Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E009503.485ON1052105251990.0
NDAI0G009903.485ON1054103435410.0
Suva_7.4133.485ON1037101733940.0
Skud_7.4363.485ON1036101733610.0
YGR125W3.485ON1036101533580.0
Smik_6.2213.485ON1036101533490.0
CAGL0I10626g3.485ON1070103332130.0
KAFR0C019103.485ON1020102231950.0
KNAG0B008603.485ON1088105131320.0
TDEL0D055303.485ON1031102831190.0
ZYRO0C07986g3.485ON1024101730940.0
Kpol_480.183.485ON1057100829500.0
SAKL0F02926g3.485ON1050105928890.0
TBLA0C044403.485ON1150104028720.0
TPHA0D042103.485ON104997328680.0
Kwal_55.212013.485ON1011104127660.0
KLTH0F14674g3.485ON1010104127430.0
KLLA0E04731g3.485ON1060107226200.0
AFR304W3.485ON1015102724040.0
TDEL0C012808.99ON7272891398e-08
Skud_16.2868.99ON7452871353e-07
KNAG0D023908.99ON7165731318e-07
SAKL0B03124g8.99ON7445741263e-06
Ecym_7084na 1ON6892041246e-06
NCAS0B048008.99ON7242871237e-06
AGR213Cna 1ON6892931229e-06
KLLA0E14059g8.99ON7062961229e-06
ZYRO0F04796g8.99ON7351271221e-05
Smik_16.2418.99ON7442851202e-05
Suva_16.3228.99ON7422861192e-05
YPR003C8.99ON7542871122e-04
Kpol_467.118.99ON7442841122e-04
Kwal_27.110398.99ON7263021112e-04
SAKL0H08800gna 1ON6202751093e-04
TBLA0C052708.99ON776841093e-04
NDAI0B022108.99ON7062921020.002
KLTH0G16764g8.99ON7101241010.003
CAGL0L09207g8.99ON7251321000.004
TPHA0H007208.99ON787127980.007
TDEL0B046508.146ON38096743.8
Kwal_55.218315.687ON22695733.9
Skud_7.918.141ON89781727.5
SAKL0H14102g8.379ON43877718.8
TBLA0A104305.272ON851167729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00950
         (1052 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  2007   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1368   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1311   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1299   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1298   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1294   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1242   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1235   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1211   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1206   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1196   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1140   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1117   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1110   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1109   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1070   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1061   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...  1013   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   930   0.0  
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    58   8e-08
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    57   3e-07
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    55   8e-07
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    53   3e-06
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    52   6e-06
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    52   7e-06
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    52   9e-06
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    52   9e-06
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    52   1e-05
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    51   2e-05
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    50   2e-05
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    48   2e-04
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    48   2e-04
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    47   2e-04
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    47   3e-04
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    47   3e-04
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    44   0.002
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    44   0.003
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    43   0.004
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    42   0.007
TDEL0B04650 Chr2 complement(827216..828358) [1143 bp, 380 aa] {O...    33   3.8  
Kwal_55.21831 s55 (996564..997244) [681 bp, 226 aa] {ON} YOR078W...    33   3.9  
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    32   7.5  
SAKL0H14102g Chr8 complement(1208344..1209660) [1317 bp, 438 aa]...    32   8.8  
TBLA0A10430 Chr1 (2564651..2567206) [2556 bp, 851 aa] {ON} Anc_5...    32   9.0  

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 2007 bits (5199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1010/1052 (96%), Positives = 1010/1052 (96%)

Query: 1    MSHRNSIDFKKKNKXXXXXXXXXXXXXXXXEEEPRDDYFDDENVNNNNYMGRSYVSGFLS 60
            MSHRNSIDFKKKNK                EEEPRDDYFDDENVNNNNYMGRSYVSGFLS
Sbjct: 1    MSHRNSIDFKKKNKQQSISGSISVSLGLQQEEEPRDDYFDDENVNNNNYMGRSYVSGFLS 60

Query: 61   VSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDY 120
            VSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDY
Sbjct: 61   VSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTRIKDY 120

Query: 121  ITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNI 180
            ITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNI
Sbjct: 121  ITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNI 180

Query: 181  NPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLL 240
            NPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLL
Sbjct: 181  NPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLL 240

Query: 241  LNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIE 300
            LNILDALSYGMIIFPITEPIFSHLGPTGLSMF             GWSSFPSGIGSEMIE
Sbjct: 241  LNILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIE 300

Query: 301  VTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRH 360
            VTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRH
Sbjct: 301  VTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRH 360

Query: 361  ILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXX 420
            ILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKW             
Sbjct: 361  ILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVT 420

Query: 421  QRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFD 480
            QRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFD
Sbjct: 421  QRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFD 480

Query: 481  FKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISG 540
            FKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISG
Sbjct: 481  FKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISG 540

Query: 541  AVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFL 600
            AVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFL
Sbjct: 541  AVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFL 600

Query: 601  LGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQ 660
            LGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQ
Sbjct: 601  LGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQ 660

Query: 661  TINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEIC 720
            TINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEIC
Sbjct: 661  TINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEIC 720

Query: 721  HKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKA 780
            HKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKA
Sbjct: 721  HKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKA 780

Query: 781  FDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQ 840
            FDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQ
Sbjct: 781  FDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQ 840

Query: 841  FTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLP 900
            FTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLP
Sbjct: 841  FTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLP 900

Query: 901  LLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGI 960
            LLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGI
Sbjct: 901  LLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGI 960

Query: 961  LKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRA 1020
            LKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRA
Sbjct: 961  LKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRA 1020

Query: 1021 ENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            ENAELFTELTLLIMAVKDNRFKELLGYTLVSA
Sbjct: 1021 ENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1034 (68%), Positives = 823/1034 (79%), Gaps = 50/1034 (4%)

Query: 45   NNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAI 104
            + +NY+GRSYVSGFLS SPA+  +   +  +LP+A     +  N+ IHAS+ LH+QTAAI
Sbjct: 45   DTSNYLGRSYVSGFLSASPAI--NHDNNNNTLPIA----NQHLNKSIHASQNLHRQTAAI 98

Query: 105  SEDFEDD---EDDTRIKDYITLFQGEDNG--------LMADKNDSLDQRLGLGQDEEAEE 153
            SEDF +D   EDD  +K+YI+  + +  G           D  D +D  L     EEAE 
Sbjct: 99   SEDFNNDPTFEDDINMKEYISNLEDDATGNNGKRYTAYYIDNEDRIDNIL----TEEAE- 153

Query: 154  DFIEPVAEAADVDESSRLLISPLSSNINPNIDDLLPTVTGED--------VSSYQSIYRT 205
                PV +    DE+SRLL+SP+ S+     ++LLP+++ ++         S+YQSI   
Sbjct: 154  ----PVTDFYPQDENSRLLLSPIPSDSLLAGENLLPSISEQEQETAQRRRTSAYQSIRHR 209

Query: 206  ATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLG 265
             + S   +S   W+     P + I YLPA++LGLLL ILDALSYGMIIFPITEPIFSHLG
Sbjct: 210  NSESTEYSSIPTWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLG 269

Query: 266  PTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLP-GRDDEII 324
            PTG+SMF             GWSSFP GIGSEMIEVTPFFHTMA AIK+ LP G +D+II
Sbjct: 270  PTGISMFYISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSNDDII 329

Query: 325  TTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRV 384
            TTT+FCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFL++TGIEV+TRV
Sbjct: 330  TTTLFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRV 389

Query: 385  AKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFI 444
            AKF+Y+IPF+  LF+D  TLW+W             Q+C +NSLVLPSFYILTLILFHF+
Sbjct: 390  AKFQYTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFM 449

Query: 445  VAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGI 504
            VAIIPSL+LNQLRDSGWIFP A ++SKWYDHYKLF+  KVHWTL+ KQIPTMLALTFFGI
Sbjct: 450  VAIIPSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGI 509

Query: 505  LHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADS 564
            LHVPINVPALAMSL +D+YDVDKELIAHG+SNF+SG  GSIQNYLVYTNSVLFIRAGADS
Sbjct: 510  LHVPINVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADS 569

Query: 565  AMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYIT 624
            A+AG+ILI+LT I+M IGPVIISFIPICIVGSLIFLLGYELLVEAL DP GKIS FEYIT
Sbjct: 570  ALAGHILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYIT 629

Query: 625  IVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKF 684
            IVIIV TMGIFDFVLG+IVGILIACFSFLIDSTKLQTINGE+DGTVAKSTVYRDLIQTKF
Sbjct: 630  IVIIVFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKF 689

Query: 685  LNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNI 744
            LNGIGEQIYVLKLQNLLFFGTIISIEEKID+LLEI   DSS+ RIKYLILDFKNINADNI
Sbjct: 690  LNGIGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLILDFKNINADNI 749

Query: 745  DYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCE 804
            DYSAAEGFNRIKRFTQTK+I+L+ISSI+ERDHIY AF+NVGLL+GVELFNDLNSALEWCE
Sbjct: 750  DYSAAEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCE 809

Query: 805  NEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGN---DKKSNLDIPRNLMSLP 861
            NEFLFKYK LR+K + +  RK  IDIN +I       T GN   ++  +L+IPRN+MSLP
Sbjct: 810  NEFLFKYKTLREKTRQK--RKNKIDINLAI-------TNGNPTEERNMHLEIPRNIMSLP 860

Query: 862  INTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVK 921
            +NTPRN+Q+LSVAQNVF+NEEQ  K LK + K++   LPLLLF LKQYRP I+S DK+++
Sbjct: 861  MNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIE 920

Query: 922  ENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTC 981
            E EIKFWSQLCPY  +  L +QSTL HNNN FFIVE+GILKATF LP G +YETMSNRTC
Sbjct: 921  EKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTC 980

Query: 982  YGKITGQHNESTL---KTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKD 1038
            YGKI G +NE+T+   + LTI+ E D  LWVID  +L +MRAEN EL+ EL LLIM+++D
Sbjct: 981  YGKILGSNNETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLIMSIRD 1040

Query: 1039 NRFKELLGYTLVSA 1052
             RFKELLGYTLVSA
Sbjct: 1041 TRFKELLGYTLVSA 1054

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1311 bits (3394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1017 (65%), Positives = 783/1017 (76%), Gaps = 39/1017 (3%)

Query: 50   MGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFE 109
            + RSY+SGF +   + M     D + LP +     +   + IH SE LH+QTA +S +F 
Sbjct: 46   LCRSYMSGFFTGGSSPMNYNMSDPK-LPFS----NKQHPKVIHGSENLHRQTAQLSNEFC 100

Query: 110  D---DEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVD 166
                +E+   IKDY+ +          D +D  D +     +E  +E++          D
Sbjct: 101  SSSVEENSPTIKDYMDII---------DSDDRKDDQSMRTIEENIDEEY---------AD 142

Query: 167  ESSRLLISPLSSNINPNIDDLL---PTVTGEDVSSYQSIYRTATPS--LSRNSETIWQNI 221
            E SRLL+SP SSN++   +  L   PT   ED   +   Y++  PS  L     ++WQ  
Sbjct: 143  EYSRLLLSPASSNVDDERNRALQGSPTSDLED--GHGGGYQSVHPSHDLRFGPRSVWQWF 200

Query: 222  ADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXX 281
              FP +F  YLPAAVLGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMF         
Sbjct: 201  TSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQS 260

Query: 282  XXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLT 341
                GWSSFPSG+GSEMIE+TPF+HTMAL IKE L G DDEIITTTIFCYVISSMLTG+ 
Sbjct: 261  VYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDDEIITTTIFCYVISSMLTGVV 320

Query: 342  FYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDW 401
            FY LGKL LGKIVGFFPRHILIGCIGGVGYFL++TGIEVTTRVAKFEYS PF++ LF+++
Sbjct: 321  FYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFVSGLFTNY 380

Query: 402  ATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGW 461
             TL KW             QRCFKNSLVLP+FYILTL+LFHFIVAIIP+L+L+ LRDSGW
Sbjct: 381  DTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLRDSGW 440

Query: 462  IFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLD 521
            IFPIA S+SKWYDHYKLF+  KVHWTLV +QIPTM+ALTFFGILHVPINVPALAMSL +D
Sbjct: 441  IFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 500

Query: 522  KYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFI 581
            KYDVDKELIAHG SNF SG +GS+QNYLVYTNSVLFIRAGADS+ AG++L+ LT  +M I
Sbjct: 501  KYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVALTVCIMVI 560

Query: 582  GPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGI 641
            GPVIISFIPICIVGSLIFLLGYELLVEAL D W K++ FEY+T+VIIV TMGIFDFVLGI
Sbjct: 561  GPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMGIFDFVLGI 620

Query: 642  IVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLL 701
            IVGILIACFSFL+DSTKLQT+NGEY+G VAKSTVYRD +QTKFL+GIGEQIYVLKLQN+L
Sbjct: 621  IVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 680

Query: 702  FFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 761
            FFGTIISIEEKI+ LLEI +KDS++ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+T
Sbjct: 681  FFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTET 740

Query: 762  KKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSR 821
            K+I+L+ISSIKERDHIY AF+NVGLL  VELF DLN ALEWCENEFLF+YKQLR+KAK R
Sbjct: 741  KRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYKQLREKAKKR 800

Query: 822  L-HRKQ---IIDINASIGSQKYQFTAGN-DKKSNLDIPRNLMSLPINTPRNHQILSVAQN 876
            L  RKQ   +  I A+  ++K   +  + +K  N D  R+LMSLP NTPRNHQ+LSVAQN
Sbjct: 801  LEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPTNTPRNHQMLSVAQN 860

