Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008403.487ON33633618020.0
NDAI0G009703.487ON33233110121e-137
Skud_7.4383.487ON3133258401e-111
YGR127W3.487ON3123258191e-108
Suva_7.4153.487ON3133258181e-108
KAFR0C019303.487ON3133178141e-107
Smik_6.2233.487ON3133248131e-107
CAGL0I10582g3.487ON3193177595e-99
SAKL0F02882g3.487ON2983147357e-96
KNAG0B008403.487ON3133187309e-95
KLLA0E04687g3.487ON3063186942e-89
TDEL0D055503.487ON3103176647e-85
Kpol_1017.93.487ON3103206309e-80
Kwal_55.212173.487ON3033216161e-77
KLTH0F14718g3.487ON3003125681e-70
Ecym_12423.487ON3113195648e-70
AFR305W3.487ON3093165561e-68
TPHA0D032603.487ON3143255491e-67
TBLA0D029903.487ON3183214979e-60
ZYRO0D10098g3.487ON2762704941e-59
CAGL0C05445g2.38ON111281731.7
Suva_10.5767.528ON30767668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00840
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   698   0.0  
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   394   e-137
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   328   e-111
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   320   e-108
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   319   e-108
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   318   e-107
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   317   e-107
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   296   5e-99
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   287   7e-96
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   285   9e-95
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   271   2e-89
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   260   7e-85
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   247   9e-80
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   241   1e-77
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   223   1e-70
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   221   8e-70
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   218   1e-68
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   216   1e-67
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   196   9e-60
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   194   1e-59
CAGL0C05445g Chr3 (517886..521224) [3339 bp, 1112 aa] {ON} simil...    33   1.7  
Suva_10.576 Chr10 (1008964..1009887) [924 bp, 307 aa] {ON} YLR45...    30   8.5  

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  698 bits (1802), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/336 (100%), Positives = 336/336 (100%)

Query: 1   MGNSSPQIKLINKQQTMCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPF 60
           MGNSSPQIKLINKQQTMCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPF
Sbjct: 1   MGNSSPQIKLINKQQTMCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPF 60

Query: 61  DMAKSCELHEKKIFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEH 120
           DMAKSCELHEKKIFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEH
Sbjct: 61  DMAKSCELHEKKIFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEH 120

Query: 121 DSDFNKWDTYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVS 180
           DSDFNKWDTYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVS
Sbjct: 121 DSDFNKWDTYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVS 180

Query: 181 NDMFATGGITVERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSV 240
           NDMFATGGITVERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSV
Sbjct: 181 NDMFATGGITVERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSV 240

Query: 241 QPKENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVK 300
           QPKENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVK
Sbjct: 241 QPKENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVK 300

Query: 301 LVEHILYTSDNDIQHYSSTNPKEVKSFEFKPNIQKN 336
           LVEHILYTSDNDIQHYSSTNPKEVKSFEFKPNIQKN
Sbjct: 301 LVEHILYTSDNDIQHYSSTNPKEVKSFEFKPNIQKN 336

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  394 bits (1012), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/331 (58%), Positives = 239/331 (72%), Gaps = 15/331 (4%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCILLATTAHP YELILISNRDEF +RKTH SCWHNDDFILSP+DMAK C+ ++KK+FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSD-FNKWDTYEKFDG 135
           W+GIN+D KIAT+LNLKL   L LKQLV P+SRGM+PFV+LS+   D F +WD Y+ F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 136 KYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVERA 194
           KY  L+ TGDFN FYGD    +YRI+DS GNT   L+ +  YL VSND+F   G   E  
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLVVSNDVFTCNGQLGELQ 180

Query: 195 SN-----------NRIAEWRKIKFGKILLQDLVEES--KSLDEDMLIEKCFKLASTCSVQ 241
           SN           ++I  W K+K G  LLQ LV +S  +  DED +I +CFKL+STCSV 
Sbjct: 181 SNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSSTCSVT 240

