Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E018307.194ON31831816060.0
YIL021W (RPB3)7.194ON31832214230.0
Suva_9.1787.194ON31932314180.0
NDAI0G020007.194ON31131914120.0
Smik_9.1697.194ON31832214080.0
Skud_9.1487.194ON31832214060.0
KAFR0A026507.194ON31232113680.0
CAGL0J02420g7.194ON31228313490.0
TDEL0H025307.194ON31131813430.0
KNAG0H027007.194ON32628213180.0
TBLA0J015207.194ON33527413150.0
TPHA0C045107.194ON31026913010.0
ZYRO0D15796g7.194ON30828213010.0
Kpol_1063.117.194ON31628412950.0
SAKL0F07458g7.194ON31531812571e-175
KLTH0E04598g7.194ON32827312401e-172
Kwal_55.203807.194ON32332412321e-171
KLLA0D16170g7.194ON30727312231e-170
ADL120C7.194ON31131812221e-170
Ecym_43827.194ON31131812081e-167
Kpol_1018.1393.428ON3352912472e-23
ZYRO0C12364g3.428ON3352912385e-22
CAGL0B04125g3.428ON3342932298e-21
TPHA0D039203.428ON3352912299e-21
KAFR0A055203.428ON3342972253e-20
Suva_16.4383.428ON3352922236e-20
NDAI0A047703.428ON3352982227e-20
YPR110C (RPC40)3.428ON3352922227e-20
TBLA0F017003.428ON3332922227e-20
Kpol_473.33.428ON3202852219e-20
Smik_16.3533.428ON3352922183e-19
KNAG0A076003.428ON3341972173e-19
ADR031C3.428ON3642952183e-19
TDEL0F031003.428ON3351962174e-19
KLTH0F12056g3.428ON3501822131e-18
Ecym_44503.428ON3342902131e-18
SAKL0F06028g3.428ON3342932112e-18
KLLA0D14861g3.428ON3341952112e-18
NCAS0A115203.428ON3352982103e-18
Kwal_23.39983.428ON3341932103e-18
Skud_16.3973.428ON3352882094e-18
CAGL0C05291g3.154ON584223676.3
KLLA0E22705g1.456ON38965677.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E01830
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   623   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   552   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   550   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   548   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   546   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   546   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   531   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   524   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   521   0.0  
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   512   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   511   0.0  
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   505   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   505   0.0  
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   503   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   488   e-175
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   482   e-172
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   479   e-171
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   475   e-170
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   475   e-170
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   469   e-167
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...   100   2e-23
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    96   5e-22
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    93   8e-21
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    93   9e-21
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    91   3e-20
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    91   6e-20
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    90   7e-20
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    90   7e-20
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    90   7e-20
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    90   9e-20
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    89   3e-19
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    88   3e-19
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    89   3e-19
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    88   4e-19
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    87   1e-18
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    87   1e-18
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    86   2e-18
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    86   2e-18
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    86   3e-18
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    86   3e-18
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    85   4e-18
CAGL0C05291g Chr3 (504216..505970) [1755 bp, 584 aa] {ON} simila...    30   6.3  
KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]...    30   7.0  

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/318 (94%), Positives = 302/318 (94%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGRE                E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREGMMNGGDNDVNMDGGME 300

Query: 301 QNSYANVANPGGAYDNAW 318
           QNSYANVANPGGAYDNAW
Sbjct: 301 QNSYANVANPGGAYDNAW 318

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/322 (81%), Positives = 285/322 (88%), Gaps = 8/322 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N  +                   E
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASN----MLGSNEDVMMTGAE 296

Query: 301 QNSYANVANPG----GAYDNAW 318
           Q+ Y+N +  G    G YDNAW
Sbjct: 297 QDPYSNASQMGNTGSGGYDNAW 318

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/323 (81%), Positives = 285/323 (88%), Gaps = 9/323 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFIL++VDLA+ANS RR+MIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHP+IQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N V+                   E
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASN----MLGTNEDVMMTGAE 296

Query: 301 QNSYANVANPG-----GAYDNAW 318
           Q+ YAN +  G     G YDNAW
Sbjct: 297 QDPYANASQMGNTGSSGGYDNAW 319

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/319 (84%), Positives = 283/319 (88%), Gaps = 9/319 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSN+DLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPIIQD+E NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD  KEWPNSKNCEYEDPPNEGE FDYKAKAETFYMNVETVGSI V
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRG++TLQ+KVASILLALTQMDQEK+ +AT   G  G                  +
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNN--------MMNQDVDMD 292