Query: 877  VFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFV 936
            VF N+EQ VKNLK E K+  P LP+LLF LKQYRP I+S  + V+E EIKFW+QLCPYF 
Sbjct: 861  VFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVREKEIKFWAQLCPYFS 920

Query: 937  KLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-K 995
            +  LASQS L+H +N+FF++ETG+LKA + LPQG++YE MSN TC+GKI    N     +
Sbjct: 921  RRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCFGKIIAPGNTMPREQ 980

Query: 996  TLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
             LTI  E DSILWVIDS SL KM+ EN  L+ E+TL+IM +KD RFKELLGYTLVSA
Sbjct: 981  KLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRFKELLGYTLVSA 1037

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1299 bits (3361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1017 (64%), Positives = 775/1017 (76%), Gaps = 39/1017 (3%)

Query: 50   MGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFE 109
            + RSY+SGF +   + M     D + LP +     +     IH SE LH+QTA +S +F 
Sbjct: 45   LCRSYMSGFFTGGSSPMVKNMSDSK-LPFS----NKQHPTVIHGSENLHRQTAQLSNEFC 99

Query: 110  D---DEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVD 166
                +E+   IKDY+ +   +D                  +D+++    +E + E    D
Sbjct: 100  SSSVEENSPTIKDYMDIIDSDDR-----------------KDDQSMRTIVENIDEEYS-D 141

Query: 167  ESSRLLISPLSSNINPNIDDLL---PTVTGEDVSSYQSIYRTATPS--LSRNSETIWQNI 221
            E SRLL+SP SSN++   +  L   P    ED   Y   Y++  PS  L      IWQ  
Sbjct: 142  EYSRLLLSPASSNVDDERNRALQSGPISELED--DYGGGYQSLRPSHNLRFRPRNIWQWC 199

Query: 222  ADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXX 281
              FP++F HYLPAAVLGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMF         
Sbjct: 200  TSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQA 259

Query: 282  XXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLT 341
                GWSSFPSGIGSEMIE+TPF+HTMALA+K+ L G DDEIITTTIFCYVISSMLTG+ 
Sbjct: 260  VYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDEIITTTIFCYVISSMLTGVV 319

Query: 342  FYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDW 401
            FY LGKL LGKIVGFFPRHILIGCIGGVGYFL++TGIEVTTRVAKFEYS PF + LF+++
Sbjct: 320  FYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTNY 379

Query: 402  ATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGW 461
             TL KW             QR FKNSLVLP+FYILTL+LFHFIVAIIP+L+L+ LR++GW
Sbjct: 380  DTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSLDTLREAGW 439

Query: 462  IFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLD 521
            IFPIA S+SKWYDHYKLF+  KVHW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +D
Sbjct: 440  IFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD 499

Query: 522  KYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFI 581
            KYDVD+ELIAHG SNF SG +GS+QNYLVYTNSVLFIRAGADS+ AG++LI LT  VM I
Sbjct: 500  KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICVMLI 559

Query: 582  GPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGI 641
            GPVIISFIPICIVGSLIFLLGYELLVEAL D W K++ FEY+T+VIIV TMG+FDFVLGI
Sbjct: 560  GPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGVFDFVLGI 619

Query: 642  IVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLL 701
            IVGILIACFSFL+DSTKLQTINGEY+G VAKSTVYRD +QTKFL+GIGEQIYVLKLQN+L
Sbjct: 620  IVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNVL 679

Query: 702  FFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 761
            FFGTIISIEEKI++LL+I +KD+ + RIKYLILDFKNINADNIDYSAAEGFNRIKRFT T
Sbjct: 680  FFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTGT 739

Query: 762  KKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSR 821
            K+I+L+ISSIKERD IY AF+NVGLL  VELF DLNSALEWCENEFLF+YKQLR+KAK R
Sbjct: 740  KRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLREKAKKR 799

Query: 822  LHRKQIIDINASI--GSQKYQFTA---GNDKKSNLDIPRNLMSLPINTPRNHQILSVAQN 876
            L  ++   + ++I   +Q  +      G     N D  RNLMSLP NTPRN+Q+LSVAQN
Sbjct: 800  LEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPTNTPRNYQMLSVAQN 859

Query: 877  VFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFV 936
            VF N+EQ VKN K E K+  P LP+LLF LKQYRP IIS  +TV+E EIKFW+QLCPYF 
Sbjct: 860  VFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEIQTVREKEIKFWAQLCPYFT 919

Query: 937  KLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-K 995
            +  LASQS L+H +NIFF+VETG+LKAT+ LPQG +YE  SN TC+GKI    N     +
Sbjct: 920  RRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQ 979

Query: 996  TLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
             LTI  E DS+LWVIDS SL KM+ EN  L+ E+TL++M +KD RFKELLGYTLVSA
Sbjct: 980  KLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCIKDTRFKELLGYTLVSA 1036

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1298 bits (3358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/1015 (65%), Positives = 780/1015 (76%), Gaps = 35/1015 (3%)

Query: 50   MGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFE 109
            + RSY+SGF +   + M +   D + LP++     +   + IH SE LH+QTA +S +F 
Sbjct: 45   LCRSYMSGFFTGGNSPMINNLSDSK-LPIS----NKQHPKVIHGSENLHRQTAQLSNEFC 99

Query: 110  D---DEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVD 166
                +E+   IKDY+ +     NG   D+ D    R     +E  +E++          D
Sbjct: 100  SSSVEENSPTIKDYMDII---GNG---DRKDDQSMRT---IEENIDEEY---------SD 141

Query: 167  ESSRLLISPLSSNINPNIDDLLPTVTGEDVS-SYQSIYRTATPS--LSRNSETIWQNIAD 223
            E SRLL+SP SSN++ + +  L   +  ++   Y   Y++  PS  L      +W     
Sbjct: 142  EYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTS 201

Query: 224  FPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXXX 283
            FP +F HYLPAAVLGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMF           
Sbjct: 202  FPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVY 261

Query: 284  XXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFY 343
              GWSSFPSGIGSEMIE+TPF+HTMALAIKE L G DDEIITTTIFCYVISSMLTG+ FY
Sbjct: 262  SGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFY 321

Query: 344  SLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWAT 403
            +LGKL LGKIVGFFPRHILIGCIGGVGYFL++TGIEVTTRVAKFEYS PF + LF+D+ T
Sbjct: 322  ALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDT 381

Query: 404  LWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIF 463
            L KW             QR FKNSLVLPSFYILTL+LFHFIVAIIP+L+L+ LR +GWIF
Sbjct: 382  LAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIF 441

Query: 464  PIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKY 523
            PIA S+SKWYDHY+LF+  KVHW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +DKY
Sbjct: 442  PIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKY 501

Query: 524  DVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGP 583
            DVD+ELIAHG SNF SG +GS+QNYLVYTNSVLFIRAGADS  AG++LI LT  +M IGP
Sbjct: 502  DVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGP 561

Query: 584  VIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIV 643
            VIISFIPICIVGSLIFLLGYELLVEAL D W K++ FEY+T+VIIV TMGIFDFVLGIIV
Sbjct: 562  VIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIV 621

Query: 644  GILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFF 703
            GILIACFSFL+DSTKLQTINGEY+G VA+STVYRD +QTKFL+GIGEQIYVLKLQNLLFF
Sbjct: 622  GILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFF 681

Query: 704  GTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKK 763
            GTIISIEEKI+ LL+I +KD+++ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+
Sbjct: 682  GTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKR 741

Query: 764  IQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLH 823
            I+L+ISSIKERD IY AF+NVGLL  VELF DLNSALEWCENEFLF+YKQLR KAK RL 
Sbjct: 742  IKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLE 801

Query: 824  R-KQIIDINASIGSQKYQF--TAGN--DKKSNLDIPRNLMSLPINTPRNHQILSVAQNVF 878
              KQ   ++A I + K +   T GN  ++ SN D  RNLMSLP NTPRN+QILSVAQNVF
Sbjct: 802  EGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVF 861

Query: 879  QNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKL 938
             N+EQ VKN K E KD  P LP+LLF LKQYRP IIS  + V+E EIKFW+QLCPYF + 
Sbjct: 862  VNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRR 921

Query: 939  PLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-KTL 997
             LASQS L+H +NIFF+VETG+LKAT+ LPQG +YE  SN TC+GKI    N     + L
Sbjct: 922  RLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKL 981

Query: 998  TIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            TI  E DS+LWVIDS SL K++ +N  L+ E+ L++M +KD RFKELLGYTLVSA
Sbjct: 982  TIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1015 (65%), Positives = 780/1015 (76%), Gaps = 35/1015 (3%)

Query: 50   MGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFE 109
            + RSY+SGF +   + M +   D + LP++     +   + IH SE LH+QTA +S +F 
Sbjct: 45   LCRSYMSGFFTGGNSPMINSMSDSK-LPLS----NKQHPKVIHGSENLHRQTAQLSNEFC 99

Query: 110  D---DEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVD 166
                +E+   IKDY+ +    D+G   D+ D    R         EED  E  +     D
Sbjct: 100  SSSVEENSPTIKDYMDII---DSG---DRKDDQSMR-------TIEEDIDEEYS-----D 141

Query: 167  ESSRLLISPLSSNINPNIDDLLPT-VTGEDVSSYQSIYRT--ATPSLSRNSETIWQNIAD 223
            E SRLL+SP SSNIN + +  L   +T E    Y+  Y++  ++ +L        +    
Sbjct: 142  EYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQSLRSSHNLRSRPRNFRRLCTS 201

Query: 224  FPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXXX 283
            FP +FIHYLPAAVLGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMF           
Sbjct: 202  FPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVY 261

Query: 284  XXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFY 343
              G SSFPSGIGSEMIE+TPF+HTMALA+KE L G DDEIITTTIFCYVISSMLTG  FY
Sbjct: 262  SGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDEIITTTIFCYVISSMLTGTVFY 321

Query: 344  SLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWAT 403
             LGKL LGKIVGFFPRHILIGCIGGVGYFL++TGIEVTTRVAKFEYS PF   LF+++ T
Sbjct: 322  VLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFLGLFTNYDT 381

Query: 404  LWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIF 463
            L KW             QR FKNSLVLPSFYILTL+LFHFIVAIIP+L+L+ LR +GWIF
Sbjct: 382  LAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDTLRAAGWIF 441

Query: 464  PIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKY 523
            PIA S+SKWYDHYKLF+  KVHW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +DKY
Sbjct: 442  PIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKY 501

Query: 524  DVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGP 583
            DVD+ELIAHG SNF SG +GS+QNYLVYTNSVLFIRAGADS+ AG++LI LT  +M IGP
Sbjct: 502  DVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIALTICIMMIGP 561

Query: 584  VIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIV 643
            VIISFIPICIVGSLIFLLGYELLVEAL D W K++ FEY+T+VIIV TMGIFDFVLGIIV
Sbjct: 562  VIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIV 621

Query: 644  GILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFF 703
            GILIACFSFL+DSTKLQTINGEY+G VAKSTVYRD +QTKFL+GIGEQIYVLKLQNLLFF
Sbjct: 622  GILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFF 681

Query: 704  GTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKK 763
            GTI+SIEEKI++LL+I +KD+++ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKK
Sbjct: 682  GTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKK 741

Query: 764  IQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLH 823
            I+L+ISSI+ERD IY AF+NVGLL  VELF DLNSALEWCENEFLF+YKQLR KAK RL 
Sbjct: 742  IKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRIKAKERLE 801

Query: 824  RKQIIDINASI--GSQKYQFTA---GNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVF 878
             ++  +I +++   +Q     A   G +K +N+D  RNLMSLP NTPRN+Q+LSVAQNVF
Sbjct: 802  ERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPTNTPRNYQMLSVAQNVF 861

Query: 879  QNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKL 938
             N+EQ VKN K E KD  P LP+LLF LKQYRP IIS  + V+E EIKFW+QLCPYF + 
Sbjct: 862  VNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEIQKVREKEIKFWAQLCPYFTRR 921

Query: 939  PLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTL-KTL 997
             LASQS L+H +N+FF+VETG+LKAT+ LPQG +YE  SN TC+GKI    N     + L
Sbjct: 922  RLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKL 981

Query: 998  TIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            TI  E DSILWVIDS SL KM+ EN  L+ E+ L++M +KD RFKELLGYTLVSA
Sbjct: 982  TIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/1033 (60%), Positives = 773/1033 (74%), Gaps = 45/1033 (4%)

Query: 43   NVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTA 102
            N + N ++GRSYVSG L  S    G    +  +LP++   G    +R IH   KLH+QTA
Sbjct: 60   NNDTNTFLGRSYVSGILGSSLPQGG----ERNTLPVSNKFG----SRAIHEQNKLHRQTA 111

Query: 103  AISEDFEDD---EDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPV 159
            AI+E+F+D    E  + +K+Y+ L       L   + + LD R     D +   D   PV
Sbjct: 112  AIAEEFDDGTIGESPSSLKEYLNL-------LDEAQEEELDLRNRRDLDNDLITDNKTPV 164

Query: 160  ------AEAADVDESSRLLISPLSSN------INPNIDDLLPTVTGEDVSSYQSIYRTAT 207
                  A   ++++ +  L++P SSN      ++P  + L  T   E  S+YQSI  T  
Sbjct: 165  SINLKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQSI--TVV 222

Query: 208  PSL------SRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIF 261
            PS       +  +   W  +     +  +Y+PAA+LGLLLNILDALSYGMIIFPITEPIF
Sbjct: 223  PSAGFRQMPTSTTAKAWMTLK----RVTNYMPAAILGLLLNILDALSYGMIIFPITEPIF 278

Query: 262  SHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDD 321
            + LGPTG+SMF             GWSSFPSGIGSEMIE+TPF+HTMALAI + LPGRDD
Sbjct: 279  AQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPGRDD 338

