS L+G P  +  +
Sbjct: 173 SLIPTNRHD-AHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFEL 231

Query: 253 NDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIP 312
                    +DD +                    ++ D KF QC+   +  T ++     
Sbjct: 232 ---------VDDQT--------------------KITDFKFDQCIEKVQSRTVRVA---A 259

Query: 313 PDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVP 372
            DG+ E++NY +      + +    I    +  ++     K+   K  +AT+V + IPVP
Sbjct: 260 TDGELEIVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKSLFPKNLSATDVVLTIPVP 319

Query: 373 EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRP- 431
            +    +   S+G  K+  E+N +IW    F G  E ++SA         +      RP 
Sbjct: 320 PNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLESWTRPS 379

Query: 432 VQIKFQIPYFTTSGIQVKYLKI-NEPKLQYKSYPWVRYITQSGDDYTIRL 480
           +Q+ F+I  ++ SG+ ++ L I ++ K +YK+  W++YI+++G  Y +R 
Sbjct: 380 IQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG-SYEMRF 428

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  127 bits (319), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 104/372 (27%), Positives = 164/372 (44%), Gaps = 114/372 (30%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           VSWR+  I Y KNE FLD+IE +  L+  + G + RS I G++  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFE---------- 303
                        L N+   ++               ++FHQCV L   E          
Sbjct: 309 -----------KLLQNDKQFISQ--------------VQFHQCVSLDSIEKVIKYAEEHS 343

Query: 304 ------------TEKIITFIPPDGDFELMNYRLSTSIK--PLI-WCDMNIQVH-SQSRIE 347
                        E  I FIPPDGDF L +Y L   I+  P++  C   I     + +++
Sbjct: 344 DELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLK 403

Query: 348 IHCRAKAQIKKKSTATNVQIIIPVPE-------DADTP-EFKYSHGSIKYVPEKNVIIWK 399
           I    +   K  ++ + + + IP+ +       D   P +FK S+G + Y    + ++W+
Sbjct: 404 ISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWE 463

Query: 400 IRSFPGGKEY-------------SMSAQMQL-------------------------PSIG 421
           I    GGK +             +M+A+  L                         P + 
Sbjct: 464 IGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLE 523

Query: 422 NI--EEHK--------AKRP------VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPW 465
           +I  E H+         ++P      + + F+IPY T SG++V+YLKI+E +LQY+S+PW
Sbjct: 524 DIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPW 583

Query: 466 VRYITQSGDDYT 477
           VRY T + D+Y 
Sbjct: 584 VRYKTINDDEYA 595

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 78/148 (52%), Gaps = 24/148 (16%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTL--LSDL-----EEETNLVPPCLSYN 84
           M+S++Y  D    PL+++         +++  P +  L DL      +  N   P +   
Sbjct: 1   MSSSIYIFDETLEPLVSK---------SVKGLPNVNELGDLFRYHVRQSQN---PIIDVY 48

Query: 85  GMQYLFIQHNDVYLVAIANSMS---ANAAQIFAFLYKLVDVLGNYL--KTVEEESIRDNF 139
             ++++I+ + +Y VA+ ++     AN   I  +L +L  +  +Y+  K ++   + DN 
Sbjct: 49  NWRFVYIKRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNT 108

Query: 140 VIIYELLDETMDYGIPQITETKMLKQYI 167
           +++ EL+DET+DYGI Q+TE  ++K YI
Sbjct: 109 LLVMELIDETLDYGIVQLTEPSIMKDYI 136

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  125 bits (315), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 100/366 (27%), Positives = 160/366 (43%), Gaps = 108/366 (29%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD+IE +  LM  +KG I ++ I GE+  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET--------- 304
                        LN +   +++S+              FHQCV L   +T         
Sbjct: 320 -----------KILNRDAQFLSNSS--------------FHQCVSLDSIKTIEKREEKED 354

Query: 305 ----------EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNIQVH-SQSRIEIHC 350
                      K + F+PPDG+F L  Y L   +K  P+I   D  I+    + +I+I  
Sbjct: 355 DDTGLQAAADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIET 414

Query: 351 RAKAQIKKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRS 402
           + +   K  ++ + + + IP+         + +    FK + G + +    + ++W+I++
Sbjct: 415 KIQTNFKPTNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQA 474

Query: 403 FPGGKEY----------------SMSAQMQL---PSIGNIEEHKA--------------- 428
             G +E+                SM A+  L        ++E K                
Sbjct: 475 MKGHREHNTNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLE 534

Query: 429 -----------------KRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQ 471
                             + V I F+IPY T SG++++YLK+ EP+LQY+S+PWVRY T 
Sbjct: 535 ELYRQVHDQQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTT 594

Query: 472 SGDDYT 477
           S D+Y 
Sbjct: 595 SDDEYA 600

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 58/99 (58%), Gaps = 5/99 (5%)

Query: 77  VPPCLSYNGMQYLFIQHNDVYLVAIANSM---SANAAQIFAFLYKLVDVLGNY--LKTVE 131
            PP LS N   ++ ++ + ++ V++ ++    + +   I AFL +   +L  Y  +K + 
Sbjct: 41  APPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLT 100

Query: 132 EESIRDNFVIIYELLDETMDYGIPQITETKMLKQYITQK 170
           ++ I DN +++ EL+DE +D+GI Q+T+  ++K YI  K
Sbjct: 101 KDVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  124 bits (312), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 102/366 (27%), Positives = 160/366 (43%), Gaps = 108/366 (29%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD+IE +  LM  +KG I ++ I GE+  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET--------- 304
                        LN +   +++S               FHQCV L    T         
Sbjct: 313 -----------KILNRDPQFMSNSN--------------FHQCVSLDSINTIEKGQEKEQ 347

Query: 305 ----------EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNIQVH-SQSRIEIHC 350
                      + I F+PPDG+F L  Y L   +K  P+I   D  I+    +S+I+I  
Sbjct: 348 NTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILT 407

Query: 351 RAKAQIKKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRS 402
           + +   K  ++ + + + IP+         + +    FK ++G + +    + ++W+I++
Sbjct: 408 KIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQT 467