Query: 301 QNSYANVA-NPGGAYDNAW 318
            ++YAN A N  GAY++AW
Sbjct: 293 GDAYANGANNQPGAYNDAW 311

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/322 (81%), Positives = 284/322 (88%), Gaps = 8/322 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREA+KDNVDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYED PNEG+ FDYKA+A+TFYMNVE+VGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N  S                   E
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSN----ILGTNEDVMMAGAE 296

Query: 301 QNSYANVANPG----GAYDNAW 318
           Q+ Y+N +  G    G YD+AW
Sbjct: 297 QDPYSNASQMGNSGSGGYDSAW 318

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/322 (81%), Positives = 283/322 (87%), Gaps = 8/322 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREA+KD VDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD+ KEWP SKNCEYEDPPNEG+ FDYKA+A+TFYMNVE+VGSIPV
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRG+DTLQKKVASILLALTQMDQ+KVNFA+  N  +                   E
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPN----MLGTNEDVVMTGAE 296

Query: 301 QNSYANVANPG----GAYDNAW 318
           Q+ Y+N +  G      YDNAW
Sbjct: 297 QDPYSNASQMGNTGSSGYDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/321 (81%), Positives = 278/321 (86%), Gaps = 12/321 (3%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDLA+ANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPIIQD+EGNGVLICKLRKGQELK+TCIAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHT+YWYEQD  KEWPNSKNCEYEDPPNE + FDYKAKA+TFYMNVETVGSI V
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVVVRGVDTLQKKVASILLAL QMDQEKVN+A+                         E
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATA---------DMNQGDIAMGGAE 291

Query: 301 QNS-YANV--ANPGGAYDNAW 318
           Q++ Y+N+  +N  G YDNAW
Sbjct: 292 QDAFYSNMPNSNANGIYDNAW 312

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  524 bits (1349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/283 (87%), Positives = 265/283 (93%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREAT+DNVDFILSNVDLALANS RRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EF+AHRLGLIPLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL+I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKL+HTDYWYE+D  KEWP SKNCEYEDPPN+ E FDYKAKA+TFYMNVE VGSI V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGRE 283
           DQVV+RG+DTLQKKVASI+LAL QMDQEKVNFAT     +G E
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIE 283

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/318 (79%), Positives = 273/318 (85%), Gaps = 7/318 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS VDLA+ANS RR+M+AEIPTLAIDSV+IETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQEL + C+AKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD +KEWP SKN EYEDPPN+ + FDYKAKA TFYMNVETVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVV+RG+DTLQKKVASILLAL QMDQE+VNF T  N  + ++                +
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQD----AGNVDVAMDGVQD 296

Query: 301 QNSYANVANPGGAYDNAW 318
           QN Y   +N GGAYD AW
Sbjct: 297 QNPY---SNGGGAYDEAW 311

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  512 bits (1318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/282 (85%), Positives = 262/282 (92%), Gaps = 1/282 (0%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           M+E GPQVKIREA +DNVDFILSNV+LA+ANS RRVM+AEIPTLAIDSVQ+ETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS+DIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+E NGVLICKLRKGQELK+TCIAKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHT YWYE DA +EWPNS+NCEYEDPP EGE FDYK+KAETFYMNVET+GSI V
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFAT-NPNGVSG 281
           DQVVVRG+DTLQKKVASILL+LTQM+QEK NFA  N  G+ G
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEG 282

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/274 (86%), Positives = 255/274 (93%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQ+KIREATKDNVDFILSN+D+ALANS RRVMIAEIPTLAIDSV++E NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPIIQD+EGNGVLICKLRKGQELK+TC+AKKGIAKEHAKWG  AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYE D  KEWP+SKNC+YEDPP EGELFDYKAKA TFYMNVE VGSI  
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFAT 274
           DQV++RG+DTLQKK A ILLAL+QM+QEKVNF T
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGT 274

