Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008503.486ON23023010181e-141
CAGL0I10604g3.486ON2112303553e-41
Skud_7.4373.486ON2302283477e-40
Suva_7.4143.486ON2302303312e-37
YGR126W3.486ON2302303295e-37
Smik_6.2223.486ON2302303112e-34
KNAG0B008503.486ON2252273051e-33
NDAI0G009803.486ON2342173042e-33
TDEL0D055403.486ON2162312884e-31
KAFR0C019203.486ON2232372815e-30
SAKL0F02904g3.486ON2221982388e-24
KLTH0F14696g3.486ON2191672258e-22
Kwal_55.212153.486ON1421451771e-15
Kpol_1017.103.486ON2341551786e-15
TPHA0D032503.486ON2192021461e-10
KLLA0E04709g3.486ON1661661396e-10
AFR322C3.503ON592531145e-06
KLLA0E03829g3.503ON609611041e-04
TBLA0D029003.503ON691921041e-04
CAGL0I10384g3.503ON630991031e-04
Kwal_47.189193.503ON640105978e-04
KLTH0G02266g3.503ON64455960.001
KNAG0B007303.503ON62262960.001
YPR156C (TPO3)3.503ON62253920.003
Skud_16.4503.503ON62253910.004
TDEL0D057103.503ON61654900.006
KAFR0C020303.503ON62454900.006
TPHA0D033103.503ON61354880.009
Smik_16.4083.503ON62253880.012
Suva_16.4843.503ON62253870.014
Smik_6.2333.503ON61454870.015
NDAI0I027703.503ON62634850.021
NCAS0E007503.503ON62034850.023
Suva_7.4253.503ON61362840.028
NCAS0F036203.503ON63435830.044
SAKL0F02442g3.503ON61053830.045
Kpol_1017.33.503ON62158830.049
YGR138C (TPO2)3.503ON61454820.057
Skud_7.4483.503ON61154810.074
NCAS0H016905.341ON28093760.26
ZYRO0G14102g8.836ON24059711.1
ZYRO0G19646g3.503ON59434649.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00850
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   396   e-141
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   141   3e-41
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   138   7e-40
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   132   2e-37
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   131   5e-37
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   124   2e-34
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   122   1e-33
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   121   2e-33
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   115   4e-31
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   112   5e-30
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...    96   8e-24
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...    91   8e-22
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    73   1e-15
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    73   6e-15
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    61   1e-10
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    58   6e-10
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    49   5e-06
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    45   1e-04
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    45   1e-04
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    44   1e-04
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    42   8e-04
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    42   0.001
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    42   0.001
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    40   0.003
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    40   0.004
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    39   0.006
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    39   0.006
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    39   0.009
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    39   0.012
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    38   0.014
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    38   0.015
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     37   0.021
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               37   0.023
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    37   0.028
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    37   0.044
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    37   0.045
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    37   0.049
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    36   0.057
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    36   0.074
NCAS0H01690 Chr8 complement(321743..322585) [843 bp, 280 aa] {ON...    34   0.26 
ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa] ...    32   1.1  
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    29   9.1  

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  396 bits (1018), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/230 (86%), Positives = 199/230 (86%)

Query: 1   MEHRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEH 60
           MEHRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEH
Sbjct: 1   MEHRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEH 60

Query: 61  TNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKK 120
           TNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKK
Sbjct: 61  TNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKK 120

Query: 121 ATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSHKS 180
           ATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE              GDDVVSHKS
Sbjct: 121 ATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRRGDDVVSHKS 180

Query: 181 QATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
           QATGKSQRSAQSLQAEKLNLAV                 GLKGFMNRLFD
Sbjct: 181 QATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  141 bits (355), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/230 (40%), Positives = 129/230 (56%), Gaps = 19/230 (8%)

Query: 1   MEHRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEH 60
           M +  +T+ T+++ ED+SSFSS+DSY+PEPFTG+ E T  +   RK T +   T +    
Sbjct: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGL-EHTKNENLSRKATNASQGTYM---- 55

Query: 61  TNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKK 120
                      D  TS+ S +TL++ DS AIE+V+T NA  GN+ET+ SL AKGLD+ +K
Sbjct: 56  -----------DDATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRK 104