Query: 403 FPGGKEYSMSAQMQLP-------------SIGNIEEHK---------------------- 427
             G +E + S   Q               S+ N EE+                       
Sbjct: 468 MKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLE 527

Query: 428 ----------------AKRPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQ 471
                             R V I F+IPY T SG++V+YLK+ EP+LQY+S+PWVRY T 
Sbjct: 528 ELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTV 587

Query: 472 SGDDYT 477
           + ++Y 
Sbjct: 588 NDEEYA 593

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 80/145 (55%), Gaps = 12/145 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEE-ETNLVPPCLSYNGMQYLF 90
           M+S+++  D    P++++  R      A+    ++LS  ++   +  PP L  N   ++ 
Sbjct: 1   MSSSLFILDEDLEPVVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILFQNDWFFIH 54

Query: 91  IQHNDVYLVAIANSM---SANAAQIFAFLYKLVDVLGNY--LKTVEEESIRDNFVIIYEL 145
           ++ + ++LV++ ++    + +   I AFL +   +L  Y  +K + ++ I DN +++ EL
Sbjct: 55  LKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLEL 114

Query: 146 LDETMDYGIPQITETKMLKQYITQK 170
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 MDECIDFGIVQVTDPSIIKDYIRVK 139

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  122 bits (305), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 158/352 (44%), Gaps = 95/352 (26%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FL++IE +   M     +++  +I GE++ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET--EKIITFI 311
                        + NE         DK+     L + KFHQCV L+  E+   K + F+
Sbjct: 313 ------------KIVNE---------DKQF----LANCKFHQCVSLASLESSDHKDVEFV 347

Query: 312 PPDGDFELMNYRLSTSIK--PLIWCDMNIQVHSQSRIEIHCRAKA-QIKKKSTATNVQII 368
           PPDG+F L  Y L   ++  P++   +N +V  + +          +   K+T    ++ 
Sbjct: 348 PPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLA 406

Query: 369 IPVPEDADTPEF----------KYSHGSIKYVPEKNVIIWKIRSFPGG------------ 406
           + VP      E+          K   G+I +    + ++W++ S  GG            
Sbjct: 407 LRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSMGVEF 466

Query: 407 -----KEYSMSAQMQLPSI--------------------------GNIE---EHKAK--- 429
                +EY    +M   S+                          GN E   EH+ +   
Sbjct: 467 ALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRLQPRT 526

Query: 430 ----RPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
               + + + F++PY T+SG++V+YLKI EP+L+Y+S+PWVRY T S  +Y 
Sbjct: 527 REIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 77  VPPCLSYNGM-QYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYL--KTVEEE 133
            PP + Y+ +  + +IQ + +  V++ + +     +   +L    +VL NYL  K +++ 
Sbjct: 41  APPVIDYHDLFTFTYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKN 100

Query: 134 SIRDNFVIIYELLDETMDYGIPQITETKMLKQYITQK 170
            + DN V+I EL++ET+D+G  Q+T++ +L  YI  K
Sbjct: 101 IVTDNSVLISELIEETIDFGAIQVTDSGLLADYIKMK 137

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  122 bits (305), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 100/349 (28%), Positives = 159/349 (45%), Gaps = 79/349 (22%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD+IE +   M  K  ++R  +I GE+  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 254 ----------DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFE 303
                         F + +  DS+       A     KKKN  E + L        +K E
Sbjct: 310 KILKQDVQFLSNVKFHQCVSLDSIRARSNPPAVEEDGKKKNE-EADTLG-------NKGE 361

Query: 304 TEKIITFIPPDGDFELMNYRLSTSIK--PLIWCDMNIQV---HSQSRIEIHCRAKAQIKK 358
            E    FIPPDG+F L  Y L   +K  P+I    N ++     + +I+IH   +   K 
Sbjct: 362 IE----FIPPDGEFLLCKYELKRHVKDQPMIKL-RNFEIIPKLHKFKIKIHVIIETHFKT 416

Query: 359 KSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGG---K 407
            ++ + + + IP+         + +  P+FK   G++ +      ++W++ +  GG    
Sbjct: 417 TNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTMNGGHGEN 476

Query: 408 EYSMSAQMQL-------------------------PSI----------GNIEEHKAKRP- 431
             SM A+  L                         P +          G+ +E   ++  
Sbjct: 477 TLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDEVSTRKKN 536

Query: 432 ---VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
              + + F++PY T SG++++YLKI E +LQY+S+PWVRY T S D+Y 
Sbjct: 537 ESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 79/146 (54%), Gaps = 13/146 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEE--ETNLVPPCLSYNGM--Q 87
           M+S+++  D    P++ +  R      A+   P+L++  +E   +N V P    N +  Q
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 88  YLFIQHND-VYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVIIYE 144
           +L I+ +  V+L  + N+   N   +F +L +   +L +YL    +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 145 LLDETMDYGIPQITETKMLKQYITQK 170
           L+DE++D+G+ Q T++ ++K Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  121 bits (304), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 159/370 (42%), Gaps = 112/370 (30%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD+IE +  LM  +KG I ++ I GE+  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET--------- 304
                        LN +   +++S+              FHQCV L    T         
Sbjct: 318 K-----------ILNRDPQFMSNSS--------------FHQCVSLDSINTIEKDEEKNS 352

Query: 305 -----------EKIITFIPPDGDFELMNYRLSTSIK--PLIWC-DMNIQVH-SQSRIEIH 349
                       + I FIPPDG+F L  Y L   +K  P++   D  I+    + +I+I 
Sbjct: 353 DDDAGLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIV 412

Query: 350 CRAKAQIKKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIR 401
            + +   K  ++ + + + IP+         + +    FK + G + +    + ++W+I+
Sbjct: 413 TKIQTNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQ 472

Query: 402 SFPGGKEYS--------------------------------------MSAQMQLPSIGN- 422
           +  G +E+S                                      M   M  P +   
Sbjct: 473 TMKGHREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTG 532

Query: 423 --IEE-----------HKAKRP--VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVR 467
             +EE           H   R   V I F+IPY T SG++V+YLK+ EP+LQY+S+PWVR
Sbjct: 533 PRLEELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 592