Query: 322  EIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVT 381
            EIITTTIFCYVISS++TGLTFY LGKL LGKIVGFFPRHILIGCIGGVGYFL++TG+EVT
Sbjct: 339  EIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVT 398

Query: 382  TRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILF 441
            TR+AKFEYSIPFL  LF D + L+KW             Q+CFKNSLVLPSFYI+TLILF
Sbjct: 399  TRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILF 458

Query: 442  HFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTF 501
            HF+VAI P+L+L+QLR +GWIFP    +SKWYDHY+ FD  K HW+LV KQIPTMLALTF
Sbjct: 459  HFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTF 518

Query: 502  FGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAG 561
            FGILHVPINVPALAMSL +DKYDVDKELIAHG SNF SG  GS+QNYLVYTNSVLFIRAG
Sbjct: 519  FGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAG 578

Query: 562  ADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFE 621
            ADSA+AGY+LI+LT +VM IGPVIISFIPICIVGSLIFLLGYELLVEA+ DP+GK++ FE
Sbjct: 579  ADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFE 638

Query: 622  YITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQ 681
            Y TI IIVLTMGIFDFVLGI+VGILIACFSFL+DSTKLQT+NGE+DGTVAKSTVYRD  Q
Sbjct: 639  YATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQ 698

Query: 682  TKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINA 741
            T+FL+ IGEQIYVLKLQN+LFFGTIISIEEKI+ LLEI   D S+ RIK+LILDFKNINA
Sbjct: 699  TRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFKNINA 758

Query: 742  DNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALE 801
            DNIDYSAAEGFNRIKR+T+ K+I+L+IS+I+E D IY  F+ VGLL+ +ELFNDLNSALE
Sbjct: 759  DNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALE 818

Query: 802  WCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGN-DKKSNLDIPRNLMSL 860
            WCENEFL++YK+LR+KA+++L R+   +INA+IG+Q  ++   N ++     + +NLMSL
Sbjct: 819  WCENEFLYQYKELREKARNKLQRRS-KNINAAIGNQLRRYDQTNKNQGPTSSLMQNLMSL 877

Query: 861  PINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTV 920
              NTPRN+Q++S AQ  F NE+Q    + T+LK   P L +LLF LK YRP I+S D   
Sbjct: 878  SNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPNIVSMDTEK 937

Query: 921  KENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRT 980
            + +E++FW QLCPYF +    + +T +HNNN FF+V+ GILK  +NLP G++YET+SN T
Sbjct: 938  RTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGT 997

Query: 981  CYGKI-TGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDN 1039
            CYGKI + + NE+  + L ++ E D+ILW+ID  S+  M+ +N  L+TEL LLI+A++D 
Sbjct: 998  CYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLLILAIRDT 1057

Query: 1040 RFKELLGYTLVSA 1052
            RFKELLGYTLVSA
Sbjct: 1058 RFKELLGYTLVSA 1070

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/1022 (62%), Positives = 755/1022 (73%), Gaps = 49/1022 (4%)

Query: 40   DDENVNN-NNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLH 98
            D+E  N+ +NY+ RSY+ G L   P+     + +  +LP++ +    L N+ IH S  LH
Sbjct: 39   DNELSNSKSNYLSRSYMYGLL---PSATPVEELETNTLPLSND----LRNKSIHQSRILH 91

Query: 99   KQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEP 158
            KQTAAI EDF ++ D+  +KDY+   +  D   + +  +SL   + L            P
Sbjct: 92   KQTAAICEDF-NESDEGSMKDYLDFIENTDRDNINEHKESLPVTVVLST----------P 140

Query: 159  VAEAADVDESSRLLISPLSSNIN-PNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETI 217
              E  + DESSRLL++P SSN    +I + L        SS +S      P   +   TI
Sbjct: 141  ADEVEEQDESSRLLLTPSSSNAEVSSIAEGL----RHHYSSIESTKDNNMPIEEQQDNTI 196

Query: 218  WQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXX 277
             + ++ F Y  + Y PA+VLGLLLNILDALSYGMIIFPI+EPIFSHLGPTG+SMF     
Sbjct: 197  NEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYISTI 256

Query: 278  XXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRD--DEIITTTIFCYVISS 335
                    GWSSFPS IGSEMIE+TPFFHTMA AI  +LPG +  D IITTTIFCYVISS
Sbjct: 257  ICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPGEENQDAIITTTIFCYVISS 316

Query: 336  MLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLA 395
            M TGLTF +LGKL LGKIVGFFPRHILIGCIGGVGYFLL+TGIEVTTR+AKFEYS+P + 
Sbjct: 317  MFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPLIK 376

Query: 396  SLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQ 455
             LF+D + LWKW             Q+CFK SLVLPSFYI TLILFHFIVAIIP L+L Q
Sbjct: 377  ELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSLTQ 436

Query: 456  LRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALA 515
            LR++GWIF     NS WYDHYKLFDF KVHW LVFKQIPTMLALTFFGILHVPINVPALA
Sbjct: 437  LREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPALA 496

Query: 516  MSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILT 575
            MS+ +DKYDVDKELIAHGLSN +SG  GSIQNYLVYTNSVLFIRAGADS  AGY+LI LT
Sbjct: 497  MSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLT 556

Query: 576  AIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIF 635
             +VM IGPVIISFIPICIVGSLIFLLGYELLVEAL D W K++ FEY+T+V+IVLTMGI 
Sbjct: 557  IVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMGIV 616

Query: 636  DFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVL 695
            DFVLGIIVGILIACF FLIDS+KLQTINGE+ G VAKSTV RDLIQ+KFLNGIG+QIYVL
Sbjct: 617  DFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIYVL 676

Query: 696  KLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRI 755
            KLQNLLFFGTIISIEEKID+LLE+  ++SS+ +IKYLILDF+NINADNIDYSAAEGFNRI
Sbjct: 677  KLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDFRNINADNIDYSAAEGFNRI 736

Query: 756  KRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLR 815
            KR T++K IQL+ISSIK RD IY +F+ VGLL GVELFNDLN ALEWCENEFL++YK +R
Sbjct: 737  KRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYKMIR 796

Query: 816  DKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQ 875
            ++ K +  +                 TA +    NL  P + M+L INTPRN+QI SVAQ
Sbjct: 797  ERIKIKNVK-----------------TATHSSDGNLSKP-SAMTLSINTPRNYQIYSVAQ 838

Query: 876  NVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYF 935
            N+F+NEEQTV  LK   +DQ P LPLLLF LKQYRP I+S DK  K  EI+FWSQL PYF
Sbjct: 839  NIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKGKEIEFWSQLAPYF 898

Query: 936  VKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITG-----QHN 990
             K  +ASQS L H NNIFF+VE G+LK TF+LPQG +YETMS R CYGKI G     + +
Sbjct: 899  SKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACYGKIMGKIPVSEAD 958

Query: 991  ESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLV 1050
              + + + I+ E D+++W+IDS +L KM+ EN EL+ EL LL+M +KD RFK LLG+ LV
Sbjct: 959  APSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIKDIRFKSLLGHALV 1018

Query: 1051 SA 1052
            S 
Sbjct: 1019 ST 1020

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1211 bits (3132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1051 (60%), Positives = 764/1051 (72%), Gaps = 55/1051 (5%)

Query: 47   NNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISE 106
            ++Y+GRSYVSG  S       + + ++    +     ++ +++PIH S+ LH+QT AI E
Sbjct: 48   SSYLGRSYVSGLWS------PTQRNNKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGE 101

Query: 107  DFEDDEDD-----TRIKDYITLFQGEDNGLMADKNDSLDQRLGL--GQDEEAEEDFIEPV 159
            +F D   D       + +YI L   E N       D++DQ  GL  G       +   PV
Sbjct: 102  NFSDSNGDEGSENKDLNEYIDLV--EHNERKTANIDNVDQIGGLATGPQTTVPGNKTHPV 159

Query: 160  A-----EAADVDESSRLLISPLSSNINPNIDDLLPTVTGED--------VSSYQSIYRTA 206
                  E    DE+SRLL++P+SS ++  I D   ++T ED        ++   S Y + 
Sbjct: 160  TSPLSDEYGIPDENSRLLLTPVSS-LSVAISDA-SSLTPEDYNGRARSPLNGINSTYGSQ 217

Query: 207  TPSLSRNSE----------TIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPI 256
             P+LS  S           + W  I+   +  +HYLPA++LGLLLNILDALSYGMIIFPI
Sbjct: 218  IPTLSSYSSAGMKIGPPITSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPI 277

Query: 257  TEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETL 316
            TEPIFS LGP+GLSMF             GWSSFP GIGSEMIEVTPFFHTMAL I +TL
Sbjct: 278  TEPIFSQLGPSGLSMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTL 337

Query: 317  -PGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLV 375
               R +EIITTTIFCYVISSM TGLTF++LGKL LGK+VGFFPRHILIGCIGGVGYFLL+
Sbjct: 338  GEERKNEIITTTIFCYVISSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLI 397

Query: 376  TGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYI 435
            TGIEV TR+AKFEYSIPFL +LF+D  TL++W             Q  F+NSLVLPSFYI
Sbjct: 398  TGIEVCTRIAKFEYSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYI 457

Query: 436  LTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPT 495
            LTLILFHFIVAI+P+L+L +LR+SGWIFP+A SN  WYDHYK F+F  VHW LV KQIPT
Sbjct: 458  LTLILFHFIVAIVPNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPT 517

Query: 496  MLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSV 555
            M+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHG SNF SG  GSI+NYLVYTNSV
Sbjct: 518  MMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSV 577

Query: 556  LFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWG 615
            LFIRAGADSA+AGYILI+LT IVM IGPVIISFIPICIVGSLIFLLGYELL+EAL D WG
Sbjct: 578  LFIRAGADSALAGYILIVLTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWG 637

Query: 616  KISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTV 675
            K++ FEY+T+ II+LTMGIFDFVLGIIVGILIACF FLIDST LQT+NGE+ G VAKSTV
Sbjct: 638  KLNTFEYVTVGIIILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTV 697

Query: 676  YRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILD 735
            YRD IQT FL+G+GEQIYVLKLQNLLFFGTIISIEEKID+LLEI + DSS+ RIKYLILD
Sbjct: 698  YRDPIQTTFLDGVGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILD 757

Query: 736  FKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFND 795
            FKNIN DNIDYSAAEGFNRI+RFTQTK IQL+ISSI+E+D IY+AF+NVGLL+ VELF D
Sbjct: 758  FKNINTDNIDYSAAEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQD 817

Query: 796  LNSALEWCENEFLFKYKQLRDKAKSRLHR------KQIIDINASIGSQKYQFTAGNDKKS 849
            LNS+LEWCENE L  Y +LR KAK+RL +        +  +  S   Q       +  +S
Sbjct: 818  LNSSLEWCENELLHWYNELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQS 877

Query: 850  NLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQY 909
                  NLMSLP NTPRNHQ+L+VAQ+VF+N+EQTV +L+ +LK + P LPLLL TLKQY
Sbjct: 878  GRAAISNLMSLPTNTPRNHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQY 937

Query: 910  RPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQ 969
            RP I S DK  ++ EI  WS+LCPYF K  + +Q+TL H N IFF+V+TG+LKA F LPQ
Sbjct: 938  RPDIGSNDKLARDKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQ 997

Query: 970  GNIYETMSNRTCYGKIT--------GQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAE 1021
            G +YETM+NRTCYGKI            +      L I  E DS LWVID+ ++ ++  E
Sbjct: 998  GCVYETMANRTCYGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLERE 1057

Query: 1022 NAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            + ELF +L LL+M +KD RFK+LLG+ L+SA
Sbjct: 1058 DPELFIQLALLVMLIKDKRFKDLLGHALISA 1088

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1206 bits (3119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1028 (60%), Positives = 759/1028 (73%), Gaps = 50/1028 (4%)

Query: 34   PRDDYFDDENVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHA 93
            P D   D      NNY+GRSYVSGFLS SP   GS   + + LP+A     R+  + IHA
Sbjct: 45   PYDSQNDQFMSPRNNYLGRSYVSGFLSCSP--YGSNSLESDRLPIA-----RMRTKSIHA 97

Query: 94   SEKLHKQTAAISEDF-EDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAE 152
            ++ LH+QTA + EDF E + +D  I+DY++  +      ++D     DQ          E
Sbjct: 98   AKNLHRQTAKLCEDFNEPNVEDNNIQDYVSATEEPRPMEISDAERMYDQ----------E 147

Query: 153  EDFIEPVAEAADVDESSRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSIYRTATPSLSR 212
            ++   PV     V+   R            +I+D+  ++       Y++I  +    L  
Sbjct: 148  DELRNPV----HVNTEDR----------GDDIEDVYESLVTGAHGGYRAIPTSPGGGLRT 193

Query: 213  NSET-IWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSM 271
            +S + +W+       + +HYLPA +LGLLLN+LD LSYGMIIFPITEPIFSHLGP+GLSM
Sbjct: 194  SSRSALWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSM 253

Query: 272  FXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCY 331
            F             G+S+FP+G+GSEMIEVTPFFH+MALAIK+ LPGRDDEI+TTTIFCY
Sbjct: 254  FYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPGRDDEILTTTIFCY 313

Query: 332  VISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSI 391
            VISS++TGLTFY LGK+ LGKIVGFFPRHILIGCIGGVGYFL+VTG+EVTTRVAK EY+ 
Sbjct: 314  VISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTW 373

Query: 392  PFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSL 451
            PF++ +F+D +TL KW             QR F+NSLVLP+FYI TL+ FHF+VAIIP++
Sbjct: 374  PFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNV 433