Query: 121 ATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSHKS 180
           A  D NAPLT+   +  FPEEY LET+TGLVK KT+E               D     KS
Sbjct: 105 AIPDYNAPLTTTGTN-QFPEEYRLETDTGLVKMKTLE--TLKRKSTQVSRNSDLSSKDKS 161

Query: 181 QATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
            +  +S +S  S  A+K+N+AV                 G+KGF +R+FD
Sbjct: 162 ISKSQSNKSEVSDIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  138 bits (347), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 93/228 (40%), Positives = 133/228 (58%), Gaps = 8/228 (3%)

Query: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTA-YKGTDRKDTLSGDETELKQEHTNATA 65
           + +T++++ED+SSFSSIDSY+PEPFTG K+  A  +   + DT+ G      +E+ +   
Sbjct: 7   SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEENID--- 63

Query: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125
              H    + S  S STL+RP SN+IE++IT NA EGN+ET  SL  +GL+LNKKA  DI
Sbjct: 64  -EQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALPDI 122

Query: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIE---XXXXXXXXXXXXXXGDDVVSHKSQA 182
            AP+T++  + AFPEEY LETETGLVK KT+E                  D   +H +++
Sbjct: 123 TAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRS 182

Query: 183 TGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
              +     SL+++KLN+AV                 G+KGF +R+FD
Sbjct: 183 KVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  132 bits (331), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/230 (42%), Positives = 135/230 (58%), Gaps = 12/230 (5%)

Query: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTA-YKGTDRKDTLSGDETELKQEHTNATA 65
           + +T++++ED+SSFSSIDSY+PEPFTG K+  A  +   + DT+ G      Q   + + 
Sbjct: 7   SVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGK----GQSENDDSV 62

Query: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125
              H    + S  S STL+RP SN+IE+++T NA EGN+ET+ SL  +GL+LNKK T DI
Sbjct: 63  DDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTPDI 122

Query: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGD-----DVVSHKS 180
            AP+T++  D AFPEEY LETETGLVK KT+E                     D  S +S
Sbjct: 123 TAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHSTRS 182

Query: 181 QATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
           +AT  SQ S  SL+++KLN+AV                 G+KG  +R+FD
Sbjct: 183 KATAYSQGS--SLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  131 bits (329), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 133/230 (57%), Gaps = 12/230 (5%)

Query: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTA-YKGTDRKDTLSGDETELKQEHTNATA 65
           T +T++++ED+SSFSSIDSY+PEPFTG K+  A  +   + DT+ G      Q   ++  
Sbjct: 7   TVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGK----GQLEDDSNV 62

Query: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125
              H    + S  S STL+RP SN+IE+++T NA EGN+ET+ SL   GL+LNKKA  DI
Sbjct: 63  DDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDI 122

Query: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGD-----DVVSHKS 180
            AP+T++  D AFPEEY LETETGLVK KT+E                     D+ S +S
Sbjct: 123 TAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRS 182

Query: 181 QATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
           + T  SQ S  SL+  KLN+AV                 G+KGF +R+FD
Sbjct: 183 KVTTNSQGS--SLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  124 bits (311), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/230 (41%), Positives = 128/230 (55%), Gaps = 12/230 (5%)

Query: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAY-KGTDRKDTLSGDETELKQEHTNATA 65
           T +T++++ED+SSFSSIDSY+PEPFTG K+     +   + DT+ G      Q   +   
Sbjct: 7   TVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGK----GQSENDDIL 62

Query: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125
              H    + S  S STL+RP SN+IE+++T NA EG +ETL SL   GL+L KKA  DI
Sbjct: 63  DDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALPDI 122

Query: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIEX-----XXXXXXXXXXXXXGDDVVSHKS 180
            AP+T++  D  FPEEY LETETGLVK KT+E                     D+ S +S
Sbjct: 123 TAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRS 182

Query: 181 QATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
           + T  SQ S  SL+  KLN+AV                 G+KGF +R+FD
Sbjct: 183 KVTTNSQGS--SLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  122 bits (305), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/227 (37%), Positives = 119/227 (52%), Gaps = 18/227 (7%)

Query: 10  TEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKD---TLSGDETELKQEHTNATAT 66
           T+ +F++VSSFSS+DSY+PEPF G        GT+ +     L  ++T L  E  +    
Sbjct: 9   TDPEFDEVSSFSSVDSYKPEPFVGF-------GTEEEQHDSRLFKNDTILNSE--DLAEN 59