Query: 468 YITQSGDDYT 477
           Y T S ++Y 
Sbjct: 593 YKTVSDEEYA 602

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 79/145 (54%), Gaps = 12/145 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEE-ETNLVPPCLSYNGMQYLF 90
           M+S+++  D    PL+++  R      A+    ++LS  ++   +  PP LS N   ++ 
Sbjct: 1   MSSSLFILDENLEPLVSKNIR------ALPNLSSVLSSFKQCYHDGSPPILSQNDWFFIH 54

Query: 91  IQHNDVYLVAIANSM---SANAAQIFAFLYKLVDVLGNY--LKTVEEESIRDNFVIIYEL 145
           ++ + ++ V++ ++    + +   I AFL +   +L  Y  ++ + +  I DN +++ EL
Sbjct: 55  LKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLEL 114

Query: 146 LDETMDYGIPQITETKMLKQYITQK 170
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 IDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/368 (27%), Positives = 162/368 (44%), Gaps = 111/368 (30%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD+IE +  LM  +KG I ++ I GE+  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRL-------------- 299
                        LN +   +++S              KFHQCV L              
Sbjct: 312 -----------KLLNRDPQFMSNS--------------KFHQCVSLDSINIIEEEGRDTD 346

Query: 300 ---SKFETE-KIITFIPPDGDFELMNYRLSTSIK--PLIWCDMNIQVH---SQSRIEIHC 350
              S+  T+ K I FIPPDG+F L  Y L   +K  P+I      ++     + +I+I  
Sbjct: 347 DAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKL-QGFEIKPKLKKFKIQIIT 405

Query: 351 RAKAQIKKKSTATNVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRS 402
           + +   K  ++ + + + IP+         + +    FK + G + +    + ++W+I +
Sbjct: 406 KIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGT 465

Query: 403 FPGGKE---------------YSMSAQMQL-------------------------PSIGN 422
             G +E                SM A+  L                         P +  
Sbjct: 466 MKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKLEE 525

Query: 423 I--EEHKAK-----------RPVQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYI 469
           +  + H+ +           + V + F+IPY T SG++V+YLK+ EP+LQY+S+PWVRY 
Sbjct: 526 LYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYK 585

Query: 470 TQSGDDYT 477
           T S D+Y 
Sbjct: 586 TISDDEYA 593

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 79/145 (54%), Gaps = 12/145 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNL-VPPCLSYNGMQYLF 90
           M+S+++  D    PL+++  R      AI    ++LS  ++  +   PP LS NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKNIR------AIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 91  IQHNDVYLVAIANSM---SANAAQIFAFLYKLVDVLGNYLK--TVEEESIRDNFVIIYEL 145
           ++ + ++ +++ ++    + +   I AFL +   +L  Y +   + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 146 LDETMDYGIPQITETKMLKQYITQK 170
           +DE +D+GI Q+T+  ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 118/244 (48%), Gaps = 26/244 (10%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMT-QKGQILRSEIIGEVKVKSRLSGMPDLKLGI- 252
           +SWR+  I Y KNE FLD+IE +   M  +KG I ++ I GE+  K  LSGMP LK+ I 
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 253 ----NDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKII 308
               ND    S       ++ +   + S+  D   +N  + + + H      + + +K I
Sbjct: 355 KILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVNENENH-----DERDRKKEI 409

Query: 309 TFIPPDGDFELMNYRLSTSIK--PLI---WCDMNIQVHSQSRIEIHCRAKAQIKKKSTAT 363
            FIPPDGDF L  Y L   +K  P+I     D+  ++ S+ +++IH   +   K  +  +
Sbjct: 410 EFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIHVIIETHFKTTNNTS 468

Query: 364 NVQIIIPVP--------EDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGK-EYSMSAQ 414
            + + IP+         + +   +FK   G + +    N +IW+I S  GG  E +MS  
Sbjct: 469 KLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIGSMKGGHGEVTMSMM 528

Query: 415 MQLP 418
            + P
Sbjct: 529 AEFP 532

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 39/46 (84%)

Query: 432 VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYT 477
           ++I F+IPY+T SG++++YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 57/89 (64%), Gaps = 3/89 (3%)

Query: 85  GMQYLFIQHNDVYLVAIANSMSANAAQI-FAFLYKLVDVLGNYLKT--VEEESIRDNFVI 141
           G Q+L I+ + +  V+I  + S N+  I F++L +   +L +YL    +++  + DNF++
Sbjct: 75  GWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKLDKGLLIDNFLL 134

Query: 142 IYELLDETMDYGIPQITETKMLKQYITQK 170
           + ELLDE++D+GI Q T++ ++K YI  K
Sbjct: 135 VMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 114/233 (48%), Gaps = 41/233 (17%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEII-GEVKVKSRLSGMPDLKLGIN 253
           +SWR+  I Y KNE FLD++E    +M  K  ++R  +I G++  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 254 DKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPP 313
                 K +                   +K+   L  L+FHQCV L   + ++ I FIPP
Sbjct: 347 ------KLL-------------------QKDQQFLSQLRFHQCVSLETIQNKE-IEFIPP 380

Query: 314 DGDFELMNYRLSTSIK-----PLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQII 368
           DG+F L  Y L   +K      LI  ++  ++  + +I+I+       K +++ + + + 
Sbjct: 381 DGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLK 439

Query: 369 IPVPEDAD--------TPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSA 413
           IP+ +  +        +P FK + G +K+    + ++W+I S  GG   ++ A
Sbjct: 440 IPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 34/45 (75%)

Query: 432 VQIKFQIPYFTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDY 476
           + + F+IPY+  SG++V+YLKI E +L Y+S+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEE--TNLVP-PCLSYNGMQY 88
           M S ++  D    PL+++  R      AI  F +++    +   TN    P +S N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 89  LFIQHND-VYLVAIA-NSMSANAAQIFAFLYKLVDVLGNYLKT--VEEESIRDNFVIIYE 144
           + I+ +  ++L AI  N   ++   +  +L K   +L  +LKT  +    I DN ++I E
Sbjct: 55  IQIKRDSLIFLGAININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIME 114