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 235/269 (87%), Positives = 256/269 (95%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MS+ GPQVKIREATKDNVDFI+SNVDLA+AN+FRRVMIAEIPTLAIDSV++ +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DIEQLEYSRDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDLVI
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+LLGRNIGHPIIQD+EGNGVLICKLRKGQELK TCIAKKGIAKEHAKWGPAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHT+YWYEQDA KEWP SKNCEYEDPPNEG  FDYKAKA+TFYMNVET+G++  
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEK 269
           DQV+VRG+D LQKKVASILLAL ++DQ+K
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDK 269

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/282 (84%), Positives = 261/282 (92%), Gaps = 1/282 (0%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREAT++NVDFILS+V+LA+ANS RRVMIAEIPTLAIDSV++ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRN+GHPIIQD+EGNGVLICKLRKGQEL + C+AKKGIAKEHAKWGP+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHT+YW+EQD  KEWP SKN EYEDPPNEGE FDY+A A TFYMNVE+VGS+  
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATN-PNGVSG 281
           DQVV+RG+DTLQKKVASILLALTQMDQ+KVNFA+  P G  G
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVG 282

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/284 (84%), Positives = 260/284 (91%), Gaps = 1/284 (0%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILS+VD+ALANS RRVMIAEIPTLAIDSV++ TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGL+PLQS DIEQLEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+TCIAKKGI+KEHAKWGPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTD+W+EQD  KEWP SKNCEYEDPP+EGE+FDYKA+A+ F    ETVG+I  
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPN-GVSGRE 283
           DQVV+RG+DTLQKKVASILLALTQMDQ+KV +A N N G  G E
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGME 284

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  488 bits (1257), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/318 (73%), Positives = 259/318 (81%), Gaps = 3/318 (0%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           M+E GPQVKIREATKD+VDFILSNVD+ALANSFRRVMIAEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD+EGNGVLICKLRKGQELK+ CIAKKGI+KEHAKW PA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQD   EWP SKNCEYEDPPNE ++FDY AK  TFYM+VETVGS+  
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVV+RG+ TLQ KVA IL +L +MDQE+VNF     G +                    
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFG-GAGGNADNVDVAMDGENEMSDPYTSN 299

Query: 301 QNSYANVANPGGAYDNAW 318
           Q+ Y     P   +D+AW
Sbjct: 300 QDQYN--GGPSAGFDDAW 315

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 224/273 (82%), Positives = 246/273 (90%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           M+E GPQVKIREATKDNVDFILSNVD+ +ANS RRVMIAEIPTLAIDSV++ETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI  L Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNL+GRNIGHPIIQD++GNGVLICKLRKGQELK+ C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYW+E DA  EWP SKNCEYEDPPNE E FDY AK  TFYMNVETVGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFA 273
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVNF 
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG 273

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  479 bits (1232), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/324 (70%), Positives = 259/324 (79%), Gaps = 7/324 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           M+E GPQVKIREATKDNVDFILSNVD+A+ANS RRVMIAEIPT+AIDSV++ETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI  L Y RDC+CED+CD+CSVVLTLQA GESESTTNVYAKDLVI
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VSNLLGRNIGHPIIQD++ NGVLICKLRKGQELK+ C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYW+E DA  EWP SKNCEYEDPPNE + FDY+AK  TFYMNVE+VGS+ V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNF------ATNPNGVSGREXXXXXXXXXXX 294
           DQVV+RG+ TLQ KVA IL +L +MDQ+KVNF      A    G    E           
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLAEQDGGAMAAEPESGFGYGNGG 300

Query: 295 XXXXXEQNSYANVANPGGAYDNAW 318
                    + N + P   +D+AW
Sbjct: 301 AGGGPGAGDFHN-SGPSSGFDDAW 323

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  475 bits (1223), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 224/273 (82%), Positives = 244/273 (89%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDLALANS RRVMI+EIPTLAIDSV+IETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFIAHRLGLIPLQS DI+Q+ Y RDC+CEDHCD+CSV L L A GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
            S+L GRNIGHPIIQDRE NGVLICKLRKGQE+++ CIAKKGI+KEHAKW P+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYWYEQDA  EWP SKNCE+EDPPNE E FDY+AK  TFY+NVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFA 273
           +QVVVRG+ TLQ KVA IL +L +MDQEKVNFA
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFA 273