Query: 452  TLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINV 511
            +L +LR+ GWIFP+A S  +WYDHYKLF   +VHW L+ KQ PTMLAL+FFGILHVPINV
Sbjct: 434  SLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINV 493

Query: 512  PALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYIL 571
            PALA+SL +DKYDVDKELIAHG SN +SGA+GSIQNYLVYTNS+LFIRAGADSAMAGY+L
Sbjct: 494  PALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLL 553

Query: 572  IILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLT 631
              LT I+M IGPVIIS+IPICIVGSLIFLLGYELL EAL +  GK++NFEYITI IIVLT
Sbjct: 554  AFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLT 613

Query: 632  MGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQ 691
            MGIFDFVLG+IVGILIACFSFL+DSTKLQTINGEYDG +AKSTVYRD +Q++FL+GIGEQ
Sbjct: 614  MGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQ 673

Query: 692  IYVLKLQNLLFFGTIISIEEKIDELLEIC-HKDSSRLRIKYLILDFKNINADNIDYSAAE 750
            IYVLKLQ+LLFFGTIISIEEKI++LLEI   + +S+ RIK LILD KNINADNIDYSAAE
Sbjct: 674  IYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAE 733

Query: 751  GFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFK 810
            GFNRIKRFTQ+K IQL+ISSI E DHIY AF  V LL  VELF DLN ALEWCENE LFK
Sbjct: 734  GFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFK 793

Query: 811  YKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPR-----NLMSLPINTP 865
            YK+LR KA+ RL  K           Q     A ND K+   +P+     NLMSLP NTP
Sbjct: 794  YKELRAKARDRLQNKM----------QMANLAANNDTKAIDGVPKSHHMQNLMSLPFNTP 843

Query: 866  RNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEI 925
            RN Q+LSVAQ VF+NE++TV +LK   K+  P LPLLLF LK YRPGI+S D  VK +E+
Sbjct: 844  RNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALKPYRPGILSEDTNVKNSEL 903

Query: 926  KFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI 985
            + WS+LCPYF +  LASQS L+HN++IFF++ETGILK  ++LPQG +YE++SNRTCYG +
Sbjct: 904  ELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCYGIV 963

Query: 986  TGQHNESTLKT-LTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKEL 1044
                     ++ +TI+ E + +LWVIDS  L +++ EN  L+TEL LLI  VK+ R++++
Sbjct: 964  LNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILLIATVKEQRYRQI 1023

Query: 1045 LGYTLVSA 1052
            LGYTLVSA
Sbjct: 1024 LGYTLVSA 1031

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1017 (61%), Positives = 737/1017 (72%), Gaps = 68/1017 (6%)

Query: 45   NNNNYMGRSYVSG-FLSVSPALMGSMKQDEES-LPMAYNGGQRLFNRPIHASEKLHKQTA 102
            N+NNY GRSY+ G FLS SP +    + D+ S LP+      R  ++ IH S+ +H+QTA
Sbjct: 67   NSNNYAGRSYLGGGFLSASPKMNLQQRNDDSSVLPI-----DRSRSKSIHGSQIIHRQTA 121

Query: 103  AISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEA 162
             +S +F DD   T +++    +       M D+N SL   +         +D+       
Sbjct: 122  ELSNNFSDDT--TGMEEVRNRYDA-----MEDENSSLHHYM-------THQDY------- 160

Query: 163  ADVDESSRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETIWQNIA 222
                                     LP  T ED ++  +         S+ +     +I 
Sbjct: 161  -----------------------QTLPGGTDEDWTNNNN---------SQTARASGSSIV 188

Query: 223  DFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXX 282
             F    +HY P+AVLGLLLNILD LSYGMIIFPITEPIFSHLG TGLSMF          
Sbjct: 189  QFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCL 248

Query: 283  XXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTF 342
               G SSF SGIGSEMIEVTPFFHTMA AI++ +PG+DD+IITTTIFCY ISS++TG+TF
Sbjct: 249  YSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITF 308

Query: 343  YSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWA 402
            Y LGKL LGKIVGFFPRHILIGCIGGVGYFLL+TG+ VTTR+AK EY+  FL  LF D  
Sbjct: 309  YLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTD 368

Query: 403  TLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWI 462
             LWKW             Q+CF+NSLVLPSFYI+TLILFHF+VAI+PS++L+QLRD GWI
Sbjct: 369  ILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWI 428

Query: 463  FPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDK 522
            FP A S  +W+DHYKLFD+ KVHW LV  QIPTMLALTFFGILHVPINVPALA+SLH+DK
Sbjct: 429  FPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDK 488

Query: 523  YDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIG 582
            +DVDKELIAHG SNFISG VGSIQNYLVYTNSVLFIRAGADS  AGY+L ILT  VM IG
Sbjct: 489  FDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIG 548

Query: 583  PVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGII 642
            PVI+SFIPICIVGSLIFLLGYELLVEAL D  GK++NFEYITIVIIVLTMGI+DFVLG+I
Sbjct: 549  PVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVI 608

Query: 643  VGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLF 702
            VGILIACFSFL+DSTKLQTINGE+DG VA+STV RD +Q+ FLNG+GEQIYVLKLQN+LF
Sbjct: 609  VGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLF 668

Query: 703  FGTIISIEEKIDELLEIC-HKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 761
            FGTIISIEEKID+LLEI   K SS+ RIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT
Sbjct: 669  FGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQT 728

Query: 762  KKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSR 821
            K+I+L+ISSIKERDHIY  F NVGLL  VELFNDLN ALEWCENEFL +YK+LRD+A+ +
Sbjct: 729  KRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREK 788

Query: 822  L-HRKQIIDINASIGSQKYQFTAGNDKKSNLDIP--RNLMSLPINTPRNHQILSVAQNVF 878
            + H   +     +  ++K         K NL +   RNL SLP+NTPRNHQ+LSVAQN+F
Sbjct: 789  MQHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF 848

Query: 879  QNEEQTVKNLKTELKD--QAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFV 936
             N+E+ V  L+ E  +  Q P LPLLLF LK YR  I STD  ++E E + WSQL PYFV
Sbjct: 849  -NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFV 907

Query: 937  KLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQ-HNESTLK 995
            K  L +QS L+HN + FF+VE+G+LK   +LPQG +YETMSNRTC G I G  +  S   
Sbjct: 908  KRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEH 967

Query: 996  TLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
             +TI  E D+ LW+ID   L K+RAEN +L+TEL LL + +K  RF++LLGYTLVSA
Sbjct: 968  KVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1008 (58%), Positives = 742/1008 (73%), Gaps = 24/1008 (2%)

Query: 50   MGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFE 109
            +GRSY     S SP+L  +  + +E LP+     +++ ++ I   + LH+QTA IS DF 
Sbjct: 69   IGRSYAGSISSNSPSLYLNTSRTDELLPI-----RKMPSKSILGPDALHRQTAEISNDFN 123

Query: 110  DDE-DDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAE-EDFIEPVAEAADVDE 167
            D   D+ +IK YI L   +    +  + +  +  + L      E + F+ P+  +A   +
Sbjct: 124  DTSMDEAKIKRYIELLNRKQ---IEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLD 180

Query: 168  S--SRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSIYRTATPSLSRNSETIWQNIADFP 225
                R L++P SS +    D  L +   E  + Y SI R  +  L+ +S       A   
Sbjct: 181  GLEQRALLTPSSSIVGNEFD--LESTYDEINNDYNSILRIQSRELTSSS------FATKG 232

Query: 226  YQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXXXXX 285
             + ++YLPAA+LGLLLNILDALSYGMIIFPITEP+FS LGPTG+SMF             
Sbjct: 233  LELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSG 292

Query: 286  GWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSL 345
            G+SSFP GIGSEMIE+TPF+HTMA AIK+ LP +D+E+ITTTIFCYVISS++TGL F+ L
Sbjct: 293  GFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFML 352

Query: 346  GKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLW 405
            GKL +GKIVGFFPRHILIGCIGGVGYFL++TGIEV+TR+ KFEY+  FL SL ++  TL 
Sbjct: 353  GKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLG 412

Query: 406  KWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPI 465
            KW             QR  +NSLVLPSFYILT+ILFHFIVAI+P+L+L+ LR++GWIFP+
Sbjct: 413  KWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPV 472

Query: 466  AISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDV 525
              S + WYDHYK F+   +HW LV KQIPTMLALTFFGILHVPINVPALAMSLH+DKYDV
Sbjct: 473  TDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDV 532

Query: 526  DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
            D+ELIAHG SN ISG +GS+QNYLVYTNSVLFIRAGADS+ AG++L+ LT +VM  G VI
Sbjct: 533  DRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVI 592

Query: 586  ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGI 645
            +SFIP+CIVGSLIFLLGYEL+VEAL D  G +++FEYITI+IIV  MGI+DFVLGIIVGI
Sbjct: 593  VSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGI 652

Query: 646  LIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGT 705
            LIAC SF++D TKL+TINGEYDG VAKSTVYRD IQTKFLNGI +QIY+LKLQN+LFFGT
Sbjct: 653  LIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGT 712

Query: 706  IISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQ 765
            IISIEEKID+LLEI  KD S+ RIKYLILDFKNINADNIDYSAAEGFNRIKRFTQ K+IQ
Sbjct: 713  IISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQ 772

Query: 766  LLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRK 825
            L+ISSIKE+D IY  F+ V LL+ VELF+DLNSALEWCENEFL++Y QL +KAK R+H++
Sbjct: 773  LIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKR 832

Query: 826  QIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTV 885
              I I+   GS  +     +   S  D  + LMSLPINTPRN+Q+LSVA+ VF+NE QT 
Sbjct: 833  --ISISKDSGSTYFSRNRSDSGLSAAD-QQMLMSLPINTPRNNQVLSVARKVFKNEAQTA 889

Query: 886  KNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQST 945
               KT  +   P L LLL++++ +RP + S D +++E EI FW QL PYF +    + ST
Sbjct: 890  SKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGST 949

Query: 946  LIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNEST-LKTLTIRAEID 1004
            L++++N FF+VE+G+++ T +LPQG + ETMSNRTCYGK+ G     T L  +  + E +
Sbjct: 950  LVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETE 1009

Query: 1005 SILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            SI+W+ID  ++ +++ EN  L+TEL LL+M +++ R+K L+GYTLVSA
Sbjct: 1010 SIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1059 (56%), Positives = 747/1059 (70%), Gaps = 82/1059 (7%)

Query: 35   RDDYFDDENVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGG-QRLFNRPIHA 93
            R    + EN ++N Y+GRSYV  F   SP+ +    Q E S    +     +  ++ IH 
Sbjct: 33   RRSSMNPEN-SSNYYLGRSYVGSF--SSPSFL----QRESSADTGHILSLHKDASKSIHE 85

Query: 94   SEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDE---- 149
            S KLH+QTAA+S +F+D  D     D I +   ++      +N++L + L L        
Sbjct: 86   SVKLHRQTAALSNNFDDSSDGK--SDEIDVAASQEF-----QNEALQRELSLENGSYSNS 138

Query: 150  ----------EAEEDFIEPVAEAADVDESSRLLISPLSS-----NINPNIDDLLPTVTGE 194
                         ED I    E   ++E +RLL SP S+         +  +L P  +  
Sbjct: 139  NNNNNNNNQIAYSEDAI--TQENNGLNECTRLL-SPTSAAATDLEYGTSPTNLSPPSSQY 195

Query: 195  DVSSYQSIYRTATPSLS-------------RNSETIWQNIADFPYQF--------IHYLP 233
            +   Y S+    +PS +                 ++ Q +    Y +        ++Y+P
Sbjct: 196  EQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRSYYDYAKGWSIKTLNYMP 255

Query: 234  AAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSG 293
            A +LGLLLN+LDALSYGMIIFPITEP+FSHLGPTGLSMF             G+S+F +G
Sbjct: 256  AVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVSTILSQLVYSCGFSAFGNG 315

Query: 294  IGSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKI 353
            IGSEMIE+TPFFHTMAL+I  +LPG DDEII+TTI CY +SS+ TGL F+ LGKL LGKI
Sbjct: 316  IGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALSSIFTGLAFFLLGKLRLGKI 375

Query: 354  VGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXX 413
            VGFFPRHILIGC+GGVGYFLL+TGIEV TRV+KFEYS PFL  LF +   L KW      
Sbjct: 376  VGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFLRELFYNTEVLGKWMLPLIL 435

Query: 414  XXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWY 473
                   Q  F NSLVLPSFYI+TL LFHF+VAI+P+L+LN LR+SGWIFP+A S++ WY
Sbjct: 436  TLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLNSLRESGWIFPMAGSSNHWY 495

Query: 474  DHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHG 533
            D YKL+DF+ VHWTLV KQ+PTMLALTFFGILHVPINVPALAMS+ +DK+DVDKELIAHG
Sbjct: 496  DFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPALAMSIGMDKFDVDKELIAHG 555

Query: 534  LSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICI 593
             SN +SG  GSIQNYLVYTNS LFIRAG+DS+ AG++L + T +VM IGPVIISFIPICI
Sbjct: 556  YSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVIISFIPICI 615

Query: 594  VGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFL 653
            VGSLIFLLGYEL+ EAL+D WGK++ FEYITIVIIV TMG+FDFVLGIIVGILIACFSFL
Sbjct: 616  VGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVGILIACFSFL 675

Query: 654  IDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKI 713
            +DSTKLQTINGE++G VA+STVYRD IQTKFLN +GEQI+VLKLQNLLFFGTIISIEEKI
Sbjct: 676  VDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHVLKLQNLLFFGTIISIEEKI 735