Query: 67  SSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATL-DI 125
           +++T   + S+ S +TL + DSNAIERV+T NA    +E+  +L +KGLD  K+  + DI
Sbjct: 60  TANTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDI 119

Query: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXX---XXXXXXXGDDVVSHKSQA 182
           NAPLT   +   FPEEY +ETETGLVK KTIE                 G    S  S  
Sbjct: 120 NAPLTLTQSH--FPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLT 177

Query: 183 TGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLF 229
           +   +     L AEKLN AV                 G+KGF++++F
Sbjct: 178 SSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  121 bits (304), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 112/217 (51%), Gaps = 23/217 (10%)

Query: 26  YQPEPFTGVKE---PTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGI----TSRT 78
           YQPEPFTG+K    P A   T          T  +Q+H + T  SSH+ D       SRT
Sbjct: 29  YQPEPFTGLKGNELPNAQPST--------TATTTEQDHDD-TVISSHSHDTKHGEEPSRT 79

Query: 79  SMSTLRRPDSNA--IERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADV 136
           S +TL++ DSN   IE+ +T+N     TETL SL  +GL+  KK+  DIN PL +  A+ 
Sbjct: 80  STATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNAGTAE- 138

Query: 137 AFPEEYNLETETGLVKAKTIEX-XXXXXXXXXXXXXGDDVVSHKSQATGKSQ--RSAQSL 193
            FPEEY +ETETGLVKAKTIE                 D  S KS  T  ++  R++ SL
Sbjct: 139 -FPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSL 197

Query: 194 QAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
              KLN+AV                 G+KGF NRLFD
Sbjct: 198 DPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  115 bits (288), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 107/231 (46%), Gaps = 44/231 (19%)

Query: 14  FEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTKDG 73
           F++VSSFSSIDSYQP+PFTG                   + EL QE    +++   +K G
Sbjct: 16  FDEVSSFSSIDSYQPQPFTG-------------------QEELPQEKNPDSSSRRSSKSG 56

Query: 74  ITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNP 133
                  +TL   DSN IE+ +T NA  G +ET  SL   GLD  KKA  DIN P+T N 
Sbjct: 57  -------TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAIPDINGPITGNA 109

Query: 134 ADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSHKSQATG--------- 184
               FPEEY +ET+TGLVK KT+               G   +S KS   G         
Sbjct: 110 DTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGK--ISRKSSGPGTIDSKIEPK 167

Query: 185 -----KSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
                  Q +AQ+  AE L  A+                 GLKGF++RLFD
Sbjct: 168 PDTAKAEQEAAQN--AENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  112 bits (281), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 112/237 (47%), Gaps = 30/237 (12%)

Query: 9   STEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDR-------KDTLSGDETE------ 55
           S E D ED+SSFSSI+SY+PEPF G  +  A + TD        KD  S    +      
Sbjct: 2   SIEQDVEDISSFSSIESYKPEPFVG--QGIARENTDELEFQSNLKDAQSHTSEKFQEEQV 59

Query: 56  --LKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAK 113
             LKQ  TN +  S  +    TSRTS   L++  S  IER++T NA  G  ET+ SL A 
Sbjct: 60  DPLKQVQTNDSFWSFRSVSN-TSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRAT 118

Query: 114 GLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGD 173
           GLDL K+A  DIN+P++    +    +E   ET+TGL+K KT+E                
Sbjct: 119 GLDLTKRAVPDINSPIS---HESKLIDESKFETDTGLIKTKTLETLNRSNTRNS------ 169

Query: 174 DVVSHKSQATGKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
              S K +  G    +   L  E++N+ V                 GLKGF  ++FD
Sbjct: 170 ---SSKRKILGNDNSNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score = 96.3 bits (238), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 101/198 (51%), Gaps = 7/198 (3%)

Query: 36  EPTAYKGTD---RKDTLSGD-ETELKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNAI 91
           EP A+ G D    + T+  + E E+  E  +      ++++ ++ R+S +TL++ DSNAI
Sbjct: 27  EPQAFTGADPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSS-NTLKKLDSNAI 85

Query: 92  ERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLV 151
           E+V+T NA EGNTETL SL  +GLDL KKA  D N P         FPEEY +ETETGLV
Sbjct: 86  EKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDRS-QFPEEYQIETETGLV 144