Query: 242 PKENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKL 301
            +++ KF+QNSTLP ETI VPPL C++ DD+GTSL +G+YYGTRSQIVILI +    VK 
Sbjct: 241 VEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTYEVKF 300

Query: 302 VEHILYTSDNDIQHYSSTNPKEVKSFEFKPN 332
            EH++YTSD+DI+ +S  NPKE   F+F  N
Sbjct: 301 AEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 214/325 (65%), Gaps = 24/325 (7%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHNDDFILSP+D+AK+ +  EK+IFGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSK--EKQIFGT 58

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W GINR+ K+ATILNLKL+ Q D    +K +SRG++PF FLS H +DF  WD Y+KF+  
Sbjct: 59  WSGINREGKLATILNLKLDGQRDT---IKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMN 115

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190
           Y+ L  TGDFNFFYGD +  +Y++IDS G TF VL        + Y+ VSN  F      
Sbjct: 116 YDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSI 175

Query: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQ 250
            E+A       W+K+K  +  L+ LV  +   DE+ +I  CF+LAS  SV P   +K N 
Sbjct: 176 SEQA-------WKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSV-PGTASKPNA 227

Query: 251 NSTLP-----METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305
              L      M TI+VPPL    +DD+G S+  G YYGTRSQIV+L+SKN  +V  +E I
Sbjct: 228 LQMLADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERI 287

Query: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330
           LY+SD D+ HYS   PKE K FEFK
Sbjct: 288 LYSSDEDVNHYSVATPKEEKRFEFK 312

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  320 bits (819), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 217/325 (66%), Gaps = 25/325 (7%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHN+DFILSP+D+AK+    EK+IFGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSA--EKQIFGT 58

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W GIN++ K+ATILNLKL+++   +   K +SRG++PF+FLS H +DF  WD Y+KF+G 
Sbjct: 59  WSGINKEGKLATILNLKLDNE---QNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGH 115

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190
           Y+ L+ TGDFNFFYGD +  +Y++IDS G TF VLS       D Y+ VSN  F      
Sbjct: 116 YDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSI 175

Query: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSV-----QPKEN 245
             +A       W K+K  +  L++LV E+   DE+ +I  CF+LAS  S+      P   
Sbjct: 176 PGQA-------WEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVL 228

Query: 246 TKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305
              + N T  M TI+VPPL     DD+G S+  G YYGTRSQIV+L+SK+  RV  +E +
Sbjct: 229 QMVDPNVT--MNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERV 286

Query: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330
           LY+SD D++ YS T+PKE K F+FK
Sbjct: 287 LYSSDEDVRKYSVTSPKEEKRFKFK 311

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  319 bits (818), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 213/325 (65%), Gaps = 24/325 (7%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+AT AHP YELILISNRDEF ERKTH +CWHNDDFILSP+D+AK+    EK+IFGT
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTS--MEKQIFGT 58

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W GIN++ K+ATILNLK++ Q   +   K +SRGM+PF FL+ H + F  WD Y KF+  
Sbjct: 59  WSGINKEGKLATILNLKMDDQ---RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKH 115

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190
           Y+ LR TGDFNFFYGD +   Y++IDS G+TF VL        D Y+ +SN  +      
Sbjct: 116 YDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSI 175

Query: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFN- 249
            E+A       W K+K  +  L+ L+ ++   DE+ LI  CF+LAS  S+ P    K + 
Sbjct: 176 SEQA-------WEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSL-PDTGLKPDL 227

Query: 250 ----QNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305
                +  + M TI+VPPL     DD+G S+  G YYGTRSQIV+L+SK+  +V  +E +
Sbjct: 228 LQMLVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERV 287

Query: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330
           LY+SD D+ HYS++ PKE K FEF+
Sbjct: 288 LYSSDEDVSHYSASAPKEEKRFEFE 312

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  318 bits (814), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 217/317 (68%), Gaps = 11/317 (3%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL AT +H +YELILISNRDE+  RKTH +CWHND+FILSP+DM++  E H  KIFGT
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSRE-ENHGNKIFGT 59