Query: 714  DELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKE 773
            D LLEI  KDSSR RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+IQL+ISSI E
Sbjct: 736  DGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIQLIISSITE 795

Query: 774  RDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINAS 833
            +D IY AF+ VGLL+ VELF DLNSALEWCENEFL +YKQ+R + K++L  +        
Sbjct: 796  KDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQIRTRTKAKLQAQ-------- 847

Query: 834  IGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELK 893
                         KK    + ++L  LPINTPRN+QI++VAQ +F  +EQ V +L+T+ +
Sbjct: 848  -------------KKQEKHLSKSL--LPINTPRNNQIVTVAQKIFP-DEQNVTHLRTQYQ 891

Query: 894  DQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIF 953
             + P LPLLL  LK++RP I+S DK VK+ E  FWS+LCPYFV+   A  S L+HNNN+F
Sbjct: 892  KREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFWSKLCPYFVRKRFAPGSLLLHNNNLF 951

Query: 954  FIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKTLTIRAEIDSILWVIDSG 1013
            F+VE+G+LK T++L QG  YETMS++TCYG+I+G    +T   + I+ E D  +W+ID+ 
Sbjct: 952  FLVESGMLKITYDLHQGQFYETMSSKTCYGRISGNAEFTTNLYVNIKTETDCAVWIIDAT 1011

Query: 1014 SLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052
            +L  ++ +N  L+ EL L++M++   R KELLGY+LVS+
Sbjct: 1012 NLANLKEKNLALYAELLLVVMSINQYRSKELLGYSLVSS 1050

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1040 (56%), Positives = 732/1040 (70%), Gaps = 100/1040 (9%)

Query: 91   IHASEKLHKQTAAISEDF-------EDDEDDTRIKDYITLFQGEDNGLMADKND---SLD 140
            IH S+ LHK+TA IS +F       EDD  +T   +  +  Q  +N  + D ND    LD
Sbjct: 133  IHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPNIPSTAQSSNN--LNDSNDFMIELD 190

Query: 141  ----------------------------------QRLGLGQDE----------------- 149
                                              Q L +G +E                 
Sbjct: 191  GNNNTNNSNNIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISGDNGGIVNRLP 250

Query: 150  --EAEEDFIEPVAEAADVDESSRLLISP------------LSSNINPNIDDLLPTVTGED 195
              E +ED I       D DE SRLL +P             SS+ N +  DL      E+
Sbjct: 251  IQELDEDII-------DNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDL------EN 297

Query: 196  VSSYQSIYRTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFP 255
             +   S   T T      S +    +     Q +H +PA +LGLLLNILDALSYGMI+FP
Sbjct: 298  NNYISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFP 357

Query: 256  ITEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKET 315
            IT+ +F HLGPTGLSMF             G+S+FPSG+G EMIE+ PFFHTMAL +K +
Sbjct: 358  ITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNS 417

Query: 316  LPGRD-DEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLL 374
            +P +D +EIITTTIFCYVIS + TG+ F+ LGK  LGK+VGFFPRHILIGCIGGVGYFL+
Sbjct: 418  IPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLI 477

Query: 375  VTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFY 434
            VTGIEVTTRV K EYS+ FL S+ ++ +TL+K              Q+ + +SL+LPSFY
Sbjct: 478  VTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFY 537

Query: 435  ILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIP 494
            I+T I FHFIVA++P+L+L+ LR +GWIFP+A S+  WY HYK F+F   HW LVFKQIP
Sbjct: 538  IITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIP 597

Query: 495  TMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNS 554
            TM ALTFFGILHVPINVPALAMS+ +DKYDVDKELIAHG SN ISG  GS+QNYLVYTNS
Sbjct: 598  TMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNS 657

Query: 555  VLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPW 614
            VLFIRAG ++A AG +L   TAI++FIGPVIISFIP+CIVGSLIFLLG+EL+VEAL D W
Sbjct: 658  VLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW 717

Query: 615  GKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKST 674
            GK++ FEYITI+IIV TMGI+DFVLGI+VGILIACFSFL+DSTKLQT+NGE++GTVAKST
Sbjct: 718  GKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKST 777

Query: 675  VYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLIL 734
            VYRD +Q++FL+GI EQIYVLKLQN+LFFGTIISIEEKID LLEI   DSS+ RIKYLIL
Sbjct: 778  VYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLIL 837

Query: 735  DFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFN 794
            D KN+N+DNIDYSAAEGFNRIKRFTQ+K+IQL+ISSIK+ D IYK F+NV LL+ VELF+
Sbjct: 838  DLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFS 897

Query: 795  DLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAG-NDKKSNLDI 853
            DLN ALEWCENEFL++Y+Q+++KA++R  RK         G      +   ND+KS+   
Sbjct: 898  DLNGALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSS--- 954

Query: 854  PRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGI 913
                 +LPINTPRNHQ++SVA+N+FQN EQ V++  T L    P L LL+F LKQYR  I
Sbjct: 955  ----GNLPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDI 1010

Query: 914  ISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIY 973
             S D  V++ E++FWSQLCPYF K PLA++++L+HNNN+FFIVE+G+LK  FNLPQG++Y
Sbjct: 1011 FSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVY 1070

Query: 974  ETMSNRTCYGKITGQ-HNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLL 1032
            ETMSNRTCYG+I G+ + + +   L I+AE D I+W+I+S  L KM+AEN EL+TELTLL
Sbjct: 1071 ETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLL 1130

Query: 1033 IMAVKDNRFKELLGYTLVSA 1052
            +M+VKD+RF  LLGY L+SA
Sbjct: 1131 VMSVKDDRFNNLLGYALISA 1150

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1109 bits (2868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/973 (58%), Positives = 723/973 (74%), Gaps = 31/973 (3%)

Query: 89   RPIHASEKLHKQTAAISEDFEDDE-DDTRIKDYITLFQGEDNGLM----ADKNDSLDQRL 143
            + I  ++ LH+QTA +S+ F D    D  +KDYI +    DN +     +D N + +  L
Sbjct: 99   KSITVADILHRQTAELSKTFYDSNFTDKDVKDYIDII---DNDVATSNESDSNSTPEPYL 155

Query: 144  GLGQDEEAEEDFIEPVAEAADVDESSRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSIY 203
            G   D+       +     AD DE SRLL +P SS I   +D             ++ + 
Sbjct: 156  GDEYDQHRLAIRTQKSPNIAD-DEQSRLL-TPSSSIIGAELD------LEAHYDEFEPV- 206

Query: 204  RTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSH 263
            R    S++R +E+    + DF  Q +HY PAAVLGLLLNILDALSYGMIIFPITEPIF++
Sbjct: 207  RMDASSINRQNES---KLIDFS-QILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFAN 262

Query: 264  LGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPGRDDEI 323
            +G  G+SMF             G+SSFP+GIGSEMIE+TPF+HTMALAIK +L  ++ EI
Sbjct: 263  MGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSLDVQE-EI 321

Query: 324  ITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTR 383
            I+TTIFCYVISS++TGL FYSLGKL LGKIV FFPRHILIGCIGGVGYFL+VTG+EVTTR
Sbjct: 322  ISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTR 381

Query: 384  VAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHF 443
            VAK EYS  FL+ L SD+  + KW             Q  F+NSLVLPSFYI+T+ILFHF
Sbjct: 382  VAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHF 441

Query: 444  IVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFG 503
            IVA++P L+LN+LRDSGWIFP+  SN KW+DHYK F+   V W L+ KQ+PTMLALTFFG
Sbjct: 442  IVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFG 501

Query: 504  ILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGAD 563
            ILHVPINVPALAMSL++DK+DVD+E IAHG SNF+SG  GS+QNYLVYTNSVLFIRAGAD
Sbjct: 502  ILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGAD 561

Query: 564  SAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYI 623
            S +AGY+LI+LTAIVM IGPVIISFIPICIVGSLIFLLGYELL+EAL D  GK++ FEY 
Sbjct: 562  SPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYT 621

Query: 624  TIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTK 683
            TI+IIV TMGI+DFVLGIIVGIL+AC  F++D TKLQTIN EYDGT+AKSTVYRD IQ+K
Sbjct: 622  TIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSK 681

Query: 684  FLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADN 743
            FL+GIGEQIY++KLQN+LFFGTIISIEEKID LL++   DSS+ RI+YLILDFKNIN DN
Sbjct: 682  FLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDDN 741

Query: 744  IDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWC 803
            IDYSAAEGFNRIKRFT  + I+L+ISSI   D IYKAF+ +GLL+ +ELF+DLN+ LEWC
Sbjct: 742  IDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWC 801

Query: 804  ENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTA--GNDKKSNLDIPRNLMSLP 861
            EN++L KY++L +KAK RLH +  I  + +I S++   T+  GN+ +S+    + LMSLP
Sbjct: 802  ENKYLEKYRELHEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSS----QRLMSLP 857

Query: 862  INTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVK 921
            +NTPRNHQ+LSVA+NVF+NE Q V   K     +  F  LLL +++++RP + S  K ++
Sbjct: 858  LNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVFSESKDIR 917

Query: 922  ENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTC 981
              EIKFW+QL PYF K+ + + ST ++ NN FF++++G++K T +L  G + ETM +RT 
Sbjct: 918  AQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTS 977

Query: 982  YGKITGQHNESTLKT--LTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDN 1039
            YG ++ ++N  T KT  +T   E  S++W+IDS  L KM  EN +L++ELTLLIM++ D 
Sbjct: 978  YGILSSKNNR-TYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLIMSISDY 1036

Query: 1040 RFKELLGYTLVSA 1052
            RFK LLGYTLV+A
Sbjct: 1037 RFKALLGYTLVNA 1049

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1041 (54%), Positives = 721/1041 (69%), Gaps = 87/1041 (8%)

Query: 34   PRDDYFDDENVNNNNY-MGRSYVSGFLSVSPALMGSMKQD-EESLPMAYNGGQRLFNRPI 91
            PR + F      + +Y +GRSYV+   ++SP  +  +       LP++Y   Q   ++ I
Sbjct: 36   PRANPFSHTGDGSPHYYLGRSYVA---NLSPPPLARLPGGLPGELPLSYRPEQ---SQSI 89

Query: 92   HASEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEA 151
            H S  L +QTAA+S +FED             F+ ED            Q  G+ +D+  
Sbjct: 90   HQSVSLRRQTAALSNEFEDT------------FEFED------------QLAGVSEDDGH 125

Query: 152  EEDFIEPVAEAADVDESSRLLISPLSS------NINPNIDDLLPTVTGEDVSSYQSI--Y 203
                 EP             LISP+SS      +IN   + LLP     D+  Y SI  Y
Sbjct: 126  STTAEEPSMNGT--------LISPVSSVPDTPIDINEPSNALLPPNAEHDLE-YGSIDGY 176

Query: 204  RTATPSL-SRNSETIWQNIAD----------FPYQFIHYLPAAVLGLLLNILDALSYGMI 252
                 SL SR S     NI               + ++Y+PA +LGLLLNILDALSYGMI
Sbjct: 177  EHQYVSLQSRRSGANTHNIGPDASLREKMMFTARRMVNYMPAVILGLLLNILDALSYGMI 236

Query: 253  IFPITEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAI 312
            IFPITEP+FSHLGPTG+SMF             G+S+F + +GSEMIE+TPF+H MA +I
Sbjct: 237  IFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASI 296

Query: 313  KETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYF 372
               LPG  D +++TTI CY +SS++TGL F+ LG+L LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 297  VAGLPGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYF 356

Query: 373  LLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPS 432
            LL+TG+EVTTRVAKFEYS  FL+SLF++   L KW             Q  F NSLVLP+
Sbjct: 357  LLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPA 416

Query: 433  FYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQ 492
            FYI  L+LFHFIVA+IPSL+L+ LRDSGWIFP   S   W+D Y L++FK V W ++ KQ
Sbjct: 417  FYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQ 476

Query: 493  IPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYT 552
            IPTMLALTFFGILHVPINVPALAMS+ LDK DVDKELIAHG SNF+SG +GS+QNYLVYT
Sbjct: 477  IPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYT 536

Query: 553  NSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWD 612
            NSVLFIRAG D A+AG +L   T  +M +GPVI+++IP+CIVGSLIFLLGYELL EAL+D
Sbjct: 537  NSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYD 596

Query: 613  PWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAK 672
             WGK++NFEY T+V IV TMG FDFVLGIIVGILIACFSFL+DSTKLQT+NGE+DG VA+
Sbjct: 597  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVAR 656

Query: 673  STVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYL 732
            STV RD IQT+FLN IGEQI+VLKLQNLLFFGTI+SIEEKID+LLE+  KDSS+ RIKYL
Sbjct: 657  STVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYL 716

Query: 733  ILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVEL 792
            ILDFKNINADNIDYSAAEGFNRIKRFT +K+I L+ISSIK  D IY+AF+ VG+L+GVEL
Sbjct: 717  ILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVEL 776

Query: 793  FNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLD 852
            F+DLNSALEWCENEFL ++K LR+K K +  +KQ                   D++ +  
Sbjct: 777  FDDLNSALEWCENEFLIQFKDLRNKTKLKAGKKQ-------------------DRRMS-K 816

Query: 853  IPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPG 912
            +P     LP NTPRN+Q +SVAQ +F  +EQ++ +LK+  +++ P LPLLL  L+++RP 
Sbjct: 817  VP-----LPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYRERPPVLPLLLSALQRFRPQ 870

Query: 913  IISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNI 972
            I+S+DK+VKE E + WS LC YF K  LA+ S L+H +NIFF++ETG++K T+NL QG +
Sbjct: 871  IMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQL 930