Query: 152 KAKTIEXXXXXXXXXXXXXXGDDVVSHKSQATGKSQRSAQSLQAEKLNLAVXXXXXXXXX 211
           K KT++                   + ++++    QR       EKL  AV         
Sbjct: 145 KVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDEQRPV-GYDEEKLKKAVDKNKKKIEK 203

Query: 212 XXXXXXXXGLKGFMNRLF 229
                   G+KGFM+RLF
Sbjct: 204 YQKHKHEKGIKGFMSRLF 221

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score = 91.3 bits (225), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 82/167 (49%), Gaps = 25/167 (14%)

Query: 79  SMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAF 138
           S  TLR+ DSNAIE+++T NA EG +ET+ SL   GL+L KKA  DIN P  +N  + AF
Sbjct: 63  SNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNP-AANYKNCAF 121

Query: 139 PEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSHKSQATGKSQRSAQS------ 192
           PEEY +ET+TGLVKA+T+               G    S K     KS R+A S      
Sbjct: 122 PEEYQMETDTGLVKAQTLH----GLNRLESRTSGRSGASQK-----KSIRTANSTTNSDL 172

Query: 193 ---------LQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLFD 230
                    L  EKL  AV                 GL+ F+ ++FD
Sbjct: 173 ASANNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 68/145 (46%), Gaps = 12/145 (8%)

Query: 95  ITSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAK 154
           +T NA EG +ET+ SL   GL++N+KA  D N P  +N  +  FPEEY LET+TGLVK +
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNP-AANFTNCEFPEEYQLETDTGLVKVQ 59

Query: 155 TIEXXXXXXXXXXXXXXGDDVVSHK---------SQATGKSQRSAQSLQAEKLNLAVXXX 205
           T++                   S +         S + G+S  S   L AEKL  AV   
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSG--LDAEKLRKAVEKN 117

Query: 206 XXXXXXXXXXXXXXGLKGFMNRLFD 230
                         GLK F+ ++FD
Sbjct: 118 KRQIDKYQKHKASGGLKKFLGKIFD 142

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 73.2 bits (178), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 81/155 (52%), Gaps = 28/155 (18%)

Query: 3   HRLSTTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTN 62
           +R ST S+  +FED+SSF S +S+ P+ F G                      L   + N
Sbjct: 9   NRNSTDSS--NFEDISSFDSQNSFAPQEFKG---------------------NLDSNNDN 45

Query: 63  ATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKAT 122
            T   + TK G TS T+  TL+   SN IE+++T NA E NTET+ +L      L+K  T
Sbjct: 46  DTGVFNKTKSG-TSETN--TLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPT 102

Query: 123 LDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
            ++      N A  AFPEEY +ET+TGLV  KT+E
Sbjct: 103 ENVLPATMENNA--AFPEEYRIETKTGLVPIKTLE 135

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 98/202 (48%), Gaps = 25/202 (12%)

Query: 6   STTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATA 65
           STT +E +F+DVSSF+S +SY P+ F G             DTL G E+  K +   A+ 
Sbjct: 9   STTDSE-NFDDVSSFNSDNSYTPQEFIG-------------DTL-GKESSTKMDD-RASH 52

Query: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDL-NKKATLD 124
            S   K+  +  +  +T++   SN + R+++ N  + N E+  +L  +  ++ +++A + 
Sbjct: 53  LSHAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRRADII 112

Query: 125 INAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSH----KS 180
           + A +  N     FPEEY +ET TGLV  KT+E                 V S     KS
Sbjct: 113 LPASMEGNSN---FPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKS 169

Query: 181 QATGKSQRSAQSLQAEKLNLAV 202
             T KS R+   L   KLN AV
Sbjct: 170 NNTVKS-RNEGGLNPAKLNAAV 190

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 58.2 bits (139), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 69/166 (41%), Gaps = 15/166 (9%)

Query: 64  TATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATL 123
           T  S H+   +  + S    +   +  +E  +  N ++G T+++ SL A  LDL+KKA  
Sbjct: 15  TKHSHHSMSSLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIP 74