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSE---HDSDFNKWDTYEKF 133
           W+G+N+  KIATILNL+  S +DLK+LVKP+SRG+IPF FL     ++  F +W+T+EKF
Sbjct: 60  WLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKF 119

Query: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-SGDPYLTVSNDMFATGGITVE 192
             KY +L+ +GDFNFFYGD     YRIIDS GNTFKVL + +  + +SND++        
Sbjct: 120 KSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRNMIISNDLYQ------H 173

Query: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252
           +        W KIK G   L   ++E++  +ED ++ KCF+LAS CS+      + N N 
Sbjct: 174 KDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENPNK 233

Query: 253 TLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312
            L  ETI+VPPL+   ++DIG + + GKYYGTR+QIV+L+ K+ + V LVEH ++ SD +
Sbjct: 234 ELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293

Query: 313 IQHYSSTNPKEVKSFEF 329
           I  YS  NPKEV+  +F
Sbjct: 294 IYKYSGLNPKEVQRLDF 310

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 215/324 (66%), Gaps = 22/324 (6%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHNDDFILSP+D+A++ +  E + FGT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSK--EGQEFGT 58

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W GIN++ K+ATILNLKL S+   +  +K +SRG++P++FLS H+++F  WD+Y KF   
Sbjct: 59  WSGINKEGKLATILNLKLGSE---RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNH 115

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190
           Y+ L+ TGDFNFFYGD +  +Y++IDS G TF VLS       D Y+ +SN  F      
Sbjct: 116 YDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSI 175

Query: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCS----VQPKENT 246
            E+A       W K+K  +  L+DLV ++  LDE+ +I  CF+LAS  S    V   +  
Sbjct: 176 PEKA-------WEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVL 228

Query: 247 KFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHIL 306
           +   +  + M TI+VPPL     DD+G S+  G +YGTRSQIV+LISK+  +   +E I+
Sbjct: 229 QMLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERII 288

Query: 307 YTSDNDIQHYSSTNPKEVKSFEFK 330
           Y+SD D++ YS + PKE K FEF+
Sbjct: 289 YSSDEDVRQYSVSAPKEEKRFEFE 312

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  296 bits (759), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 212/317 (66%), Gaps = 5/317 (1%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL AT  HP YELI+ISNRDEF ERKTH +CWHNDDFILSP+D+A+         FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W G+NR  ++AT+LNL++  +LD+K+++  +SRG +PFVFL++   +F  WDTY KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLS--GDPYLTVSNDMFATGGITVERA 194
           Y  +++TGDFN FYGD     Y +IDS GNT  + S  G  YL +SN++     +  +  
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQSQDI 180

Query: 195 SNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTL 254
            N+   EW KIK GK ++++ V+ + +L ++ +IE CFKLAST  +  K   +F+   +L
Sbjct: 181 -NSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVKSL 239

Query: 255 PM--ETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312
            +  ETI+V PL    +++IG+ L+ G+YYGTRSQIV+L+ K+  +   +E I+Y+SD D
Sbjct: 240 GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSDQD 299

Query: 313 IQHYSSTNPKEVKSFEF 329
           I  YS++NPKE   +E+
Sbjct: 300 ISLYSTSNPKEELRYEY 316

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  287 bits (735), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 200/314 (63%), Gaps = 19/314 (6%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCILL TTAHP+Y LILISNRDEFFER+TH +C H+DDFI+SPFDM+ +    + + FGT
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSIT---TKGRNFGT 57

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W G+N+D K+A ILNL++ S  + K +  PQSRG++P  FL+  D DFN WD+YEKF   
Sbjct: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHH 117

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG-DPYLTVSNDMFATGGITVERAS 195
           Y  + KTG+FN FYGD    EY++I S   T       D Y+ VSND+ ++         
Sbjct: 118 YPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSNDLISSK-------- 169

Query: 196 NNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTLP 255
                +W KI   K LL++LVE S    +D +++KCFKLAS  +   K   K   + ++ 
Sbjct: 170 ----KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIVVK---HESVT 222