Query: 973  YETMSNRTCYGKI-TGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTL 1031
            YETMS +TCYG++    +N + +  + +  E D  LW+ID   L K++ EN  L+TE+ L
Sbjct: 931  YETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLL 990

Query: 1032 LIMAVKDNRFKELLGYTLVSA 1052
            + + +  +R KELLG+ LVS+
Sbjct: 991  VTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1061 bits (2743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1041 (53%), Positives = 723/1041 (69%), Gaps = 88/1041 (8%)

Query: 34   PRDDYFDD-ENVNNNNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRPIH 92
            PR + F +  + + + Y+GRSYV+   ++SP  + ++K+     P + +  ++  ++ IH
Sbjct: 36   PRGNPFSNGADGSPHYYLGRSYVA---NLSPPPL-AIKERFSGDPTSSSRPEQ--SQSIH 89

Query: 93   ASEKLHKQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAE 152
             S  L +QTAA+S +F+              F+ ED                  Q E+  
Sbjct: 90   QSLSLRRQTAALSNEFDGT------------FEFED------------------QLEDLA 119

Query: 153  EDFIEPVAEAADVDESSRLLISPLSSNINPNIDD-------LLPTVTGEDVSSYQSI--- 202
            E+    V + + +  S+   ISP SS   P++ D       LLP  T  D+  Y SI   
Sbjct: 120  ENGNTAVPDESVMAGSA---ISPTSSGPEPSVLDNTDVSNLLLPPNTQRDL-EYGSIDEF 175

Query: 203  ---------YRTATPSLSRNSETIWQNIADFPYQFI-HYLPAAVLGLLLNILDALSYGMI 252
                      R  + S + +     ++   F ++ + +Y+PA +LGLLLNILDALSYGMI
Sbjct: 176  DHQYVSLQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMI 235

Query: 253  IFPITEPIFSHLGPTGLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAI 312
            IFPITEP+FSHLGP+GLSMF             G+S+F + +GSEMIE+TPF+H+MA +I
Sbjct: 236  IFPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASI 295

Query: 313  KETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYF 372
              ++PG  D ++TTTI CY +SS++TGL F+ LG+L LGKIVGFFPRHILIGCIGGVGYF
Sbjct: 296  MASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYF 355

Query: 373  LLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPS 432
            L++TG EVTTR +KFEYS  FL+SL +D   L KW             QR  KNSLVLP+
Sbjct: 356  LVITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPT 415

Query: 433  FYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQ 492
            FYI  L+LFHFIVA+IPSL+L+ LRDSGW+FP   +   W+D YKL++FK V W LV KQ
Sbjct: 416  FYIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQ 475

Query: 493  IPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYT 552
            +PTMLALTFFGILHVPINVPALAMS+ LDK DVDKELIAHG SNF+SG +GS+QNYLVYT
Sbjct: 476  VPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYT 535

Query: 553  NSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWD 612
            NS+LFI+AGAD ++AG +L   T  +M IGPVI+++IP+CIVGSLIFLLGYELL EAL D
Sbjct: 536  NSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVD 595

Query: 613  PWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAK 672
             WGK++NFEY T+V IV TMG FDFVLGIIVGILIACFSFL+DSTKLQTINGE+DG VA+
Sbjct: 596  TWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVAR 655

Query: 673  STVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYL 732
            STV RD IQT+FLN IGEQI+VLKLQNLLFFGTIISIEEKID+LLE+  KD+S+ RIKYL
Sbjct: 656  STVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYL 715

Query: 733  ILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVEL 792
            ILDFKNINADNIDYSAAEGFNRIKRFT +K+I L+ISSIK  D IY+AF+ VG L GVEL
Sbjct: 716  ILDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVEL 775

Query: 793  FNDLNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLD 852
            F+DLNSALEWCENEFL +++ LR+K K +  RK           Q+ Q + G        
Sbjct: 776  FDDLNSALEWCENEFLRQFRDLRNKTKLKAVRK-----------QERQLSKG-------- 816

Query: 853  IPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPG 912
                  +LP NTPRN+  +SVAQ +F  +EQ++ +LKT  K++ P L LLL  L++YRP 
Sbjct: 817  ------ALPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQRYRPE 869

Query: 913  IISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNI 972
            I+S +K VKE E K WS+L  +F K  LA+QS L H NNIF +VE+G++K T+NL QG +
Sbjct: 870  IMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQL 929

Query: 973  YETMSNRTCYGKITGQH-NESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTL 1031
            YE +S +TCYG+IT  + +E  + ++ I+ E D  LW++D  +L K++ EN  L+TEL L
Sbjct: 930  YEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLL 989

Query: 1032 LIMAVKDNRFKELLGYTLVSA 1052
            + + +  +R KELLG+ LVS+
Sbjct: 990  VTLCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1072 (51%), Positives = 703/1072 (65%), Gaps = 110/1072 (10%)

Query: 47   NNYMGRSYVSGFLSVSPALMGSMKQDEESLPMAYNGGQRLFNRP--------IHASEKLH 98
            + Y+GRSYV  F  +SP +      +  S     +     F  P        IH S  LH
Sbjct: 31   STYLGRSYVGSF--ISPPMEYRSNSNTTSNNNNNSNVGDPFKSPFSSEGSKLIHESGNLH 88

Query: 99   KQTAAISEDFEDDEDDTRIKDYITLFQGEDNGLMADKND-----SLDQRLGLGQDEEAE- 152
            KQTA +S  F++D  +     +     G D+    ++ND       DQ L   Q      
Sbjct: 89   KQTAFLSNTFDNDAGNDEGAGFP--LDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRGRM 146

Query: 153  -----------------EDFIEPVAEAADV--------DESSRLLISPLSSNINPNIDDL 187
                             ED     A+   +        D+SS L +S  + N+      L
Sbjct: 147  SVDAAADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTENLA-----L 201

Query: 188  LPTVTGEDVSSYQSIY----------RTATPSLS----------------RNSETIWQNI 221
            LPT      +S+ S+Y          + AT  +S                R+S + +   
Sbjct: 202  LPT------NSHNSMYVEYGTFDEENQPATQYISLLPDGASSGGFTSQGFRSSMSHYDKA 255

Query: 222  ADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFXXXXXXXXX 281
             D   +   Y PA  LGLLLNILDALSYGMIIFPITEP+FSHLGPTGLSMF         
Sbjct: 256  RDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVSTVICQL 315

Query: 282  XXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLP-GRDDEIITTTIFCYVISSMLTGL 340
                G SSFPS IGSEMIE+TPFFHTMAL+I  ++P G D+++I+TTI CY +SS++TGL
Sbjct: 316  CFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTTIVCYALSSIITGL 375

Query: 341  TFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSD 400
            TF+ LGK+ LGKIVGFFPRHILIGCIGGVGYFL++TG+EV TRV +F+YS  FL+SLF+D
Sbjct: 376  TFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQFLSSLFTD 435

Query: 401  WATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSG 460
            +  L KW             Q    NSLVLPSFYI+TL+LFHF+VA++PSL+L++LRD G
Sbjct: 436  FDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSLDKLRDFG 495

Query: 461  WIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHL 520
            WIF    +   WYD YKL+DFK V W+L+ KQ+PTMLALTFFGILHVPINVPALAMSL++
Sbjct: 496  WIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPALAMSLNV 555

Query: 521  DKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMF 580
            DKYDVDKELIAHG SN ISG +GSIQNYLVYTNSVLFIRAGADS +AG +L I T IVM 
Sbjct: 556  DKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMV 615

Query: 581  IGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLG 640
            IGPVIISFIPICIVGSLIFLLGYEL+ EA+ D WGK+  FEY+TI IIV+TMG+ DFV+G
Sbjct: 616  IGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMGVVDFVIG 675

Query: 641  IIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNL 700
            IIVGIL+ACFSFL++ST+LQTINGEYDG VAKSTVYRD IQ+KFL  IGEQIYVLKLQN+
Sbjct: 676  IIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNI 735

Query: 701  LFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQ 760
            LFFGTIISIEEK++ LLEIC  DSS+ RIKYLILDFKNI A +IDYSAAEGFNRIKRF +
Sbjct: 736  LFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYSAAEGFNRIKRFLE 795

Query: 761  TKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKS 820
             ++I L+ISSI + D IY AFD V L + VELF+DLN ALEWCENEFL +YK++R K ++
Sbjct: 796  KERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRA 855

Query: 821  RLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMS-LPINTPRNHQILSVAQNVFQ 879
            R                         K + L   +N MS LP+NTPRNHQ +S  +N++ 
Sbjct: 856  R-------------------------KLAQLKKSQNRMSKLPVNTPRNHQFVSEVRNIY- 889

Query: 880  NEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLP 939
             EE  ++ L  ELK++  FLP+ L +++++R  I S ++  + NE+  W +L  YF +  
Sbjct: 890  TEEMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLISYFQQKK 949

Query: 940  LASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNESTLKTLTI 999
                + + H NN+F +VE+G+L  T +L QG  YETMS +T YG I+  +++     ++I
Sbjct: 950  FPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVISNVNSDPL--AVSI 1007

Query: 1000 RAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVS 1051
              + + +L  ID+ SL  ++  + ELFTEL +L+MA+  +RF+ELLGY+L+S
Sbjct: 1008 TTDTECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1027 (50%), Positives = 674/1027 (65%), Gaps = 87/1027 (8%)

Query: 49   YMGRSYVSGFLSVSPALM----GSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAI 104
            Y+GRSYV  F S S +LM    G+   D   LP   +         +H    LH+QTAA+
Sbjct: 53   YLGRSYVGSF-SNSGSLMSREAGAAGPDSPPLPRFRDQASSY----VHNGSHLHRQTAAL 107

Query: 105  SEDFEDDEDDTRIKDYITLFQGEDNGLMADKNDSLDQ----RLGLGQ------DEEAEED 154
                    DD+R  D       E+  L+ + N  L +    R G+G       D    E 
Sbjct: 108  C-------DDSRAYDG---GPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEV 157

Query: 155  FIEPVAEAADVDES-----SRLLISPLSSNINPNIDDLLPTVTGEDVSSYQSI--YRTAT 207
             +  V EA D  +S     +RL +SP               +T + + SY +I   ++A+
Sbjct: 158  LLN-VDEAVDDSDSDQEAGTRLFLSP---------------ITTDYIHSYGAINEEQSAS 201

Query: 208  PSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPT 267
             + SR +ET    +  +  + + Y+PA +LGLLLNILDALSYGMIIFPI EPIFSHLGP 
Sbjct: 202  ETASR-AETGPSPLRLWGTRTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPH 260

Query: 268  GLSMFXXXXXXXXXXXXXGWSSFPSGIGSEMIEVTPFFHTMALAIKETLPG-RDDEIITT 326
            GLSMF             G+SSF  G GSEMIEVTPFFHTMAL+IK +L   + D+IITT
Sbjct: 261  GLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITT 320

Query: 327  TIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAK 386
            TI CY +S+++TG  F +LGKL LGK+V FFP HILIGCIGGV YFL++TGIEV+TRV K
Sbjct: 321  TIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTK 380

Query: 387  FEYSIPFLASLFSDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPSFYILTLILFHFIVA 446
            FEYS+ FL +LF D   L KW             QR   NS++LP FY+    LFHFIVA
Sbjct: 381  FEYSLAFLRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVA 440

Query: 447  IIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILH 506
            +IPSL+L+ LRD GWIFP+  S  +WYD+ +L++ +++HW LV  +IPTMLALTFFGILH
Sbjct: 441  LIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILH 500

Query: 507  VPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAM 566
            VPINVPALA+S  +DK DVDKELIAHG SN  SG  GSIQNYLVYTNSVLFIRAGADS  
Sbjct: 501  VPINVPALAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRY 560

Query: 567  AGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIV 626
            AG++L I T + M  GP IIS IP+CIV SLIFLLGYELL E L+D + ++SNFEYIT+V
Sbjct: 561  AGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVV 620

Query: 627  IIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLN 686
            II+LTMGIFDFVLGIIVG+L+ACFSFL++ST+ +TI+ E+DG VAKS  +RD +Q+ FL 
Sbjct: 621  IIILTMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLE 680

Query: 687  GIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILDFKNINADNIDY 746
             + EQIYVLKLQN LFFGTIISIEEKI  LLE    +  ++ IKYLILDFK+IN DNIDY
Sbjct: 681  KVAEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKKI-IKYLILDFKHINIDNIDY 739

Query: 747  SAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENE 806
            SAAEGFNRIKR  + K+I+L++SSI E D IY  F  +GLL+ VELF DLNSALEWCENE
Sbjct: 740  SAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENE 799

Query: 807  FLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIPRNLMSLPINTPR 866
             L +Y+ L     SR HR ++                   ++S   +P+  + L  NTPR
Sbjct: 800  LLCEYRSLL----SRAHRVKV------------------RRRSKDIVPKAQIPLE-NTPR 836

Query: 867  NHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGIISTDKTVKEN-EI 925
            N QI++ AQ V+  E+Q  K L ++ K   P L LLL  LK YR G        KE  EI
Sbjct: 837  NAQIMTAAQAVYSGEQQLNKTL-SKYKASHPALALLLVALKTYRSG-----HAYKETKEI 890

Query: 926  KFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKI 985
            + W  LCPYFV+   + Q+++    ++FF+VE+G+LK T+ LPQG++ E ++++TCYG I
Sbjct: 891  RLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNI 950

Query: 986  TGQHNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELL 1045
            +G  + S   +  +R E + +LW+ID+  L K++ EN  L+TEL ++ ++V  +RFKELL
Sbjct: 951  SGPGSLS--YSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELL 1008