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/318 (71%), Positives = 257/318 (80%), Gaps = 7/318 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDL+LANS RR+MIAEIPTLAIDSV+IE+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQD+E NGVLICKLRKGQEL++ C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKL+HTDYW+EQD   EWP+SKNCE+EDPPNE + FDY AK  TFYMNVE+VGSIP 
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV F       +  E                 
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNEYN 300

Query: 301 QNSYANVANPGGAYDNAW 318
            N++A       AYD+AW
Sbjct: 301 DNAHA-------AYDDAW 311

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  469 bits (1208), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/318 (71%), Positives = 259/318 (81%), Gaps = 7/318 (2%)

Query: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDL+LANS RR+MIAEIPTLAIDSV+IETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120
           EFI+HRLGLIPLQS DI+QL Y RDC+CEDHCD+CSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
           VS+L G+NIGHPIIQD+E NG+L+CKLRKGQEL++ C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240
           DPWNKLKHTDYW+EQDAT EWP+SKNCE+EDP N+ ++FDY AK   FY+NVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREXXXXXXXXXXXXXXXXE 300
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV F     G    E                +
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAF-----GGPTSENAPMEVDHDPYSGTNGQ 295

Query: 301 QNSYANVANPGGAYDNAW 318
            N Y +  N   AYD+AW
Sbjct: 296 YNEYND--NTNTAYDDAW 311

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 99.8 bits (247), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 138/291 (47%), Gaps = 51/291 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           ++ I        +F L N+D ++AN+FRR+MI+E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+ +D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLVIVSNLLGRNI----GHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
           +NVYA+DL       G+ +     +P++       +L+CKLR GQE+ +      GI  +
Sbjct: 160 SNVYARDLKFEPQ--GKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL----------KHTDYW-------------YEQDATKEWPN 203
           HAK+ P A   +   P   +          K   Y+             Y +DA K+  +
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
            +   +  P  EG++   + +   F +NVE+ G++  +++  + V  L+ K
Sbjct: 276 RE--VFRHPEFEGKVKLGRVRNH-FIVNVESTGAMTPEEIFFKSVRILRNK 323

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 96.3 bits (238), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 136/291 (46%), Gaps = 52/291 (17%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I   T+   +F L +VD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++V+TL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEH 167
           ++YA+DL       G  +      P+I       +L+ KLR GQE+ +      G+  +H
Sbjct: 161 HIYARDLKFEPQ--GSQVETFAKCPVIP--TDPDILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDATKEWPN 203
           AK+ P A   +   P   ++                         TD  Y QDA K+  +
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
            +   +E+  N+ +L   +   + F  NVE+ G++  +++  + V  L+ K
Sbjct: 277 REVLRHEEFSNKVKLGRVR---DHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 92.8 bits (229), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 137/293 (46%), Gaps = 57/293 (19%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           QV   E  + N D I   +D +LAN+FRR+MIAE+P +A + V I+ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEY--SRDCFCEDHCDKCSVVLTLQAFGESE--------------ST 110
           +GL+PL+ +D E+LE   + D    +  DK ++V+TL                     + 
Sbjct: 101 IGLVPLK-VDPEKLERLDTSDPDNLEFHDKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLVI--VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHA 168
            +VYA+DL     S+ +      P++       +L+ KLR GQE+ ++     G  K+HA
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPC--DPDILLAKLRPGQEISLSTHCILGEGKDHA 217

Query: 169 KWGPAAAIEFEYDPWNK-----------------------LKHTDYWYEQDATKEWPNSK 205
           K+ P A   +   P  +                       +      Y  D  K+  + +
Sbjct: 218 KFSPVATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSRE 277

Query: 206 NCEYEDPPNEGELFDYKAK----AETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
              +E+       F+ K K     + F  NVE+ G++  + +V++ +D L+KK
Sbjct: 278 VLRHEE-------FEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 92.8 bits (229), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 138/291 (47%), Gaps = 53/291 (18%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           + I   T+   +F L ++D ++AN+FRR+MIAE+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  IHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEY--SRDCFCEDHCDKCSVVLTLQAF------GESEST--------T 111
           GLIPL+ +D ++L +  S     E   D+ ++V+TL A          ++T         
Sbjct: 102 GLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVLYRNA 160