Query: 256 METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDIQH 315
            ETI+VPPL  E   D+  S+  GKYYGTRSQIVIL+SK+ +++  VE +LYT D D+  
Sbjct: 223 NETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLK 282

Query: 316 YSSTNPKEVKSFEF 329
           Y   NPKE   FEF
Sbjct: 283 YGPKNPKEQIEFEF 296

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  285 bits (730), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 207/318 (65%), Gaps = 14/318 (4%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCILL T  HP Y+L+LISNRDEFFER TH++ WH+ D+ILSP+DM K      K + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 77  WIGINRDAKIATILNLKLESQL---DLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKF 133
           W+G+NR  +++T+LNLKLE +      K  VK +SRG+IPF+FLS+     ++WD++EKF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119

Query: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL--SGDPYLTVSNDMFATGGITV 191
             +Y  L K+GDFN F GD    +Y+++DS GNTF VL  +    + VSND       T 
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSND-------TY 172

Query: 192 ERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQN 251
           +  + N I+EW K+K GK+ L +LV  + +LD+   I+KCF  AS CS++ K +   ++ 
Sbjct: 173 KEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIE-KSHEDISKT 231

Query: 252 STLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDN 311
             +   TIFVPPL+C+   D+G + S G Y+GTRSQ+V L+SK+  +V + E IL+TSD 
Sbjct: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291

Query: 312 DIQHYSSTNPKEVKSFEF 329
           D    S  NPKEVK F F
Sbjct: 292 DRDFNSPHNPKEVKQFTF 309

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  271 bits (694), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 205/318 (64%), Gaps = 21/318 (6%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL AT AHP Y+LIL+SNRDEFFERKTH +CW++D FILSP+DMA      + + +GT
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIE---KKGQGYGT 57

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLV---KPQSRGMIPFVFLSEHD-SDFNKWDTYEK 132
           W+GINR  +IA ILNLK++S LD + ++   +P+SRG++P  FL + D + F+ WD++EK
Sbjct: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117

Query: 133 FDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVSNDMFATGGITVE 192
           F+G++  LR+TG F  FYGD  +DEY +ID   ++        ++ +SND+F        
Sbjct: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKMEHMVISNDIFHC------ 171

Query: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252
            A     + W K ++G +LL  L + +  + ++ L++KCF+L S  +    E+       
Sbjct: 172 -AVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEGEDV-----D 225

Query: 253 TLPMETIFVPPLE-CEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDN 311
           ++   +I+VPPL   +  D IGTSL +G YYGTRSQIVIL+ K++ RV   EH++Y SD 
Sbjct: 226 SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDE 284

Query: 312 DIQHYSSTNPKEVKSFEF 329
           D + YS  +PKEV  F+F
Sbjct: 285 DCETYSFMDPKEVIQFQF 302

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  260 bits (664), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 139/317 (43%), Positives = 189/317 (59%), Gaps = 15/317 (4%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+AT+ HP+Y+L+L+SNRDE+F RK   + W  D+F+L P D        +    GT
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGED---LGT 57

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           WIG NRD KI T+LNLKL S    +  V P+SRG IP  FLS   ++F  WDTY+KF  +
Sbjct: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQ 117

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL--SGDPYLTVSNDMFATGGITVERA 194
           +  L  T DFNFFYGD    +YR+IDS GNT KVL  + + Y+ VSND+F        + 
Sbjct: 118 FQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF--------QG 169

Query: 195 SNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKEN--TKFNQNS 252
            +N+   W KI      L  LV E    DED  I++CF +AS      K +    + +  
Sbjct: 170 ESNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAV 229

Query: 253 TLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDND 312
            L M+T+FVPPL+   +D +G S+ +G+YYGTRSQ VIL+SK+   +  VE I++ SD D
Sbjct: 230 ELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLD 289

Query: 313 IQHYSSTNPKEVKSFEF 329
              YS  + KE K ++F
Sbjct: 290 ALQYSRDHYKEQKRYDF 306

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  247 bits (630), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 197/320 (61%), Gaps = 19/320 (5%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDF--ILSPFDMAKSCELHEKKIF 74
           MCILLA+  HP Y+LILISNRDEF +R+TH +CW+  ++  IL P+DM+KS E +  KI 
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59