Query: 145 LLDETMDYGIPQITETKMLKQYITQK 170
           L+DE++D+GI Q+T+  ++K Y+  K
Sbjct: 115 LIDESIDFGIIQMTDPNIIKDYVRVK 140

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 68.9 bits (167), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 105/273 (38%), Gaps = 66/273 (24%)

Query: 84  NGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLK--TVEEESIRDNFVI 141
           +G++Y  +Q  +     I    + N  + F FL  +  +L  Y     ++   I  N+  
Sbjct: 72  DGLRYWCLQRTE-----IGEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 142 IYELLDETMDYGIPQITETKMLKQYITQKS-FKLVXXXXXXXXXXXPPEALTN------- 193
           +  L +  +D G P IT+   LK+ +  K+ F  V              A  N       
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 194 ----------------SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQI-----LRSEI 232
                           +V WRSA +KY  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 233 IGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLK 292
            GEV  K  LS  P ++L +N  G    H                         +L    
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG----H-------------------------DLGIPA 277

Query: 293 FHQCVRLSKFETE-KIITFIPPDGDFELMNYRL 324
           FH+CVR    +     + FIPPDGDF LM Y +
Sbjct: 278 FHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 33/137 (24%)

Query: 194 SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQ---ILRSEIIGEVKVKSRLSGMPDLKL 250
           +V WR+AD +Y  NE ++D++E++N  + QKG    ++   + G++ VK  LSG P ++L
Sbjct: 139 TVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQL 198

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITF 310
            +   G    H  D+S                           H+CV L +     +  F
Sbjct: 199 KLRTSG----HPLDNS-------------------------ALHRCVELGEAGVATM-NF 228

Query: 311 IPPDGDFELMNYRLSTS 327
           +PPDG F L  Y +  S
Sbjct: 229 VPPDGRFTLAEYAIDLS 245

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 126/313 (40%), Gaps = 65/313 (20%)

Query: 188 PEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQK---GQI--LRSEIIGEVKVKSRL 242
           P A    V WRSA +KY  NE ++D++E++++++ +    G++  +R  + G V  +S L
Sbjct: 179 PAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSHL 238

Query: 243 SGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKF 302
           SG P + L +  +G    H                         +L     HQC   S  
Sbjct: 239 SGNPVIALNLRLRG----H-------------------------DLGMPALHQCCLDSYQ 269

Query: 303 ETEKIITFIPPDGDFELMNYRL---STSIKPLIWCDMNIQVHSQSRIEI-----HCRAKA 354
                + F+PPDG F+LM+Y +   S   K  ++ ++ + V    R E+           
Sbjct: 270 GRPDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEVNL 328

Query: 355 QIKKKSTATNVQIII------PVPEDADTPEFKYSHGSIKYVPEKNVIIWKI-RSFPGGK 407
            I     A  V  ++      P+P +      + +HG  +     N+  W   +  P G 
Sbjct: 329 NIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGT 388

Query: 408 EYSMSAQMQLPSIGNIEEHKAKRPVQ-IKFQIPYFTT----SGIQVKYLKI-NEPKLQYK 461
                    LP +    E+  +  V+ ++  + Y       SGI+V  + I +      K
Sbjct: 389 ---------LPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDILSGLSKNIK 439

Query: 462 SYPWVRYITQSGD 474
            +  V+YI ++GD
Sbjct: 440 PFKGVKYIAKTGD 452

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 68/150 (45%), Gaps = 37/150 (24%)

Query: 188 PEALTNS--VSWRSADIKYKKNEAFLDIIESINML-----MTQKGQILRSEIIGEVKVKS 240
           PE L +   V WRS  +KY  +E ++DIIE+++++          Q++   I G+V VKS
Sbjct: 183 PEILESEEVVPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKS 242

Query: 241 RLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLS 300
            LSG P ++            MD D   NE  + +                  HQCV + 
Sbjct: 243 YLSGNPTVE------------MDMDLAGNEMYAPS-----------------MHQCVEMP 273

Query: 301 KFETEKIITFIPPDGDFELMNYRLSTSIKP 330
           +      + FIPPDG+  L+NY +   + P
Sbjct: 274 QGSPSS-LCFIPPDGNCNLLNYTIDLDMNP 302

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 45/148 (30%)

Query: 194 SVSWRSADIKYKKNEAFLDIIESINMLMTQKGQ----------ILRSEIIGEVKVKSRLS 243
           +V WR  ++ +  NE +LD++ESI++++  K +          I+   IIG+  VKS L+
Sbjct: 201 AVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLN 260

Query: 244 GMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRL---- 299
           G P +++ I+  G                              +LE +  H+CV+     
Sbjct: 261 GNPIVEMKIDMAGN-----------------------------DLESIFLHECVKSKDVD 291

Query: 300 --SKFETEKIITFIPPDGDFELMNYRLS 325
              +FE  K+I F+PPDG F+L +Y ++
Sbjct: 292 KDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 74/163 (45%), Gaps = 44/163 (26%)

Query: 187 PPEALTNSV-SWRSADIKYKKNEAFLDIIESINMLM------TQKGQILRSEIIGEVKVK 239
           P + + N V  WRS +IK  +NE ++D+ E++ + +      + + ++L   I G V V 
Sbjct: 164 PSKTVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVD 223

Query: 240 SRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDL--KFHQCV 297
           S + G+P L++                                    + +D+  KFH CV
Sbjct: 224 SSIGGVPMLEVSFG-------------------------------GCDFKDIIPKFHDCV 252

Query: 298 RLSKFETE--KIITFIPPDGDFELMNYR--LSTSIKPLIWCDM 336
            +++F T    II FIPPDG F+LM Y   LS+    LI C+ 
Sbjct: 253 EVNEFLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNF 295

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 71/153 (46%), Gaps = 37/153 (24%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKG------------------QILRSEIIGEV 236
           V WRS ++KY  NE ++D+IE I+++  ++                   +++R++IIGE+
Sbjct: 256 VPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGEL 315