Query: 112 NVYAKDLVI-----VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
           +VYA+DL        + L        I  D     +LI KLR GQE+ +      GI  +
Sbjct: 161 HVYARDLKFEPQGKQAELFADQPVEAIDPD-----ILIAKLRPGQEISLRAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDATKEWPN 203
           HAK+ P A   +   P               + K        +   D  + +DA K+  +
Sbjct: 216 HAKFSPVATASYRLLPHINITSPISGESAKRFQKCFPSGVIGINDKDEAFVKDARKDTVS 275

Query: 204 SKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
            +   +E+  N+ +L   +   + F  NVE+ G++  +++  + V  L+ K
Sbjct: 276 REVLRHEEFQNKVKLGRVR---DHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 133/297 (44%), Gaps = 65/297 (21%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           VKI    +   +F L ++D ++AN+FRR+MI+E+P +A++ V    NT+V+ DE +AHR+
Sbjct: 42  VKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      +D    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNILYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGHPIIQDREGNGVLIC-------KLRKGQELKITCIAKKGIA 164
           NVYA DL       G+      ++    N V+ C       KLR GQE+ +      GI 
Sbjct: 161 NVYASDLKFEPQ--GKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHCILGIG 213

Query: 165 KEHAKWGPAAAIEFEYDP---------------WNK--------LKHTDYWYEQDATKEW 201
            +HAK+ P A   +   P               + K        +K     Y QD+ K+ 
Sbjct: 214 SDHAKFSPVATASYRLLPHIEITEPITGESAKRFQKCFPAGVIGIKENGDAYVQDSRKDT 273

Query: 202 PNSKNCEYEDPPNEGELFDYKAK----AETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
            + +   +E+       F+ K K     + F  NVE+ G++  +++  + V  L+ K
Sbjct: 274 VSREVYRHEE-------FNGKVKLGRIRDHFVFNVESTGAMTPEEIFFKSVRILKNK 323

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 90.5 bits (223), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 135/292 (46%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           +V I      + +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF------GESEST-------- 110
           +GL+PL+ +D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLVIVSNLLGRN----IGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ +      G+  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFANCPVLP--ADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDATKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +DA K+  
Sbjct: 216 HAKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           + +   YE+  ++ +L   +     F  NVE+ G++  +++  + V  L+ K
Sbjct: 276 SREVLRYEEFTDKVKLGRVR---NHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 141/298 (47%), Gaps = 62/298 (20%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I   ++   +F L N+D ++AN+FRR+MI+E+P++A + V   TNT+V+ DE +AHR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTL-----QAFGESESTTN-------- 112
           G+IPL+ +D + L +      E+    D  +VV++L     +     +  T+        
Sbjct: 102 GMIPLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 113 -VYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQE--LKITCIAKKGIAK 165
            VYAKDL       G+ +      P++       +L+ KLR  QE  L++ CI   G+  
Sbjct: 161 SVYAKDLKFEPQ--GKQVETFAKCPVVP--SDPDILLAKLRPDQEISLRVHCIL--GVGG 214

Query: 166 EHAKWGPAAAIEFEYDPW-NKLK-----------------------HTDYWYEQDATKEW 201
           +HAK+ P +   +   P  N LK                        T   Y +DA K+ 
Sbjct: 215 DHAKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDT 274

Query: 202 PNS---KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKKVA 256
            +    ++ E+ D    G + D+      F  NVE+ G++  +++  + V  L+ K +
Sbjct: 275 VSREVLRHEEFNDKVKLGRIRDH------FIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 134/292 (45%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
            +VYA+DL       GR        P++       +L+ KLR GQE+ +      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GRQSTTFADCPVVP--ADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDATKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +DA K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           + +   YE+  ++ +L   +     F  NVE+ G++  +++  + V  L+ K
Sbjct: 276 SREVLRYEEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 90.1 bits (222), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 134/292 (45%), Gaps = 56/292 (19%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           +KI    + +  F L N+D ++AN+FRR+M+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEH 167
           +VYA+DL       G+ +      P++       +L+ KLR GQE+ +      GI  +H
Sbjct: 161 HVYARDLKFEPQ--GKQVETFANCPVVP--TDPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNKL------KHTDYW----------------YEQDATKEWPNS- 204
           AK+ P A   +   P   +      K  + +                Y +DA  +  +  
Sbjct: 217 AKFSPVATASYRLLPHINITEPIRGKDAEKFQKCFTPGVIGIKDGEAYVKDARMDTVSRE 276