Query: 124 DINAPLTSNPADVAFPEEYNLETETGLVKAKTIEXXXXXXXXXXXXXXGDDVVSHKSQAT 183
             N P+        FPEEY +ET TGLVK  T+                  V +H S+ +
Sbjct: 75  GFNQPIAEG---AEFPEEYEIETRTGLVKVATLHQLNRLDTR---------VTTHSSKKS 122

Query: 184 GKSQRSAQSLQAEKLNLAVXXXXXXXXXXXXXXXXXGLKGFMNRLF 229
            K + ++     +KL   +                 G K F+ +LF
Sbjct: 123 TKEKNTSCGYDNDKLQKCI---ERNQKEIDSYHKKSGFKKFIGKLF 165

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET+ SL   GL  ++K   D+NAP TS  A V FPEEY LET TGLVK  T+
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTS--AGVIFPEEYTLETPTGLVKIATL 94

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 96  TSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKT 155
           +SN K   TET  SL   GL  ++    D NAP TS   +  FPEEY LET TGLV   T
Sbjct: 40  SSNLKLVPTETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVAT 98

Query: 156 I 156
           +
Sbjct: 99  L 99

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 32/92 (34%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 65  ATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLD 124
           + S  ++D + S  +      P + +         K   TET+ SL   G+  +      
Sbjct: 32  SVSRQSRDDLQSSINSYLTTTPTNRSSNASTNQRLKLVKTETVKSLIDMGVS-SYIPNPA 90

Query: 125 INAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           INAP TS  A   FPEEY LETETGLV   T+
Sbjct: 91  INAPKTSKKA--IFPEEYTLETETGLVPVSTL 120

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 15/99 (15%)

Query: 67  SSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGN--------TETLGSLAAKGLDLN 118
           SS T   I S   + + ++P      + I SN K+GN        TET+ SL   G+  +
Sbjct: 11  SSETSQSINSDIDIESQQQP-----RQYIPSNEKDGNKERLHLTRTETVKSLQEMGMTQD 65

Query: 119 KKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
                D+NAP T+   +  FPEEY +ET TGLV   T++
Sbjct: 66  APIP-DVNAPQTTT-KNAIFPEEYTMETPTGLVPVATLQ 102

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 50/105 (47%), Gaps = 20/105 (19%)

Query: 54  TELKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAK 113
           T++ Q +  +TATS                RR  ++  +R+     +   TET+ SL   
Sbjct: 18  TQVPQTYVPSTATSGRDP------------RRSSASGSDRL-----RLVPTETVKSLQEM 60

Query: 114 GLDLNKKATL-DINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           G+    +A L D+NAP  +      FPEEY LET TGLV   T++
Sbjct: 61  GV--TPEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQ 103

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 104 TETLGSLAAKGLDLNKKATL-DINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G+    +A L D+NAP T       FPEEY LET TGLV   T++
Sbjct: 57  TETVKSLQDMGV--TPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQ 109

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 96  TSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKT 155
           T+  K   TET+ SL   G+  N     D+NAP T+    + FPEEY +ET TGLV   T
Sbjct: 43  TNKLKLVRTETVKSLQDMGMTKNAPIP-DVNAPQTAKKTAI-FPEEYTMETPTGLVPVAT 100

Query: 156 IE 157
           ++
Sbjct: 101 LQ 102

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET+ SL   G+  +K    D+NAP +S   +  FPEEY LET TGLV   T+
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSSK--NKIFPEEYTLETPTGLVPVATL 99

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET+ SL   G+  +K    D+NAP +S   +  FPEEY LET TGLV   T+
Sbjct: 50  TETVKSLQDMGVS-SKAPIPDVNAPQSSK--NKIFPEEYTLETPTGLVPVATL 99

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G+        D+NAP T+    + FPEEY +ET TGLV   T++
Sbjct: 45  TETVKSLQEMGMTATAPVP-DVNAPQTTARPQI-FPEEYTMETPTGLVPVATLQ 96

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G++    A  D+NAP ++   +  FPEEY +ET TGLV   T++
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAPQSNR--NAIFPEEYTIETTTGLVPVATLQ 102

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   GL  +     D+NAP TSN   + FPEEY +ET TGLV   T+ 
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAP-TSNKHSI-FPEEYTMETPTGLVPVATLH 95

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET+ SL   G+  +K    D+NAP +    +  FPEEY LET TGLV   T+
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAPQSGK--NKIFPEEYTLETPTGLVPVATL 99