Query: 237 KVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQC 296
            V+S LS  P +++ + D+            N        S  D  K  + L    FH C
Sbjct: 316 NVRSYLSDNPMVEVTLVDR------------NYSDQKTGWSENDLFK-QLNLGLPMFHDC 362

Query: 297 VRLSKFETE-----KIITFIPPDGDFELMNYRL 324
           V +  +E       + I FIPPDG F LM Y +
Sbjct: 363 VEID-YEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 135/330 (40%), Gaps = 90/330 (27%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKG----------QILRSEIIGEVKVKSRLSG 244
           V WR+A +KY  NE ++D+ ESI+++  + G          +++   I G+  VK  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 245 MPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFE- 303
            P + L ++  G           N+ G                     FH+CV L   + 
Sbjct: 271 NPTVDLQLDLAG-----------NDLGVPA------------------FHECVELDNHQN 301

Query: 304 -TEKIITFIPPDGDFELMNY------------RLSTSIKPLIWCDMNIQVHSQS-RIEI- 348
            +   + FIPPDG F LM Y            R       L+  D   Q+ +++   EI 
Sbjct: 302 PSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEIT 361

Query: 349 ----HCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKY-----SHGSI--KYVPEKNVII 397
               + R  A I  +    +VQ+     ED++T +FK      +HG      VP +   I
Sbjct: 362 VNISNSREVANI--EDLRIDVQLQSNTDEDSET-DFKIKVLRNTHGRFDNSVVPGQGSWI 418

Query: 398 WKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIK-----FQIPYFTTSGIQVKYLK 452
           +  +  P G          LP +    E    R ++++     + +     SGI+VK + 
Sbjct: 419 FD-KDTPTGT---------LPVLRGCVESTEPRLLRVQRVTASYSLSGQLASGIRVKAIN 468

Query: 453 INEPKLQYKS---YPWVRYITQSGDDYTIR 479
           I +  L  KS   +  V+Y T++G D+ IR
Sbjct: 469 IGQ--LTTKSNRPFKGVKYATKTG-DFEIR 495

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 31/151 (20%)

Query: 193 NSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMP--DLKL 250
           + V WR + I Y  NE F+D+ E IN ++ +KG++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNI-ELEDLKFHQCVRLSKFETEKIIT 309
           G          + D  L++   +      + K N+I +L   KF +            +T
Sbjct: 267 G----------LLDHKLSHLNTTFHRCILEDKANSINDLIAGKFTK------------LT 304

Query: 310 FIPPDGDFELMNYRLSTSIKPLIWCDMNIQV 340
           F+PPDG   L  Y L     PL+  D N+ +
Sbjct: 305 FVPPDGRTRLCQYTL-----PLVKRDSNLGI 330

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/308 (21%), Positives = 121/308 (39%), Gaps = 71/308 (23%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLM--TQK-GQIL--RSEIIGEVKVKSRLSGMPDLK 249
           V WR+A +KY  NE ++D++E+I++++  T+K GQ++  R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 250 LGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIIT 309
           L +N  G    H                         +L     H C +     + + + 
Sbjct: 246 LKLNLHG----H-------------------------DLGVPALHPCCQAQYTGSPENLQ 276

Query: 310 FIPPDGDFELMNYRL---STSIKPLIWCDMNI----------QVHSQSRIEIHCRAKAQI 356
           F+PPDG F LM Y +   +   K  ++ +M +           +  +  I+++      +
Sbjct: 277 FVPPDGKFRLMQYTIDLEALQTKSKLFSNMGLVSLDYFVGLGDLRDEFEIKVNIAGSQHV 336

Query: 357 KKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWK---------IRSFPGGK 407
           K             +  D      + +HG  +   E N+  W          +  F G  
Sbjct: 337 KLIDDLVVTIKFGKLTSDCRIKALRSTHGHFENGFENNIGKWSFDKETPTGTVPVFRGCL 396

Query: 408 EYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYLKI--NEPKLQYKSYPW 465
           E +   Q++  S+     +K   P            SGI+V  + I    PK   K +  
Sbjct: 397 ENATPEQIKTLSLAISYSNKGSLP------------SGIKVGAVDIISGLPK-NTKPFKG 443

Query: 466 VRYITQSG 473
           V+Y+ ++G
Sbjct: 444 VKYVARTG 451

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 37/138 (26%)

Query: 195 VSWRSADI-KYKKNEAFLDIIESINMLMTQKGQILR---SEIIGEVKVKSRLSGMPDLKL 250
           V WR++   K++ NE ++D++E+ ++++ +K   LR    +I G V V+S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLS---KFETEKI 307
            +N  G                           N I +  L  H+CV ++   +F T   
Sbjct: 259 KLNTMG---------------------------NEIGIPSL--HECVEINDDGEF-TPSN 288

Query: 308 ITFIPPDGDFELMNYRLS 325
           ITFIPPDG F L+ Y ++
Sbjct: 289 ITFIPPDGKFRLLEYSIN 306

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 67/153 (43%), Gaps = 57/153 (37%)

Query: 197 WRSADIKYKKNEAFLDIIESINML----------MTQKGQILRSEIIGEVK----VKSRL 242
           WRS ++K+  NE ++D++ES++++          +T+  Q ++  + G +K    V+S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 243 SGMP----DLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVR 298
           +G P     L+L  ND G  S                                 FH+CV 
Sbjct: 263 NGNPLVELQLELSGNDIGHPS---------------------------------FHECVD 289

Query: 299 LSKF------ETEKIITFIPPDGDFELMNYRLS 325
           + ++       +   + FIPPDG F LM+Y ++
Sbjct: 290 IDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (46%), Gaps = 37/137 (27%)

Query: 195 VSWRSADI-KYKKNEAFLDIIESINMLMTQKGQILR---SEIIGEVKVKSRLSGMPDLKL 250
           V WR++   K++ NE ++D++E+ +++   K   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKI--- 307
            +N  G                           N+I +  L  H+CV + K + E +   
Sbjct: 259 KLNTMG---------------------------NDIGVPTL--HECVEI-KDDGEFLPSN 288