Query: 205 --KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
             ++ E+ D    G + D+      F  NVE+ G++P +++  + V  L+ K
Sbjct: 277 VFRHQEFADKVKLGRVRDH------FVFNVESTGAMPPEEIFFKSVRILKNK 322

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 89.7 bits (221), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 132/285 (46%), Gaps = 61/285 (21%)

Query: 17  NVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRLGLIPLQSLD 76
           N+D I  NVD ++AN+ RR+MI+E+P++A + + I  NT+V+ DE IA R+GLIPL+ +D
Sbjct: 39  NLDLI--NVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVIAQRIGLIPLK-VD 95

Query: 77  IEQLEYSRDCFCEDH--CDKCSVVLTLQA-----FGESESTTN---------VYAKDLVI 120
            ++L +  +   ED    D+ ++VL+L           +  T+         +YA+DL  
Sbjct: 96  PDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSILYHNAHIYARDLKF 155

Query: 121 VSNLLGRN----IGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAI 176
                G+        P++       +LI KLR GQE+ +      GI  +HAK+ P    
Sbjct: 156 EPQ--GKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILGIGADHAKFSPVCTA 211

Query: 177 EFEYDP----WNKLK-------------------HTDYWYEQDATKEWPNSKNCEYEDPP 213
            +   P      K+K                     D  Y +DA K+    +   +E+  
Sbjct: 212 SYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKDTMTREVLRHEE-- 269

Query: 214 NEGELFDYKAKAET----FYMNVETVGSIPVDQVVVRGVDTLQKK 254
                F  K K +     F  N+ETVG++  +++ ++ V  L+ K
Sbjct: 270 -----FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 134/292 (45%), Gaps = 52/292 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           +V I        +F L N+D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRN----IGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
            +VYA+DL       G+        P++       +L+ KLR GQE+ +      GI  +
Sbjct: 160 AHVYARDLKFEPQ--GKQSTTFADFPVVP--ADPDILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWGPAAAIEFEYDPWNKL------------------------KHTDYWYEQDATKEWP 202
           HAK+ P +   +   P   +                        + +D  Y +DA K+  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 203 NSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           + +   Y++  ++ +L   +     F  NVE+ G++  +++  + V  L+ K
Sbjct: 276 SREVLRYDEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 103/197 (52%), Gaps = 29/197 (14%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           +KI   ++   +F L ++D ++AN+FRR+MI+E+P++A + V +  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           G+IPL+ +D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQE--LKITCIAKKGIAK 165
           +VYA+DL       G+ +      P++       +L+ KLR  QE  L++ CI   GI  
Sbjct: 161 SVYARDLRFEPQ--GKQLETFADCPVVP--SDPDILLAKLRPNQEISLRVHCIL--GIGS 214

Query: 166 EHAKWGPAAAIEFEYDP 182
           +HAK+ P A   +   P
Sbjct: 215 DHAKFSPVATASYRLLP 231

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 134/295 (45%), Gaps = 61/295 (20%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I+   +   +F L  VD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQA--------------FGESESTT 111
           GL+PL+ +D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQE--LKITCIAKKGIAK 165
           ++YA+DL       G+ +      P++       +L+ KLR GQE  L++ CI   GI  
Sbjct: 191 HIYARDLKFEPQ--GKQLETFAKCPVVP--ADPDILLAKLRPGQEISLRVHCIL--GIGS 244

Query: 166 EHAKWGPAAAIEFEYDPW-----------------------NKLKHTDYWYEQDATKEWP 202
           +HAK+ P A   +   P+                         +      + QDA K+  
Sbjct: 245 DHAKFSPVATASYRLMPYINIVEPITGPDAEKFVKCFPPGVAAINEKGEAFVQDARKDTV 304

Query: 203 NS---KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           +    ++ E E     G + D+      F  NVE+ G++  +++  + V  L+ K
Sbjct: 305 SREVLRHPELEQKVKLGRVRDH------FIFNVESAGAMTPEEIFFKSVRILKNK 353

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 88.2 bits (217), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 98/196 (50%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I   T+   +F L ++D ++AN+FRR+MI+E+P+LA + V    NT+V+ DE +AHR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLVI-----VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKE 166
           +VYA DL        + L  +    P   D     +L+ KLR GQE+ +      G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWGPAAAIEFEYDP 182
           HAK+ P A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 91/182 (50%), Gaps = 21/182 (11%)