Query: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSD-FNKWDTYEKF 133
           GTW GIN   +++TILNLK +           +SRG +P  FL   ++D    WD+YEKF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVE 192
             +Y ++++TGDFNFFYGD    +Y +IDS G+T +VL+ D PYL +SND F        
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDKFG------- 172

Query: 193 RASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNS 252
           +++     EW KI   K LL+ L        ED LI KCF +AST ++  ++  K     
Sbjct: 173 KSNGKSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIASTNTLN-EDLIKDVDVR 228

Query: 253 TLPMETIFVPPLEC---EVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTS 309
            L  ETI VPPL     E  + IG SL +G+YYGTRSQIVIL++KN  +VK +E ILY S
Sbjct: 229 ELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYNS 288

Query: 310 DNDIQHYSSTNPKEVKSFEF 329
           D+D+     ++P +  ++ F
Sbjct: 289 DDDVTTQKLSSPIQDLTYNF 308

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  241 bits (616), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 131/321 (40%), Positives = 202/321 (62%), Gaps = 25/321 (7%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCILLA++AHP+Y LILISNRDEF ER+T  +C ++DD+++SP DM  + + + +   GT
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDM--TLKDNNEPNLGT 58

Query: 77  WIGINRDAKIATILNLKL--ESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFD 134
           W G NR+ +IA ILNL+    +Q   K++V   SRG +   +L++     + W++Y KF 
Sbjct: 59  WCGANRNGRIAVILNLRTGNTNQTKTKRIV---SRGNVTMRYLTDKQP-ASDWNSYAKFA 114

Query: 135 GKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-SGDPYLTVSNDMFATGGITVER 193
            K   + K+ +FN FYGD  + +Y  IDS G++F+VL S +PYL +SND       ++E 
Sbjct: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND-------SIES 166

Query: 194 ASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNST 253
           A+     +W KI+  + L++DLV +S +  ED L+ +CF LAS    +   N        
Sbjct: 167 AT-----KWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH---KQDYNVDHMDKEK 218

Query: 254 LPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDI 313
           +    IFVPPLE   ++D+G S+  G++YGTRSQIV+L+SK  + ++ VEH+LY SD + 
Sbjct: 219 VTSSNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPET 278

Query: 314 QHYSSTNPKEVKSFEFKPNIQ 334
            H+ + NPK+  S++  P++Q
Sbjct: 279 THFCAANPKKCVSYKINPDLQ 299

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  223 bits (568), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/312 (39%), Positives = 182/312 (58%), Gaps = 20/312 (6%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76
           MCIL+A+ AHP+Y LI ISNRDEFFERKT  +C ++DD+ILSP D A     + K   GT
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTA--LRSNNKPALGT 58

Query: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136
           W G+NR  ++A ILNL+ +       +  P SRG +P  +L +     + W+++EKF  K
Sbjct: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD-WNSFEKFVSK 117

Query: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFATGGITVERAS 195
           Y  + +  +FN FYGD +  EY  IDS G + + L+ + P L +SND   +         
Sbjct: 118 YPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDSS-------- 168

Query: 196 NNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNSTLP 255
               + W K++   ILLQ+LV+ S+   E+ LIEKCF LAS  + +P E    ++     
Sbjct: 169 ----SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS--NTEPAEIDNSDKEE-FT 221

Query: 256 METIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDIQH 315
             +IF+PP+E     D+G SL  G++YGTRSQIVIL+ ++   +   E +L+ SD ++  
Sbjct: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281