Query: 308 ITFIPPDGDFELMNYRL 324
           ITFIPPDG F L+ Y +
Sbjct: 289 ITFIPPDGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 66/142 (46%), Gaps = 36/142 (25%)

Query: 195 VSWRSADI-KYKKNEAFLDIIESINMLMTQKGQILR---SEIIGEVKVKSRLSGMPDLKL 250
           V WR++   K++ NE ++D++E+ +++  +K   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSK-FETEKIIT 309
            +N  G                           N+I +  L  H CV ++    +   IT
Sbjct: 259 KLNTMG---------------------------NDIGIPSL--HDCVEINDGVFSPSNIT 289

Query: 310 FIPPDGDFELMNYR--LSTSIK 329
           FIPPDG F L+ Y   LS+ +K
Sbjct: 290 FIPPDGKFRLLEYSVDLSSQVK 311

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 35/134 (26%)

Query: 195 VSWRSADI-KYKKNEAFLDIIESINMLMTQKGQILR---SEIIGEVKVKSRLSGMPDLKL 250
           V WR++   K++ NE +LD++E+ +++  +K   +R     I G + V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFE--TEKII 308
            +N  G                           N+I +  L  H+CV ++     +   I
Sbjct: 259 KLNTMG---------------------------NDIGIPSL--HECVEINDGGVFSPSNI 289

Query: 309 TFIPPDGDFELMNY 322
           TFIPPDG F L+ Y
Sbjct: 290 TFIPPDGKFRLLEY 303

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 65/142 (45%), Gaps = 8/142 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A       G PLL+R++R+   D  +  +  F +L+++L  E   V      N ++Y++ 
Sbjct: 5   AASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVEG----NHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  +  + L  L   + N L + +E  I D+   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVI 119

Query: 152 YGIPQITETKMLKQYITQKSFK 173
            G  +   +  +  Y+T +S +
Sbjct: 120 MGYKENLSSTQVTTYLTMESHE 141

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 65/140 (46%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV     KG PLL+R++RD   D  +  +  F TL+++  ++   V        ++Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVED----EHVRYVYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N + +N  Q    L   V  + + LK + EE + D+   I    DE + 
Sbjct: 61  PFDDYYIILITN-LHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +K ++  +S
Sbjct: 120 MGYKENLSLTQIKTFLAMES 139

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 66/329 (20%), Positives = 119/329 (36%), Gaps = 88/329 (26%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKG---------------QILRSEIIGEVKVK 239
           V WR   IK  K E ++D+ E + +   +                 +++   I G + V+
Sbjct: 189 VPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVR 248

Query: 240 SRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRL 299
             L+G P + L      +F      D++ N+                 L    FH CV  
Sbjct: 249 CYLNGNPTVSL------MF------DTMGND-----------------LGIPSFHACVEQ 279

Query: 300 S-------------KFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN----IQVH- 341
                          F+ ++++ F+PPDG F L  Y +    +  +   M+    IQV  
Sbjct: 280 EDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYVIDLDGQGGMSRRMDRDGLIQVSF 339

Query: 342 --------SQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVPEK 393
                    +  + +H R    +        V +      D++    + +HG+     E 
Sbjct: 340 EDGLGLNKDEFEVRLHVRESIAVVDPVEDLVVTLQFSNGNDSNVKMLRATHGTFVGQDED 399

Query: 394 NVIIWKIRSFPGGKEYSMSAQMQLPSI-GNIEEHK----AKR----PVQIKFQIPYFTTS 444
               W+  S     E S      LP + G I++ K     KR     V +++  P    S
Sbjct: 400 RQCSWRFDS----DEISAGT---LPVLRGCIDDSKHVQQKKRSCLTSVAVRYGYPGELAS 452

Query: 445 GIQVKYLKIN--EPKLQYKSYPWVRYITQ 471
           G +V  L ++   P+++ K +  VR +T+
Sbjct: 453 GCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 52/152 (34%)

Query: 197 WRSA-DIKYKKNEAFLDIIESINMLMTQK-----------------GQI--LRSEIIGEV 236
           WR+  +I   +NE + D+ E I ++  +K                 G +  +R  I G V
Sbjct: 227 WRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNISGSV 286

Query: 237 KVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQC 296
            ++  L+G P +++ +                             K+  +++    FH C
Sbjct: 287 DMRCFLTGNPLVEIAL-----------------------------KQGGLDIGIPGFHDC 317

Query: 297 V-RLSKFETEKI--ITFIPPDGDFELMNYRLS 325
           V + S  + EKI  ++FIPPDG F LM Y ++
Sbjct: 318 VDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 61/158 (38%), Gaps = 59/158 (37%)

Query: 195 VSWRSADIKYKKNEAFLDIIESI-----NMLMTQKGQ-------------------ILRS 230
           V WR+ +IK  KNE ++D+ E I     N +  +KG+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 231 EIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELED 290
            I G + V+S L+G P +++ +N  G           N+ G                   
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG-----------NDMGTP----------------- 350

Query: 291 LKFHQCVRLS---KFETEKI---ITFIPPDGDFELMNY 322
              H CV L      + +K+   + FIPPDG F L  Y
Sbjct: 351 -SLHPCVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV     +G PLL+R++RD   D     +  F  L++    +   V        ++Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYK 156

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q    L      +  YL + +E  I +N   I    DE + 
Sbjct: 157 PFDDYYIILITNRQS-NIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +  Y++ +S
Sbjct: 216 MGYKENLSISQINTYLSMES 235

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 55/135 (40%), Gaps = 34/135 (25%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLMTQKG----QILRSEIIGEVKVKSRLSGMPDLKL 250
           V WR  ++    NE ++D++E++ + + Q       +    I G++ +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 251 GINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVR-LSKFETEKIIT 309
                          +L++ G +   S                H+C+   S       + 
Sbjct: 255 ---------------NLHSAGHAFKPSA--------------LHRCLDPSSSSFDSSSLR 285

Query: 310 FIPPDGDFELMNYRL 324
           FIPPDG F L+ Y +
Sbjct: 286 FIPPDGKFTLLEYTI 300

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV      G PLL+R++RD   D  +  +  F  L++    E   V        ++Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFV----EEEHVRYIYI 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q    L      + + LK   EE + ++   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +  +++ +S
Sbjct: 120 LGYKESLSLSQINTFLSMES 139