Query: 19  DFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRLGLIPLQSLDIE 78
           +F L NVD ++AN+FRR+MIAE+P++A + V    NT+V+ DE +AHR+GL PL+ +D +
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLK-VDPD 127

Query: 79  QLEYSRDCF--CEDHCDKCSVVLTLQAFGESE--------------STTNVYAKDLVIVS 122
            L +        E   D+ ++VLTL                        ++YA+DL    
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 123 NLLGRNI--GHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180
               R     +P++       +L+ KLR GQE+ +      GI  +HAK+ P +   +  
Sbjct: 188 QGKQRETFAKNPVVP--ADPDILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTASYRL 245

Query: 181 DP 182
            P
Sbjct: 246 MP 247

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 134/290 (46%), Gaps = 51/290 (17%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I        +F L ++D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQAF--------------GESESTT 111
           GL+PL+ +D + L +        E   D+ +VV++L                  E  +  
Sbjct: 102 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLVI--VSNLLGRNIGHPIIQDREGNGVLICKLRKGQE--LKITCIAKKGIAKEH 167
           ++Y++DL        L     HP++       +L+ KLR GQE  L++ CI   G+  +H
Sbjct: 161 HIYSRDLKFEPQGKQLDSFAKHPVLP--TDPDILLAKLRPGQEISLRVHCIL--GVGGDH 216

Query: 168 AKWGPAAAIEFEYDPWNKLKHT-----------------------DYWYEQDATKEWPNS 204
           AK+ P     +   P   +  T                          Y +DA K+  + 
Sbjct: 217 AKFSPVCTASYRLMPHIDILETIQGEDATKFVKCFPPGVAAIDEKGEAYIKDARKDTVSR 276

Query: 205 KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           +   +  P  EG++   + K + F  NVE+ G++  +++  + V  L+ K
Sbjct: 277 EVLRH--PEFEGKVKLGRVK-DHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 131/293 (44%), Gaps = 57/293 (19%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           VKI    +   +F L ++D ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAFGESE--------------STT 111
           GL+PL+ +D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLVIVSNLLGRNI----GHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEH 167
           N+YA+ L       G+ +      P++       +L+ KLR GQE+ +      GI  +H
Sbjct: 161 NIYARHLKFEPQ--GKQLETFAKSPVVP--ADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPAAAIEFEYDPWNK-----------------------LKHTDYWYEQDATKEWPNS 204
           AK+ P     +   P                          +      Y +DA K+  + 
Sbjct: 217 AKFSPVCTASYRLMPQINITEPITGESAKNLVRCFPPGVIGINEQGEAYVEDARKDTVSR 276

Query: 205 ---KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
              ++ E+E     G + D+      F  NVE+ G++  +++  + V  L+ K
Sbjct: 277 EVLRHEEFEGKVKLGRVRDH------FVFNVESAGAMTPEEIFFKSVRILKNK 323

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I    +  V+F L +VD ++AN+FRR+MI+E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQ--------AFGESES------TT 111
           GL+PL+ +D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLVIVSNLLGRNIGH----PIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEH 167
           ++YA+DL       G+ +      P++       +L+ KLR GQE+ +      GI  +H
Sbjct: 161 HIYARDLKFEPQ--GKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWGPAAAIEFEYDP 182
           AK+ P +   +   P
Sbjct: 217 AKFSPVSTASYRLLP 231

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 136/298 (45%), Gaps = 64/298 (21%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           +V+I    +   +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFC--EDHCDKCSVVLTLQAF------GESEST-------- 110
           +GLIPL+ +D + L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLVIVSNLLGRNI----GHPII---QDREGNGVLICKLRKGQELKITCIAKKGI 163
           ++VYA DL       G+ I    G P++   QD     +L+ KLR GQE+ +      G 
Sbjct: 160 SSVYASDLKFEPQ--GKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 AKEHAKWGPAAAIEFEYDPWNKLKH------------------------TDYWYEQDATK 199
             +HAK+ P +   +   P   +                          +   + +DA K
Sbjct: 213 GGDHAKFSPVSTASYRLLPHINITKPIKGELAEKFQKCFLPGVIGIDNASGEAFVKDARK 272