Query: 316 YSSTNPKEVKSF 327
           +S  +PKE   F
Sbjct: 282 HSEKHPKEKLQF 293

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  221 bits (564), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 123/319 (38%), Positives = 185/319 (57%), Gaps = 17/319 (5%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKK---- 72
           MCILLATT HP Y+LILISNRDEF+ER+THV+CWH D  IL+P+D++ S    +      
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 73  IFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSE-HDSDFNKWDTYE 131
            +GTW+GINR   ++ +LNLK  S+         +SRG +   FL +  + +++KW+ YE
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 132 KFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG-DPYLTVSNDMFATGGIT 190
           KF   +  L  T  F  FYGD    ++ +IDS   +    S   PY+ +SN         
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVNC---- 176

Query: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQ 250
                 +    W+K+  G+ LL++LV+ + ++ ++ L++KCF+LA T         +   
Sbjct: 177 -----EDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVNGVIQVT- 230

Query: 251 NSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSD 310
           +++LP +TIFVP L+   N  +G S  VG+YYGTR+ IVIL+  N   V + EH+++ SD
Sbjct: 231 DTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSD 289

Query: 311 NDIQHYSSTNPKEVKSFEF 329
            DI   S+ NPK   ++EF
Sbjct: 290 KDIGLSSAMNPKTKVAYEF 308

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  218 bits (556), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 180/316 (56%), Gaps = 15/316 (4%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMA--KSCELHEKKIF 74
           MCIL ATTAHP+Y+L+LISNRDE+F RKTH +CW ++D IL+P+DMA   +  L      
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHD-SDFNKWDTYEKF 133
           GTWIGINR   ++ +LNL  +            SRG +   +L + D ++++ W+TYEKF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTVSNDMFATGGITVER 193
              +  L KT  F  FYGD +N ++ +I+S G T    S  PY  VSN     G     +
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSPYYVVSN-----GPSDGAK 175

Query: 194 ASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQNST 253
           A    + +W K+  G  L + +++ES  + E+ L+++CF LAS       +    + +S 
Sbjct: 176 A----LGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDS- 230

Query: 254 LPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDNDI 313
           +P  TIFVP L   ++     S + G YYGTRS IV+L+S++   V   EH+++ SD D+
Sbjct: 231 IPKRTIFVPAL-YNLSGQANLSFAAGMYYGTRSTIVMLVSED-GNVVTREHVIHDSDQDL 288

Query: 314 QHYSSTNPKEVKSFEF 329
             YS  NPKE  +  F
Sbjct: 289 DSYSILNPKEQVTHRF 304

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  216 bits (549), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 130/325 (40%), Positives = 190/325 (58%), Gaps = 26/325 (8%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWH--NDDFILSPFDMAKSCELHEKKIF 74
           MCIL  T +HP YELILISNRDEF +RKT  SCW+  ++  +L P+D++++ E    K F
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRN-ETDPSK-F 58

Query: 75  GTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFL-SEHDSDFNKWDTYEKF 133
           GTW GIN   +++++LNLK++      + V+ +SRG +P  FL +  ++ FN W++Y KF
Sbjct: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKF 118

Query: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL-----SGDPYLTVSNDMFATGG 188
             +Y  L KTG FN F GD    EY +IDS G T ++L     +G   + +SN  F +  
Sbjct: 119 LKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISNSEFIS-- 176

Query: 189 ITVERASNNRIAEWRKIKFGKILLQDLVEESKSL-DEDMLIEKCFKLASTCSVQPKENTK 247
                   N    W KI  G+ L+ + +  SK + DE+ +IE CFK+AST  +  +    
Sbjct: 177 --------NDKERWHKISNGEKLMDEFL--SKDIRDENSVIESCFKIASTSELTNEYLHS 226

Query: 248 FNQNSTLPMETIFVPPLECE---VNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEH 304
            +    L  ET+FVPP++ E     D+IG SL VGK+YGTRSQIVIL++K    V+ +E 
Sbjct: 227 HDDILDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMER 286

Query: 305 ILYTSDNDIQHYSSTNPKEVKSFEF 329
           +LY  D+D+       P    +FE+
Sbjct: 287 VLYECDDDVSKAGIEKPINELNFEY 311

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  196 bits (497), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 128/321 (39%), Positives = 181/321 (56%), Gaps = 33/321 (10%)