Query: 1046 GYTLVSA 1052
            G++L++ 
Sbjct: 1009 GHSLING 1015

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 132/289 (45%), Gaps = 31/289 (10%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYIL--IILTAIVMFIGP 583
           ++EL+A G  N  +  +G++  +  Y  S +   +GA + M+G  +  I+L  +  F+  
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 584 VIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEY---ITIVIIVLTMGIFDFVLG 640
             I +IP+CI+  +  ++G  LL EA  D     ++  Y   +   + VLT   +   +G
Sbjct: 445 --IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMG 502

Query: 641 IIVGILIACFSFLIDSTK--LQTI-----NGEY---DGTVAKSTVYRDLIQTKFLNGIGE 690
           + +G   +  S +  S K  +Q +      G++   D  ++ +T   DL   + L G   
Sbjct: 503 VCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG--- 559

Query: 691 QIYVLKLQNLLFFGTIISIEEKIDELLE----ICHKDS--SRLR--IKYLILDFKNINAD 742
              V+K+   L F  +  ++E++  L      I H  +  SR R  IKYL+ D   +   
Sbjct: 560 -CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF- 617

Query: 743 NIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVE 791
            +D SAA+    I +    +++++ ++ +   + +    +   +L  VE
Sbjct: 618 -MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 123/287 (42%), Gaps = 25/287 (8%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N +    G++ ++  Y  S +   +GA S M+G  + I+T I M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGI 645
           + +IP C++  +  ++G  LL E   D    +    Y  + +  +T G+   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 646 LIACFSFLIDSTKLQT-----INGEYDGTVAKSTVYRDLIQTKFLNGIG--------EQI 692
            I C   +++  K        I     GT +  T   D ++T   N +G        E  
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGT-SNFTNLDDYLRTMKKNPLGGENRLEEVEGC 575

Query: 693 YVLKLQNLLFFGTIISIEEKIDELLEI----CHKDSSRLR----IKYLILDFKNINADNI 744
            ++++   L F     +++++D +        H      R    IKY+I D   + +  I
Sbjct: 576 MIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--I 633

Query: 745 DYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVE 791
           D SAA+  + I    + + + + ++++   D I       G++  +E
Sbjct: 634 DSSAAQVLDEIITSYKRRNVFIYVANVSINDKIRTRLLKAGVIPNLE 680

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 125/573 (21%), Positives = 216/573 (37%), Gaps = 69/573 (12%)

Query: 314 ETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFL 373
           ETL   D  + T  I   +  S ++GLT    G   LG +     + +L G I  +G+ +
Sbjct: 156 ETLTSHDLSLETVDIATMI--SFMSGLTLLFGGIFRLGFLGNILSKALLRGFISSIGFVM 213

Query: 374 LVTGIEVTTRVAKF------EYSIPFLASLF------------SDWATLWKWXXXXXXXX 415
           +V  +    ++ K        Y  PF   LF            + + +L  +        
Sbjct: 214 IVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYGPSNYHLPTSFLSLAVFTTLMTIRI 273

Query: 416 XXXXXQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDH 475
                 R  K  + +P   IL++++F  +++      +  L+    I  I   N+  +D 
Sbjct: 274 FKKKMMRRIKWIVFIPE--ILSVVIFSIVLSY-----MCDLKKKYDISVIGDFNTDGFDD 326

Query: 476 YKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKY-----DVDKELI 530
           ++     K +  L+       L     G L       ++  S  L  Y       ++EL+
Sbjct: 327 FR-NPLSKCNRGLIPALRDVSLVSALLGFLE------SITASKSLGGYGNTVASSNRELV 379

Query: 531 AHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI-VMFIGPVIISFI 589
           A GL N I  A G I  +  Y  S +   +GA + MAG  +  +T   + F+ PVI  +I
Sbjct: 380 ALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVI-HYI 438

Query: 590 PICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIAC 649
           P C++  +   +G  LL EA  D    I    Y  +++ VLT     F   I  GIL  C
Sbjct: 439 PTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFGILAGC 497

Query: 650 FSFLIDSTK---------LQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQ---IYVLKL 697
              LI   K         L  + G      A   +  DL          E      V+K+
Sbjct: 498 TYSLISIVKHSAQSRIQILARVEGTDHFINANEYLQLDLDSDNCSAPDIEHFEGCLVVKI 557

Query: 698 QNLLFFGTIISIEEKIDELLEI----CH---KDSSRLRIKYLILDFKNINADNIDYSAAE 750
              L F     ++E++D L        H   K      I+Y+I D   +    +D SA +
Sbjct: 558 PEPLTFTNTEDLKERLDRLERFGSTKAHPGMKSEGGSSIEYIIFDLHGMTF--MDSSATQ 615

Query: 751 GFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVG---LLKGVELFNDLNSALEWCENEF 807
               I    + + + + ++ +     + +     G   L++  E+    N +L+  +  +
Sbjct: 616 ILKDIVVEYRKRDVVVFLARVPPNLEVRERLKESGINDLVQKQEVKQHSNHSLQSAQTPY 675

Query: 808 LFKYKQ---LRDKAKSRLHRKQIIDINASIGSQ 837
                +   + D  K+R   +QI+  + SI S 
Sbjct: 676 FPNIAEALSMVDNLKARTRSQQILRTSPSISSS 708

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 113/574 (19%), Positives = 222/574 (38%), Gaps = 96/574 (16%)

Query: 295 GSEMIEVTPFFHTMALAIKETLPG-----------------RDDEIITTTIFCYVISSML 337
           G   +  TPFF+ +  ++ + + G                 R D  +++   C +I+  +
Sbjct: 144 GLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FI 202

Query: 338 TGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKF------EYSI 391
           +G+  ++ G    G +     R  L G I  VG  +++  + V  ++ K        Y  
Sbjct: 203 SGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHS 262

Query: 392 PFLASLF------------SDWATLWKWXXXXXXXXXXXXXQRCFKNSLVLPS--FYILT 437
           PF   LF            +   +L  +              + F++ +  P     ++T
Sbjct: 263 PFEKVLFLIKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLVVVT 322

Query: 438 LILFHF-----------IVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHW 486
           +I F +           +V  I +   ++LR+     P++ +   +Y       F     
Sbjct: 323 VIFFSYNFDLKHRYNIEVVGDIEASVFDKLRN-----PLSKNKRPFYGDLFSAGF----- 372

Query: 487 TLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQ 546
                    M+A+   G         +L  +  L     ++EL+A G  N I    G++ 
Sbjct: 373 ---------MVAM--LGFFESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGALP 420

Query: 547 NYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELL 606
           ++  Y  S +   +GA + ++G  +  +T   +      I +IP+C++  +  ++G  LL
Sbjct: 421 SFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLL 480

Query: 607 VEALWDPWGKISNFEY---ITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQ-TI 662
            EA  D    I    Y   I+ +I VLT   +    GI VG   +    +  STK +  I
Sbjct: 481 EEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQI 540

Query: 663 NGEYDGT----VAKSTVYRDLIQTKFLNGIGEQI---YVLKLQNLLFFGTIISIEEKIDE 715
            G+  GT     A     ++    + +N   E+I    ++++   L F     ++ +++ 
Sbjct: 541 LGKLAGTNKFVNADEYEGKNSTSERRVNPQLEEIEGCLIVRIPEPLTFTNTDDLKTRLNR 600

Query: 716 LLEI-----CHKDSSRLR----IKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQL 766
            LE+      H  + R R     KY+I D   +    ID SA +    I    + + + +
Sbjct: 601 -LELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMT--TIDSSAIQILQEIISSYKRRHVHV 657

Query: 767 LISSIKERDHIYKAFDNVGLLKGVELFNDLNSAL 800
            +  +     +   F N G+L+ VE  +D++ +L
Sbjct: 658 FLVRVPSARKVRNRFVNSGILEMVE--SDIHRSL 689

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 94/204 (46%), Gaps = 9/204 (4%)

Query: 521 DKYDVD----KELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTA 576
           +K+D+D    +EL++ GL N +S    ++  +  Y  S L I   A + MAG ++ +   
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 577 IVMFIGPVIISFIPICIVGSLIFLLGYELLVEA---LWDPWGKISNFEYITIVIIVLTMG 633
             M        ++P+C++  +I  + Y LL E    L+  W      E +T V +V+T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 634 IFDFVLGIIVGILIACFSFLIDSTKLQT-INGEYDGTVAKSTVYRDLIQTKFLNGIGEQI 692
           ++    G+ +G+ +     L  +T+ +  I G    T     +Y +  +   L  I E+ 
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-EKT 519

Query: 693 YVLKLQNLLFFGTIISIEEKIDEL 716
            V+K+   L F  +  +++++  L
Sbjct: 520 MVIKIPEPLIFSNVSDLKKRLSRL 543

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 123/287 (42%), Gaps = 34/287 (11%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI-VMFIGPV 584
           ++EL+A G  N +    G++ ++  Y  S +   +GA + M+G  + ++T   + F+ PV
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 585 IISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEY---ITIVIIVLTMGIFDFVLGI 641
           I  + P+CI+  +  ++G  LL EA  D    I    Y   I   +I +T  I     GI
Sbjct: 444 I-HYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGI 502

Query: 642 IVGIL--------------IACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNG 687
            VG +              I   + +I + +   ++G Y G     T+  DL ++  L  
Sbjct: 503 SVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPGL---KTI--DLRESSALEE 557

Query: 688 IGEQIYVLKLQNLLFFGTIISIEEKIDELLEI----CHKDS----SRLRIKYLILDFKNI 739
           + +   ++K+   L F     ++E+++ L        H       +R  IKY+I +   +
Sbjct: 558 LDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGM 617

Query: 740 NADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGL 786
            +  +D SAA+    I +  + + + +    +     I     + G+
Sbjct: 618 TS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDAGI 662

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 126/293 (43%), Gaps = 32/293 (10%)

Query: 523 YDVD----KELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI- 577
           +D+D    +EL++ GL N +     S+  +  Y  S L I  GA + MAG I + L+AI 
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAG-IFVSLSAIF 401

Query: 578 VMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDP---WGKISNFEYITIVIIVLTMGI 634
            M     +  ++P+CI+  +I  + Y LL E   D    W      E IT   +VL+  I
Sbjct: 402 CMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLI 461

Query: 635 FDFVLGIIVGILIACFSFLIDSTKLQ-TINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIY 693
           +    G+++G+ +     L  +T+ +  I G+   T     +Y +  +   L  I E+  
Sbjct: 462 WSPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKTM 520

Query: 694 VLKLQNLLFFGTIISIEEKIDEL-----LEICHKDSSRLR-------------IKYLILD 735
           V+K+   L F  +  + +K+  L     L +     + LR             +KY+I+D
Sbjct: 521 VIKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMD 580

Query: 736 FKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLK 788
              +    ID SA +    +      + I ++      RD +   FD  G+ +
Sbjct: 581 L--LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD-LKNKFDKSGITR 630

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 128/296 (43%), Gaps = 29/296 (9%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI-VMFIGPV 584
           ++ELIA G  N +      +  +  Y  S +   +GA + M+G+ + ++T   + F+ P 
Sbjct: 377 NRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLP- 435

Query: 585 IISFIPICIVGSLIFLLGYELLVEALWD---PWGKISNFEYITIVIIVLTMGIFDFVLGI 641
           II +IP+CI+  +  ++G  LL EA  D    W +   +  +T+  + L   +F     +
Sbjct: 436 IIRYIPVCILSVITTVVGLTLLEEAPHDLKFHW-RCKGYSELTVFTVTLLATLF---YSL 491

Query: 642 IVGILIACFSFLIDSTKLQT-----INGEYDGTVA--KSTVYRDLIQTKFLNGIGEQI-- 692
             GI I C   +I+  K        I G   GT     +  Y+      F+N   E+I  
Sbjct: 492 EAGIYIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEIEG 551

Query: 693 -YVLKLQNLLFFGTIISIEEKIDELLE----ICHKDSSRLRIKYL----ILDFKNINADN 743
             ++K+   L F     ++ ++  L +    + H  + R R K +    I D K +   +
Sbjct: 552 FLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT--H 609

Query: 744 IDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSA 799
           ID SAA+    I      + + + ++++   + + +     G+ +  E     NS+
Sbjct: 610 IDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKVRERLVTSGVAELCERNTITNSS 665

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 7/127 (5%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGY---ILIILTAIVMFIG 582
           ++EL+A G  N  S  +GS+  +  Y  S +   +GA + M+G    +L++LT  + F+ 
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLT--IKFLL 450

Query: 583 PVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGII 642
           P +I +IPIC++  +  ++G  LL EA  D       F Y  +++  LT+ +      + 
Sbjct: 451 P-MIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTV-LTTMFYSVE 508

Query: 643 VGILIAC 649
           VGI I C
Sbjct: 509 VGICIGC 515

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/285 (20%), Positives = 122/285 (42%), Gaps = 22/285 (7%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N +    G++ ++  Y  S +   +GA S ++G  + ++T I M +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGI---FDFVLGII 642
           + +IP C++  +  ++G  LL E   D    +    Y  + +  +T G+   +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 643 VGILIACFSFLIDSTKLQ-TINGEYDGTVAKSTVYRDLIQTKFLNGIG-------EQIYV 694
           +G + +  + +  S K +  I     GT +  T   D +     N +        E   +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARVAGT-SNFTNLDDYLMNMKRNPLSIENTEEIEGCMI 576

Query: 695 LKLQNLLFFGTIISIEEKIDELLEI----CHKDSSRLR----IKYLILDFKNINADNIDY 746
           +++   L F     +++++D +        H      R    IKY+I D   + +  +D 
Sbjct: 577 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDS 634

Query: 747 SAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVE 791
           SAA+  + I    + + + + ++++   D I       G++  VE
Sbjct: 635 SAAQVLDEIITSYKRRNVFIYLANVSINDKIRTRLSKAGVIPNVE 679