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 59/142 (41%), Gaps = 8/142 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A       G PLL+R++ D   D  +  +  F  L++    E   V        ++YL+ 
Sbjct: 5   AASITTRNGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D YL+ I N  S N  Q  + L      +  YL + +E  I +N   I    DE + 
Sbjct: 61  PFDDYYLIIITNRQS-NIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIV 119

Query: 152 YGIPQITETKMLKQYITQKSFK 173
            G  +      ++ Y+T +S +
Sbjct: 120 MGYKENLTMAQVETYLTMESHE 141

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 61/142 (42%), Gaps = 8/142 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A       G PLL+R++R+   D  +  +  F  L+S +  +   V        ++Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFVED----EHVRYVYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q  + L      + +YL + +E  + DN   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 152 YGIPQITETKMLKQYITQKSFK 173
            G  +      +  Y++ +S +
Sbjct: 120 MGYKENLTAAQVSTYLSMESHE 141

>Kwal_0.348 s0 (164816..165214) [399 bp, 132 aa] {OFF} [contig 88]
           FULL
          Length = 132

 Score = 35.0 bits (79), Expect = 0.11,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 295 QCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEI------ 348
           QC R SK    K++ ++    +F  M YR S++      C  N +V + +RI+I      
Sbjct: 36  QCARKSKATVAKLVNWLIFSTEFTSMRYRKSSN------CKENSKVCNSTRIDIRLLGWS 89

Query: 349 HCRAKAQIKKKSTATNVQIIIPVPE 373
           H    ++  K S    + + IP PE
Sbjct: 90  HRSQSSKFIKMSKMQLMALFIPTPE 114

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV     +G PLL+R++R+   D     +  F  L++    +   V        ++Y++ 
Sbjct: 5   AVSIVTRQGKPLLSRQFREISKDRVTELLSNFQGLVAKSSSQHTFVED----EHVRYVYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q    L      +  YL + +E  I +N   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEVIT 119

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +  Y++ +S
Sbjct: 120 MGYKENLSMTQINTYLSMES 139

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 58/147 (39%), Gaps = 45/147 (30%)

Query: 195 VSWRSADIKYKKNEAFLDIIESINMLM-------TQKG-----QILRSEIIGEVKVKSRL 242
           V WRSA +  ++NE ++D+ ES+ +++       T +G     Q++   I G V  +  L
Sbjct: 206 VPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRCYL 265

Query: 243 SGMPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKF 302
           S  P +++  N+ G                              +L     H CV L   
Sbjct: 266 SRDPIVEVTFNNHGC-----------------------------DLGTPALHDCVELDGV 296

Query: 303 ----ETEKIITFIPPDGDFELMNYRLS 325
                    + FIPPDG F LM Y ++
Sbjct: 297 PEGPADHTTLKFIPPDGKFRLMEYSVT 323

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 26  NKVISIMASAVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLS 82
           NK + ++A+++     +G PLL+R+++D   D  +  +  F  L++++  +   V     
Sbjct: 51  NKTMVVLAASI--TTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFVED--- 105

Query: 83  YNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVII 142
              ++Y++   ++ Y++ I N  S N  +  + L      + +YL + +++ I  N   I
Sbjct: 106 -KHVRYVYRPFDNYYIILITNRQS-NIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEI 163

Query: 143 YELLDETMDYG 153
               DE +  G
Sbjct: 164 LSSFDEIVSMG 174

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 60/140 (42%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV      G PL++R+++D   D  +  +  F  L+++   +   V        ++Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSSRQHTFVEE----EHVRYVYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q    L      + ++LK   E+ I DN   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +  +++ +S
Sbjct: 120 LGCKENLSLSQINTFLSMES 139

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 8/122 (6%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A      +G PLL+R+++D   D  +  +  F  L+S++  +   V        ++Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             ++ Y++ I N  S N  +  A L      + +YL + +++ I  N   I    DE + 
Sbjct: 61  PFDNYYIILITNRQS-NIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 152 YG 153
            G
Sbjct: 120 MG 121

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 8/122 (6%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A      +G PLL+R+++D   D  +  +  F  L+S++  +   V        ++Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             ++ Y++ I N  S N  +  A L      + +YL + +++ I  N   I    DE + 
Sbjct: 61  PFDNYYIILITNRQS-NIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 152 YG 153
            G
Sbjct: 120 MG 121

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 62/142 (43%), Gaps = 8/142 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A       G PLL+R++R+   +  +  +  F  L+S++  +       L    ++Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTF----LEDEHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             ++ Y++ I N  S N  Q  + L      + +YL + +E  I DN   I    DE + 
Sbjct: 61  PFDNYYIILITNRQS-NIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 152 YGIPQITETKMLKQYITQKSFK 173
            G  +      ++ Y+  +S +
Sbjct: 120 MGYKENLSISQVETYLAMESHE 141

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 59/140 (42%), Gaps = 8/140 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           AV      G PLL+R++RD   D     +  F  L+++   +   V        ++Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRDISKDRVTELLSNFQGLVANSSSQHTFVED----EHVRYVYK 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N  Q    L      + + L++ +E  I +N   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 152 YGIPQITETKMLKQYITQKS 171
            G  +      +  +++ +S
Sbjct: 120 MGYKENLSLTQINNFLSMES 139

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 8/142 (5%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A       G PLL+R++R+   D  +  +  F +L++++  +   V        ++Y++ 
Sbjct: 5   AASITTRTGKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFVED----EHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             +D Y++ I N  S N     + L      + +YL + +E  I +N   I    DE + 
Sbjct: 61  PFDDYYIILITNRQS-NIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVV 119

Query: 152 YGIPQITETKMLKQYITQKSFK 173
            G  +      +  Y++ +S +
Sbjct: 120 MGYKENLSITQVNTYLSLESHE 141

>CAGL0J08888g Chr10 complement(877386..878783) [1398 bp, 465 aa]
           {ON} similar to uniprot|P53378 Saccharomyces cerevisiae
           YLR212c TUB4 gamma tubulin
          Length = 465