Query: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHE------ 70
           MCILL TTAHP Y+LILISNRDE FER+TH +CW+++  IL P+DM+K    H+      
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDI-CHDGGGDER 59

Query: 71  -KKIFGTWIGINRDAKIATILNL--KLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKW 127
            K   GTW G+N+D KI T+LNL  + E++ D       QSRG+IP  +L + D  F  W
Sbjct: 60  FKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119

Query: 128 DTYEKFDGKYNYL-RKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFA 185
           +TY+KF  +   +  K G FN F GD  ++EY II+S G + +VL  + PY+ VSN    
Sbjct: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN---- 175

Query: 186 TGGITVERASNNRIAEWRKIKFGKILLQDLVE---ESKSLDEDMLIEKCFKLASTCSVQP 242
                +      ++ EW KIK G  LL+ L+    ++ + DE  ++E CF+++ST ++  
Sbjct: 176 -----INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSG 230

Query: 243 KENTKFNQNSTLPMETIFVPPL---ECEVNDDIGTSLSVG------KYYGTRSQIVILIS 293
           K+     +      + IFVPPL   E EV  D G            KYYGTRSQIV+L  
Sbjct: 231 KKIDGNIERLEQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCE 290

Query: 294 KNHERVKLVEHILYTSDNDIQ 314
           +   +V  VE IL+  + D +
Sbjct: 291 RKSNKVTFVERILHCKNEDAK 311

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  194 bits (494), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 159/270 (58%), Gaps = 17/270 (6%)

Query: 69  HEKKIFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWD 128
           H    FGTW GIN+D ++ T+LNLKL+        +   SRG +P  FLS+HD D+ +W+
Sbjct: 18  HRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWN 77

Query: 129 TYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD------PYLTVSND 182
           +Y KF  +++ L  TGDFNFFYGD  N +Y+IIDS   T  VL+ +       Y+ VSND
Sbjct: 78  SYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSND 137

Query: 183 MFATGGITVERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQP 242
           ++   G             W K++  K  L+ L+E++ + D+D  I KCF++AST     
Sbjct: 138 VYRYQGEET----------WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLD 187

Query: 243 KENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLV 302
            ++ +  ++S +  ++IFVPPL+   + ++GT+   G +YGTRSQIV+L+SK+ ++V  V
Sbjct: 188 WQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFV 246

Query: 303 EHILYTSDNDIQHYSSTNPKEVKSFEFKPN 332
           E +L+ SD  +   S  +P E   F+F  N
Sbjct: 247 ERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276

>CAGL0C05445g Chr3 (517886..521224) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q07660 Saccharomyces cerevisiae YDL231c BRE4
          Length = 1112

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 7/81 (8%)

Query: 126 KWDTYEKF------DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGDPYLTV 179
           +WD  E F      DG ++ +    + +F   DP N++ RI ++  N  K L+   + TV
Sbjct: 73  QWDEIEDFLLEELRDGYFDAMFAKPEPDF-RSDPTNEDNRITENNTNVPKRLTSQIHTTV 131

Query: 180 SNDMFATGGITVERASNNRIA 200
            ND+       +E AS+N I+
Sbjct: 132 KNDIHVLSTRFLEDASHNVIS 152

>Suva_10.576 Chr10 (1008964..1009887) [924 bp, 307 aa] {ON} YLR455W
           (REAL)
          Length = 307

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 116 FLSEHDSDFNKWDTYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIID----SKGNTFKVL 171
           F+SEH+ + N+ +        Y   +K  DFN F  +  ++E R+ D     K    +++
Sbjct: 73  FISEHNKNANQRELV----NAYKEAKKFDDFNVFLQEKFDEENRLKDLKAFEKSEGSRIV 128

Query: 172 SG-DPYL 177
           +G DPY+
Sbjct: 129 AGEDPYI 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,613,713
Number of extensions: 1938621
Number of successful extensions: 5164
Number of sequences better than 10.0: 33
Number of HSP's gapped: 5279
Number of HSP's successfully gapped: 33
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)