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET+ SL   G+  ++    D+NAP +S   +  FPEEY +ET TGLV   T+
Sbjct: 50  TETVKSLQDMGVS-SRAPVPDVNAPQSSK--NKIFPEEYTIETPTGLVPVATL 99

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G+  N     DINAP T+   +  FPEEY +ET +GLV   T++
Sbjct: 45  TETVKSLQDLGVTSNAPVP-DINAPQTAK--NNIFPEEYTMETPSGLVPVATLQ 95

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 124 DINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           D+NAP TS   +  FPEEY +ET TGLV   T++
Sbjct: 71  DVNAPQTSA-RNTIFPEEYTMETTTGLVPVSTLQ 103

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 124 DINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           DINAP +S   +  FPEEY +ET TGLV   T++
Sbjct: 65  DINAPQSSK-KNAIFPEEYTMETTTGLVPVATLQ 97

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 96  TSNAKEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKT 155
           T+  K   TET+ SL   G+  +     DINAP T+   +  FPEEY +ET +GLV   T
Sbjct: 37  TNQLKLTKTETVKSLQDLGVT-SAAPVPDINAPQTAK--NNIFPEEYTMETPSGLVPVAT 93

Query: 156 IE 157
           ++
Sbjct: 94  LQ 95

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 3/35 (8%)

Query: 124 DINAPLTSN-PADVAFPEEYNLETETGLVKAKTIE 157
           DINAP  S  PA   FPEEY +ET TGLV   T++
Sbjct: 69  DINAPQGSKKPA--IFPEEYTMETPTGLVPVVTLQ 101

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 36.6 bits (83), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTI 156
           TET  SL   G+  ++    DINAP   N     FPEEY +ET TGLV   T+
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP--QNVKSPIFPEEYTMETPTGLVPVATL 93

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 100 KEGNTETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           K   TET+ SL   G+  ++     +NAP TS      FPEEY +ET TGLV   T++
Sbjct: 44  KLSRTETVKSLQDMGMT-SEAPIPGVNAPQTSRVQ--IFPEEYTMETPTGLVPVATLQ 98

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 36.2 bits (82), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G+  +     DINAP T+   +  FPEEY +ET +GLV   T++
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPQTAK--NNIFPEEYTMETPSGLVPVATLQ 95

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 104 TETLGSLAAKGLDLNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           TET+ SL   G+  +     DINAP T+   +  FPEEY +ET +GLV   T++
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAPKTAK--NNIFPEEYTMETPSGLVPVATLQ 95

>NCAS0H01690 Chr8 complement(321743..322585) [843 bp, 280 aa] {ON}
           Anc_5.341 YHR067W
          Length = 280

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 6/93 (6%)

Query: 55  ELKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKG 114
           ++ +EH        + K+GI     + TL   DSN  ER  T+   +   ET+G+   K 
Sbjct: 110 KINEEHFVCLKREINDKEGIPLLEELRTLIYTDSNPQERTTTTLITDSAGETIGTFNFKE 169

Query: 115 LDLNKKATLDINAPLTSNPADVAFPEEYNLETE 147
           +D+ + +       LT NP  + + ++Y   TE
Sbjct: 170 MDIIRYSQ------LTLNPHRIHWDKDYCRGTE 196

>ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa]
           {ON} some similarities with uniprot|P13483 Saccharomyces
           cerevisiae YML113W
          Length = 240

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 9/59 (15%)

Query: 13  DFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRKDTLSGDETELKQEHTNATATSSHTK 71
           D E + +   +++  PEP T    PT  KG           TE+ Q HTN     +HT+
Sbjct: 121 DLEAIDALRELNNSPPEPLTPTLTPTQSKGR---------HTEIVQNHTNEGPFVTHTR 170

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%)

Query: 124 DINAPLTSNPADVAFPEEYNLETETGLVKAKTIE 157
           D+ AP  +  A   FPEEY +ET +G+V    +E
Sbjct: 59  DVVAP--TYAAAPVFPEEYTMETPSGIVPLAQLE 90

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.122    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,642,991
Number of extensions: 742731
Number of successful extensions: 2466
Number of sequences better than 10.0: 145
Number of HSP's gapped: 2409
Number of HSP's successfully gapped: 151
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)