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 124/286 (43%), Gaps = 23/286 (8%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N      G++ ++  Y  S +   +GA S M+G  + I+T I M +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGI---FDFVLGII 642
           + +IP C++  +  ++G  LL E   D    +    Y  + +  +T G+   +    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 643 VGILIACFSFLIDSTKLQ-TINGEYDGTVAKSTVYRDLIQTKFLN-----GIGEQI---Y 693
           +G + +  + +  S K +  I     GT +  T   D ++T   N     G  E+I    
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARIAGT-SNFTNLDDYLRTTKKNPPAVEGRIEEIEGCM 576

Query: 694 VLKLQNLLFFGTIISIEEKIDELLEI----CHKDSSRLR----IKYLILDFKNINADNID 745
           ++++   L F     +++++D +        H      R    IKY+I D   + +  ID
Sbjct: 577 IVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--ID 634

Query: 746 YSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVE 791
            SAA+  + I    + + + + ++++   D I       G+   VE
Sbjct: 635 SSAAQVLDEIISCYKRRNVFIYLANVSINDKIRTRLLKAGVTPNVE 680

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 121/287 (42%), Gaps = 26/287 (9%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N +    G++  +  Y  S +   +GA S M+G  + ++T I M +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDP--WGKISNFEYITIVIIVLTMGIFDFVLGIIV 643
           + +IP C++  +  ++G  LL E   D     +   F  + +  +     IF     I  
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIF---YSIEA 524

Query: 644 GILIACFSFLIDSTKLQTING-EYDGTVAKSTVYRDL------IQTKFLNGIG----EQI 692
           GI I C   +I+  K    +  +    VA ++ + +L      ++   L+  G    E  
Sbjct: 525 GICIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGC 584

Query: 693 YVLKLQNLLFFGTIISIEEKIDELLEI----CHKDSSRLR----IKYLILDFKNINADNI 744
            ++++   L F     +++++D +        H     LR    IKY+I D   + +  I
Sbjct: 585 MIVRIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--I 642

Query: 745 DYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVE 791
           D SAA+    I    + + + + + ++   D + +     G+   VE
Sbjct: 643 DSSAAQVLEEIITSYKRRNVFIYLVNVSINDKVRRRLFKAGVAASVE 689

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 123/284 (43%), Gaps = 28/284 (9%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N I+   G++ ++  Y  S +   +G+ + M+G  +  +T I +     +
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNF------EYITIVIIVLTMGIFDFVL 639
           I +IP+CI+  +  ++G  LL EA   P     +F      E     I VL   ++   +
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEA---PSELKFHFRCKGYDELFVFAITVLATLLYSVEM 508

Query: 640 GIIVGILIACFSFLIDSTKLQ-TINGEYDGTVAKSTV--------YRDLIQTKFLNGIGE 690
           GI +G   +  S +  S K +  I G   GT   + +          D+   KF+    E
Sbjct: 509 GICIGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIE 568

Query: 691 QIYVLKLQNLLFFGTIISIEEKIDELLEICHKDS--------SRLRIKYLILDFKNINAD 742
              ++K+   L F     ++E+++ L       +        S+   K +I D   + + 
Sbjct: 569 GCLIVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS- 627

Query: 743 NIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGL 786
            ID SA + F  I    + +K+++ ++ + +   I +  +  G+
Sbjct: 628 -IDSSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGV 670

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 124/302 (41%), Gaps = 26/302 (8%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N +    G++ ++  Y  S +   +GA + M+G  + ++T I        
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWD---PWGKISNFEYITIVIIVLTMGIFDFVLGII 642
           I  IPIC++  +  ++G  L  EA  D    +      E +T  I VLT   +    GI 
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPADLKFHFRCRGYNELLTFAITVLTTFFYSVEAGIT 507

Query: 643 VGILIACFSFLIDSTK-----LQTINGEYDGTVAKSTVYRDLIQTKFLNGIG--EQIYVL 695
           +G   +    + +ST+     L  I+G      A        + ++F   +   E   V 
Sbjct: 508 LGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNADEFYSASSLDSEFGPRLDHMEGCLVA 567

Query: 696 KLQNLLFFGTIISIEEKIDELLE----ICHKDSSRLRIKYL----ILDFKNINADNIDYS 747
           ++   L F     ++ +++ L        H  S R R K L    I D + +    ID S
Sbjct: 568 RIAEPLTFTNTEDLKSRLNRLENHGSVKTHPASPRSRDKDLTRNMIFDLEGMT--QIDSS 625

Query: 748 AAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSAL------E 801
           A++    I +    +K+++ ++ +    H+ +     G+   VE    LN+A        
Sbjct: 626 ASQILCEIVKSLTKRKVRVYLARVPRALHVRERLVASGVAGMVENNIPLNTASMGQPGDS 685

Query: 802 WC 803
           WC
Sbjct: 686 WC 687

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 112/275 (40%), Gaps = 24/275 (8%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL++ G+ N +S    ++  +  Y  S + I  GA +  +G  + +L  I M      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDP---WGKISNFEYITIVIIVLTMGIFDFVLGII 642
              +PICI+  +I  + + LL EA  D    W      E    +IIV+T  ++    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 643 VGILIACFSFLIDSTKLQT-INGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLL 701
           +G+ +     L  ST+ +  I G    T     +  D      L  I E++ V+K+   L
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPL 450

Query: 702 FFGTIISIEEKIDELLE-----------------ICHKDSSRLRIKYLILDFKNINADNI 744
            F  +  +   +  + +                 +    S ++ +KYL++D   +    I
Sbjct: 451 IFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YI 508

Query: 745 DYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYK 779
           D SA +    I      + I ++ +  K  D  +K
Sbjct: 509 DISALQALREIVDAYSRRNICVMFTRPKIPDLRHK 543

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 52/84 (61%), Gaps = 2/84 (2%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI-VMFIGPV 584
           ++EL+A GLSN +   +G++ ++  Y  S +   +G  + ++G  + + T + ++F+ PV
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPV 472

Query: 585 IISFIPICIVGSLIFLLGYELLVE 608
           I  +IP+CI+  +  ++G+ LL E
Sbjct: 473 I-HYIPVCILSVITTVIGFTLLEE 495

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 120/292 (41%), Gaps = 37/292 (12%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAI-VMFIGPV 584
           ++EL+A G  N +    G++  +  Y  S +   +G  + M+G  L  +T   + F  PV
Sbjct: 363 NRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPV 422

Query: 585 IISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVG 644
           + +  P C++  +  ++G  LL EA  D      +  Y  ++++ LT  I      + VG
Sbjct: 423 VHN-TPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTF-ITTIFYSVEVG 480

Query: 645 ILIACFSFLID------STKLQTIN--------------GEYDGTVAKSTVYRDLIQTKF 684
           I + C   +I        +++Q +               G +DG    +  + +      
Sbjct: 481 ICVGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGENNNNNTFFE----PL 536

Query: 685 LNGIGEQIYVLKLQNLLFFGTIISIEEKIDEL-------LEICHKD-SSRLRIKYLILDF 736
           L  + E   V+K+   L F     ++E++  L       +    +D  SR + KY+I D 
Sbjct: 537 LEDLDEDRLVVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRRDLRSRDKTKYIIFDL 596

Query: 737 KNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLK 788
             +    ID SAA+    I      +++ +    +  R  + + F+  GL K
Sbjct: 597 HGMTY--IDASAAQILLEIILAYNRRQVFVFFVRVPMRREVRQRFERSGLNK 646

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 1/124 (0%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G  N +    G++ ++  Y  S +   +GA + M+G  + ++T +        
Sbjct: 373 NRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNA 432

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGI 645
           I  IP+C++  +  ++G  L  EA  D         Y  ++I  LT+ +  F   +  GI
Sbjct: 433 IHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGI 491

Query: 646 LIAC 649
            + C
Sbjct: 492 TLGC 495

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 62/132 (46%), Gaps = 1/132 (0%)

Query: 523 YDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIG 582
           Y  ++ELIA G  N +    G++ ++  Y  S + + +G  + M+G ++ ++T +   + 
Sbjct: 374 YSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLL 433

Query: 583 PVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGII 642
             +I + P C++  +  ++G  LL E   D    I    Y  + +  LT  I      + 
Sbjct: 434 LPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTF-IATLSQSVE 492

Query: 643 VGILIACFSFLI 654
           +G+ + C   LI
Sbjct: 493 LGVTVGCIYSLI 504

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 526 DKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVI 585
           ++EL+A G+ N  +  +G + ++  Y  S +   +GA + M+G ++  +T + +      
Sbjct: 428 NRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAKTVMSGVVMGGITVLTIKFLLNY 487

Query: 586 ISFIPICIVGSLIFLLGYELLVEALWD---PWGKISNFEYITIVIIVLTMGIFDFVLGII 642
           I FIP C++  +  ++G  L+ EA  +    W +   +  + I  +     IF     + 
Sbjct: 488 IHFIPTCVLSVITTIVGLSLIEEAPGEVKFHW-RCKGYNELIIFFMTACGTIF---FSVE 543

Query: 643 VGILIAC 649
           VGI+I C
Sbjct: 544 VGIIIGC 550

>TDEL0B04650 Chr2 complement(827216..828358) [1143 bp, 380 aa] {ON}
           Anc_8.146 YGL185C
          Length = 380

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 766 LLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWC-------ENEFLFKYKQLRDKA 818
            L+ S + R  +   F +VG    ++L + L   + +C       ENE  + + +L D  
Sbjct: 188 FLVQSPRNRKCLILGFGSVGKQIALKLHHGLGMEVHYCRRSEPQKENEHGWTFHRLDDSL 247

Query: 819 KSRLHRKQIIDINASIGSQKYQFTAGNDKKSNLDIP 854
           KS+LH+  +I I A  G+Q+ Q     +  S+ D P
Sbjct: 248 KSQLHQFSVI-IVALPGTQETQHLIDKEFLSHCDGP 282

>Kwal_55.21831 s55 (996564..997244) [681 bp, 226 aa] {ON} YOR078W
           (BUD21) -  [contig 126] FULL
          Length = 226

 Score = 32.7 bits (73), Expect = 3.9,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 16/95 (16%)

Query: 95  EKLHKQTAAISEDFEDDEDDTRIKD---YITLFQGEDNGLMADKNDSLDQRLGLGQDEEA 151
           EK  KQ       F++ ++  RIK+   + +  + ++      K+DS D+ +     EE 
Sbjct: 76  EKRRKQNLR----FKEQQEQKRIKEMQEFESRLKAQEKIAAESKSDSSDEAI----PEEL 127

Query: 152 EEDFIEPVAEAADVDESSRLLISPLSSNINPNIDD 186
            EDF E + +     ES+R++  P   N N +IDD
Sbjct: 128 PEDFFEKLEQ----QESTRIVTKPKHVNFN-DIDD 157

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 905 TLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKAT 964
           TLK+YR   +ST    K   +   SQL   F KLPL+    L +   + ++    IL  +
Sbjct: 656 TLKKYREDCLSTKTFGKGRTLSAASQLSATFNKLPLSEMVLLCNEAIVLYMKALSILSKS 715

Query: 965 FNLPQGNIYETMSNRTCYGKI 985
             +     YE+   ++C  ++
Sbjct: 716 MQVTSNWWYESQE-KSCSLRV 735

>SAKL0H14102g Chr8 complement(1208344..1209660) [1317 bp, 438 aa]
           {ON} similar to uniprot|Q03984 Saccharomyces cerevisiae
           YDR179W-A Hypothetical ORF
          Length = 438

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 675 VYRDLIQTKFLNGIGEQIYVLKLQNLLF-------FGTIISIEEKIDELLEICHKDSSRL 727
           ++ +L++TKFLN     I  ++L+++LF        G +   EE+ + L + C +  SR+
Sbjct: 332 MFNNLLKTKFLNPQTISIMFIQLRHVLFPNDNRMGPGKVPPTEEEFELLKKQCEESISRV 391

Query: 728 RIKYLILDFKNINADNI 744
            I++ +     I  D+I
Sbjct: 392 CIRHRLYQLLGITDDDI 408

>TBLA0A10430 Chr1 (2564651..2567206) [2556 bp, 851 aa] {ON}
           Anc_5.272 YHR028C
          Length = 851

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 72/167 (43%), Gaps = 32/167 (19%)

Query: 421 QRCFKNSLVLPSFYILTLILFHFIV--AIIPSLTLNQLRDSGWIFP----------IAIS 468
           ++ FK+ L++PS  IL L+L+  IV   ++P LT  ++RD G +             A++
Sbjct: 28  KQFFKDGLLIPSM-ILVLLLWGTIVLLKVVPILTAQEIRDHGRLGSHRNFYNQNGGKALN 86

Query: 469 NSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVD-- 526
           +    D      F+ V     FK  P + +L +  +L    N   L M++  D Y V   
Sbjct: 87  SRHTKDGSLKISFENVR-NNTFK--PKLQSLQWLRVLDFETNDRGLFMTVSNDTYMVKSV 143

Query: 527 ------------KELIAHGLSNFISGAVGS--IQNYLVYTNSVLFIR 559
                       K++  HG +  I   V S  ++  L+ TNSV   R
Sbjct: 144 HDKEYCQILYQGKDITIHGTAYKIDSLVASPDLKRLLIRTNSVANWR 190

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,813,229
Number of extensions: 5023969
Number of successful extensions: 17741
Number of sequences better than 10.0: 113
Number of HSP's gapped: 18430
Number of HSP's successfully gapped: 117
Length of query: 1052
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 932
Effective length of database: 39,721,479
Effective search space: 37020418428
Effective search space used: 37020418428
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)