Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008303.489ON67167130610.0
NDAI0G009603.489ON70071217230.0
Suva_7.4163.489ON71372314930.0
Smik_6.2243.489ON70571514560.0
YGR128C (UTP8)3.489ON71372314550.0
Kpol_480.163.489ON65567914490.0
Skud_7.4393.489ON71372414490.0
TDEL0D055703.489ON64967914420.0
ZYRO0D10054g3.489ON66468514100.0
KLLA0E04665g3.489ON64763613371e-177
KLTH0F14762g3.489ON65068113331e-176
AFR307C3.489ON65067613201e-174
SAKL0F02838g3.489ON65468113171e-173
TBLA0C044603.489ON69871913021e-171
TPHA0D042303.489ON65268412681e-166
CAGL0I10560g3.489ON67870912061e-156
Kwal_55.212223.489ON3733887762e-96
KAFR0C019403.489ON6096936896e-81
KNAG0B008303.489ON6074355662e-63
Kwal_55.21225singletonOFF2152234383e-49
Suva_4.4588.526ON92276733.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00830
         (671 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...  1183   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   668   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   579   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   565   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   565   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   562   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   562   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   560   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   547   0.0  
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   519   e-177
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   518   e-176
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   513   e-174
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   511   e-173
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   506   e-171
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   493   e-166
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   469   e-156
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   303   2e-96
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   270   6e-81
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   222   2e-63
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   173   3e-49
Suva_4.458 Chr4 (799298..802066) [2769 bp, 922 aa] {ON} YBR203W ...    33   3.4  

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/671 (89%), Positives = 600/671 (89%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120
           PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120

Query: 121 SAPSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXXXXXXQTYDFELKLLNSINMAYNNV 180
           SAPSDSSVTSEFKIKADDHVVD                  QTYDFELKLLNSINMAYNNV
Sbjct: 121 SAPSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLLNSINMAYNNV 180

Query: 181 RFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENAK 240
           RFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENAK
Sbjct: 181 RFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENAK 240

Query: 241 FCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVN 300
           FCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVN
Sbjct: 241 FCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVN 300

Query: 301 NKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGSNPTSSLE 360
           NKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGSNPTSSLE
Sbjct: 301 NKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGSNPTSSLE 360

Query: 361 LLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKIYKEL 420
           LLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKIYKEL
Sbjct: 361 LLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKIYKEL 420

Query: 421 VDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKTFTYL 480
           VDSKNDVT              EYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKTFTYL
Sbjct: 421 VDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKTFTYL 480

Query: 481 LTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRI 540
           LTDPLFPLERTKGLLARLNNHPRLFKQAIVTC            FTISNGELSLDISLRI
Sbjct: 481 LTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRI 540

Query: 541 LQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQLLSLVVDSIGLFAL 600
           LQDYTRDS                           KDTTNAPHLFQLLSLVVDSIGLFAL
Sbjct: 541 LQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQLLSLVVDSIGLFAL 600

Query: 601 DNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEV 660
           DNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEV
Sbjct: 601 DNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEV 660

Query: 661 LPKYSVEYLDL 671
           LPKYSVEYLDL
Sbjct: 661 LPKYSVEYLDL 671

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/712 (52%), Positives = 475/712 (66%), Gaps = 53/712 (7%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRLT+LPKIASLSN++LQ DYIQV  STF+PTTNK+ IG+SGS++SQYI+NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEE--TWCFATMANKTSTLNLINKNQYQ---TNE 115
           PKLIFN+PIPSTNIVTAC+V E    +     WCF  +ANKT TL LI K++ +   T E
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 116 EESGDSAPSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXXXXXX----QTYDFELKLLN 171
           ++       D+++  EF +K D  +VD                      Q ++  LKLLN
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 172 SINMAYNNVRFVEHFHEDGKDFMFVLCDL-ENDKVCLKLFQINENIETINDSAIELTSTI 230
           ++ + Y NV+FVEHF ED KDFMF +CDL +N+KVC+KLFQIN      NDSAIEL S I
Sbjct: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQIN------NDSAIELNSII 234

Query: 231 LENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPI 290
           +ENF  +NAKFCYQFGKFYKLT++ ++VYSLPQFQ +++ T+PMI   K  +++VS KPI
Sbjct: 235 MENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI---KTDDQIVSMKPI 291

Query: 291 SPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTK 350
           S NRILLT+NNKIYLLDLIHNSILSERELTHLK+ QLL++AV+    N N+T+ IGVSTK
Sbjct: 292 STNRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTK 351

Query: 351 FGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNV----QSLKSLFDDENDYSDK-- 404
           FG NPTSSLE++NVDVG++T+KDSLGK FQ  + +N +    Q+LK LFD   D  DK  
Sbjct: 352 FGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTD-GDKDD 410

Query: 405 ---KKQV--KNFNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLV 459
              KK V  + FNY++I  +L ++ ND+               E+YTE DRFIYNHEF +
Sbjct: 411 DLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFL 470

Query: 460 QIIDLIFETFKE--------EYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVT 511
           ++IDLIFE F          EYPKT T+LLT PLFP+ERT+ LL+R  NHPRLFKQAIVT
Sbjct: 471 KLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVT 530

Query: 512 CXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXX 571
           C             TI N ELSLDISLRILQDY++DS                       
Sbjct: 531 CPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDS--IKQELRNLPRLEIENFIDFIL 588

Query: 572 XXXXKDTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDY 631
               KD  N+P LFQLL+LV+DSIGLFAL + +LE LS YID QV+I + NTELW+L+D 
Sbjct: 589 NDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDS 648