Query: 200 EWPNS---KNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           +  +    ++ E+ D    G + D+      F  NVE+ G++  +++  + V  L+ K
Sbjct: 273 DTVSREVLRHEEFNDKVKLGRIRDH------FIFNVESTGAMTPEEIFFKSVRILKNK 324

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 94/193 (48%), Gaps = 21/193 (10%)

Query: 8   VKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHRL 67
           V+I    +   +F L NVD ++AN+FRR+MI+E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSLDIEQLEYSRDCF--CEDHCDKCSVVLTLQAFGESE--------------STT 111
           GL PL+ +D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLVI--VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAK 169
           ++YA+DL        L     +P++       VL+ KLR GQE+ +      GI  +HAK
Sbjct: 161 HIYARDLKFEPQGKQLETFAKNPVVP--ADPDVLLAKLRPGQEISLRAHCILGIGSDHAK 218

Query: 170 WGPAAAIEFEYDP 182
           + P     +   P
Sbjct: 219 FSPVCTASYRLMP 231

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 85.1 bits (209), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 129/288 (44%), Gaps = 44/288 (15%)

Query: 7   QVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLADEFIAHR 66
           +V I    +   +F L N+D ++AN+FRR+MI+E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSLDIEQLEYSRDCFCEDH--CDKCSVVLTLQAF--------------GESEST 110
           +GL+PL+ +D + L +      +D    D+ ++VL+L                  E  + 
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLVIVSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKW 170
            +VYA+DL                       +L+ KLR GQE+ +      GI  +HAK+
Sbjct: 160 AHVYARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPAAAIEFEYDPW-NKLKH-----------------------TDYWYEQDATKEWPNSKN 206
            P +   +   P  N L+                        +   Y +DA K+  + + 
Sbjct: 220 SPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSREV 279

Query: 207 CEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
             YE+  ++ +L   +     F  NVE+ G++  +++  + V  L+ K
Sbjct: 280 LRYEEFADKVKLGRVR---NHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>CAGL0C05291g Chr3 (504216..505970) [1755 bp, 584 aa] {ON} similar
           to uniprot|Q12362 Saccharomyces cerevisiae YOL066c RIB2
           DRAP deaminase or uniprot|Q12069 Saccharomyces
           cerevisiae YDL036c
          Length = 584

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 81/223 (36%), Gaps = 50/223 (22%)

Query: 36  VMIAEIPTLAIDSVQIETNTTVLADEFIAHRLGLIPLQSLDIEQLEYSRD------CFCE 89
           + +A+ P  A D +  +  T  +  E+IA  +G  P   + +E+   S D        C+
Sbjct: 220 MFLAKTPEGA-DQMADQMKTREVTKEYIARVVGEFPTGEITVEKPLKSYDPKVSLNIICD 278

Query: 90  D--HCDKCSVVLTLQAFGESESTTNVYAKDLVIVSNLLGRNI---GHPIIQDREGNGVLI 144
           D    D        Q       T+ V  K L   ++ +  ++   GHPI  D        
Sbjct: 279 DTNEDDAKPAKTVFQRISFDGQTSIVKCKPLTGRTHQIRVHLQFLGHPIAND-------- 330

Query: 145 CKLRKGQELKITCIAKKGIAKEHAKWGP------AAAIEFEYDPWNKLKHTDYWYEQDAT 198
                             I      WGP         I  + D + K K  + WY  DA 
Sbjct: 331 -----------------PIYSNTEVWGPNFDSKKYEEIVLKLDAFGKTKCAESWYHPDAQ 373

Query: 199 KEWPNSKNCE------YEDP-PNEGELFDYKAKAETFYMNVET 234
            E  +S  CE      Y DP PN+ +L+ +  K E+  ++ +T
Sbjct: 374 GEVMSSYRCEVCDIPLYTDPGPNDLDLWLHAYKYESTEIDPDT 416

>KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 389

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 195 QDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPVDQVVVRGVDTLQKK 254
           +D  K +    NC Y     E  L DYK  A+T          +P D+ V + +D  +KK
Sbjct: 323 KDKAKAYLRRGNCLYALNRFEAALTDYKNSAKT----------VPEDKNVEQKIDITEKK 372

Query: 255 VASIL 259
           +AS L
Sbjct: 373 IASDL 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,780,819
Number of extensions: 1303475
Number of successful extensions: 2913
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2960
Number of HSP's successfully gapped: 50
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)