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 8/59 (13%)

Query: 203 KYKKNEAF---LDIIESINMLMTQKGQILR-----SEIIGEVKVKSRLSGMPDLKLGIN 253
           +YKKN A+   LD+++  N L+TQ+  ++      S +IGEV     L  +P ++  +N
Sbjct: 286 RYKKNTAYDVLLDLLDPFNSLVTQRSDMVTHFNVFSTVIGEVDQNHILRALPKMQQRLN 344

>TPHA0D01640 Chr4 complement(343171..344868) [1698 bp, 565 aa] {ON}
           Anc_2.266 YNL048W
          Length = 565

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 37  YFCDSKGYPLL--ARRYRDDIPISAIEKFPTLLSDL 70
           ++CD+ GYP    A R+  D+PI A   FP + +D+
Sbjct: 222 FWCDTMGYPFGYPAIRFMADMPIIAYTHFPVISTDM 257

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 8/122 (6%)

Query: 35  AVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91
           A      +G PLL+R+++D   D  +  +  F  L++++  +   V        ++Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYR 60

Query: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151
             ++ Y++ I N  S N  +  A L      + +YL +  ++ I  N   I    DE + 
Sbjct: 61  PFDNYYIILITNRQS-NIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVS 119

Query: 152 YG 153
            G
Sbjct: 120 MG 121

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 31/148 (20%), Positives = 68/148 (45%), Gaps = 10/148 (6%)

Query: 29  ISIMASAVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNG 85
           ++++A+++      G PLL+R++ +   D  +  +  F  L++++  +   V        
Sbjct: 1   MAVLAASI--TTRNGKPLLSRQFVEMSKDRVMELLSNFQGLVANISSDHTYVED----EH 54

Query: 86  MQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYEL 145
           ++Y++   +D YL+ + N  S N  Q  + L      +  YL + +E  I +N   I   
Sbjct: 55  VRYVYKPFDDYYLILMTNRQS-NIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSS 113

Query: 146 LDETMDYGIPQITETKMLKQYITQKSFK 173
            DE +  G  +    + +  YI+ +S +
Sbjct: 114 FDEIIVMGHKENLTIQQVNNYISMESHE 141

>Kpol_1052.32 s1052
           complement(96248..98302,98305..98313,98317..98385,
           98389..100428,100796..100804,100847..102301) [5637 bp,
           1878 aa] {ON}
           complement(96248..98302,98305..98313,98317..98385,
           98389..100428,100796..100804,100847..102301) [5637 nt,
           1879 aa]
          Length = 1878

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 258 FSKHMDDDSLN----NEGASVASSTTDKKKNNIELEDLKFHQC-VRLSKFETEKIITFIP 312
           F    +D+ LN      G  +  ST D K+NN  +E  K+H C ++ ++     +I+ + 
Sbjct: 672 FDTSSEDEHLNIFVYLNGFLLGHSTIDLKRNNQIIEYKKYHNCKLKSTERHNNDLISKVE 731

Query: 313 PDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIK--KKSTAT 363
               +    Y +++S+K  +  D  +++H+++  +I     ++++  KKS  T
Sbjct: 732 ISTTYYGAKYNMNSSLKLFLLHDETLEIHNETSYKIWLGILSEVESLKKSELT 784

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/95 (22%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 81  LSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFV 140
           L Y   + ++ ++  +Y +   +S S N       +++ V+ + +Y   V E  I  NF 
Sbjct: 52  LEYQDHKVVYKRYASLYFICGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFT 111

Query: 141 IIYELLDETM--DYGIPQITETKMLKQYITQKSFK 173
             YE+L+E +  D  + + ++  +L+  +T  S +
Sbjct: 112 KAYEILNEVLVCDGSMTETSKQAILRSVMTMDSLE 146

>SAKL0D08074g Chr4 complement(673663..674133) [471 bp, 156 aa] {ON}
           highly similar to uniprot|P35181 Saccharomyces
           cerevisiae YLR170C APS1 Small subunit of the clathrin-
           associated adaptor complex AP-1 which is involved in
           protein sorting at the trans-Golgi network homolog of
           the sigma subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 81  LSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFV 140
           L YN  + ++ ++  +Y V   +    N       +++ V+ +  Y   V E  I  NF 
Sbjct: 52  LEYNDHKVVYKRYASLYFVCGVSPDKDNELLTLEIIHRFVETMDRYFGNVCELDIIFNFN 111

Query: 141 IIYELLDETM--DYGIPQITETKMLKQ 165
             Y +LDE +  D  I + ++ ++LK 
Sbjct: 112 KAYSILDEVLICDGSITETSKKEVLKH 138

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 65/146 (44%), Gaps = 10/146 (6%)

Query: 29  ISIMASAVYFCDSKGYPLLARRYRD---DIPISAIEKFPTLLSDLEEETNLVPPCLSYNG 85
           ++++A+++      G PLL+R++ +   D  +  +  F  L++++  +   V        
Sbjct: 1   MTVLAASI--TTRSGKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EH 54

Query: 86  MQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYEL 145
           ++Y++   +D YL+ + N  S N  Q  + L      +  YL + +E  I +N   I   
Sbjct: 55  VRYVYKPFDDYYLILVTNRQS-NIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSS 113

Query: 146 LDETMDYGIPQITETKMLKQYITQKS 171
            DE +  G  +      +  Y+  +S
Sbjct: 114 FDEIIVMGNKEDLTISQVNTYLAMES 139

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 338 IQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYS--HGSIKYVPEKNV 395
           I  H+Q  +E   +    +  KS AT + + + +PE AD P + ++   G++ +    ++
Sbjct: 129 ITFHTQELLESPLKVGDIVLLKSNATELSMCVALPESADDPRYTFATIKGNLLFSTRSSI 188

Query: 396 IIWKIRSFPGG 406
            +    S P G
Sbjct: 189 NLRIPYSIPNG 199

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,141,828
Number of extensions: 2259007
Number of successful extensions: 7296
Number of sequences better than 10.0: 125
Number of HSP's gapped: 7314
Number of HSP's successfully gapped: 183
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)