Query: 632 SNVLAYKNDKFVTSTSKDSNTSLKL------------QEEVLPKYSVEYLDL 671
           +N +   N K  + +S  ++T+ K             Q+E LP YSV+YL+L
Sbjct: 649 NNNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/723 (46%), Positives = 447/723 (61%), Gaps = 62/723 (8%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D  F+  TN IT+GISGSS+SQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACNVFE------------------------QKGSSEETWCFATM 96
           PKL F++PIPSTNI+TACN  +                        Q     E W F  M
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 97  ANKTS-TLNLINKNQYQTNEEESGDSAPSDSS----------VTSEFKIKADDHVVDXXX 145
            NK + TLN+I K   + N++ S D    + +          + S++KIK  D V++   
Sbjct: 121 VNKGNYTLNVITK-AVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179

Query: 146 -XXXXXXXXXXXXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDK 204
                           + YDF+LKLL+S +++Y N+++ + F E+G +F+FVLC LE+DK
Sbjct: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239

Query: 205 VCLKLFQINENIETINDSAI-ELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQ 263
           VC KLF++++  E    S I EL+STI+E F  E++KFCYQFGK YKL   KI VYSLP 
Sbjct: 240 VCYKLFELSD-FEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPH 298

Query: 264 FQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLK 323
            Q Q  I +P+I        ++SF+P+S NRILLTVNN IYLLDL+H SIL++RELTH++
Sbjct: 299 CQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVR 358

Query: 324 TFQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTS 382
           TFQLL++AV+D+  +QN +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ  
Sbjct: 359 TFQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIG 418

Query: 383 STENNVQSLKSLFDDENDYSDKKKQ--------VKNFNYEKIYKELVDSKN-DVTXXXXX 433
             + +   LK LFDDEN   +  K+        V  F Y++I K++   KN DV      
Sbjct: 419 KNDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDI 478

Query: 434 XXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERTK 492
                    E+YTEKDRFI + EFL +++DLIFE F   +YPK  T+LLT PLFPL RT 
Sbjct: 479 FFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTH 538

Query: 493 GLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXX 552
            LL+RL + PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDS    
Sbjct: 539 NLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQE 598

Query: 553 XXXXXXXXXXX----XXXXXXXXXXXXKDTTNAPHLFQLLSLVVDSIGLFALDNAVLERL 608
                                       + + +  LFQLLSLV+DSIGLF+L+ A+L+ L
Sbjct: 599 MKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNL 658

Query: 609 SKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEY 668
           + YID+QV IA+ NTELW+L++        +    T+ + DS TS   Q++ LP Y++EY
Sbjct: 659 ASYIDKQVEIAERNTELWNLVETKG-----SQHGFTNMNSDSRTS---QKQALPTYTMEY 710

Query: 669 LDL 671
           L++
Sbjct: 711 LEI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/715 (46%), Positives = 446/715 (62%), Gaps = 54/715 (7%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ++Y+QV D TF+ +TN IT+GISGSSVSQYI+NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSE-----------------ETWCFATMANKTS-T 102
           PKLIF++PIPSTNI+TACN  E + + E                 E W F  M NK + T
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 103 LNLINKNQYQT--NEEES-------GDSAPSDSSVTSEFKIKADDHVVDXXX-XXXXXXX 152
           LN+I K    T  N +E+        +       + S++KIKA   V+            
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 153 XXXXXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQI 212
                   + YDF+LKLL+S +++Y+N+++ + F E+G +F+FVLC L++DKVC KL ++
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240

Query: 213 NENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITL 272
            +     N    EL+STI+E F  +++K CYQFGK YKL   KI VYSLP  Q Q  I L
Sbjct: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300

Query: 273 PMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAV 332
           P+I +      ++SF+P+S NR+LLTVNN +YLLDL+H S L +REL+H+KTFQLL TAV
Sbjct: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360

Query: 333 VDTNINQ-NRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSL 391
           +++  +  ++T+AIG+STK G+NPTSSLE++N+DVGT+T+KDSLGKSFQ    +++V  L
Sbjct: 361 INSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDSSV-IL 419

Query: 392 KSLFDDENDYSDKKKQ--------VKNFNYEKIYKELVDSK-NDVTXXXXXXXXXXXXXX 442
           K LFDDE    +  K+        +  F Y++I  +L   K ND+T              
Sbjct: 420 KPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKE 479

Query: 443 EYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERTKGLLARLNNH 501
           E+YTEKDRFI +  FL +++DLIFE F   +YPKT T+LLT PLFPL+RT+ LL+ L + 
Sbjct: 480 EHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQ 539

Query: 502 PRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXXXXXXXXXXX 561
           PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDS             
Sbjct: 540 PRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDI 599

Query: 562 XXXXXXXXXXXXXXK----DTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVA 617
                              + + +  LFQLLSLV+DSIGLF+L+ A+LE L+ YID+QV 
Sbjct: 600 QNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVK 659

Query: 618 IAQSNTELWHLLDY-SNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671
           IA+ NTELW+L+D  S+   + N  F +++S         Q++ LP Y++EYLD+
Sbjct: 660 IAERNTELWNLIDIKSSQHGFTNLAFESASS---------QKQALPTYTMEYLDI 705

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/723 (45%), Positives = 441/723 (60%), Gaps = 62/723 (8%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D TF+ +TN IT+GISGSS+SQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACN-------------------------VFEQKGSSEETWCFAT 95
           PKL F++PIPSTNI+TACN                         +  QK  + E W F  
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 96  MANKTS-TLNLINKNQYQTNEEESGDSAPSD---------SSVTSEFKIKADDHVVDXXX 145
           M NK + TLN+I K    T +  +   + SD             S++KIKA   V+    
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 146 -XXXXXXXXXXXXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDK 204
                           + +DF+L LL+S +++Y+N+++ + F E+G +++FVLC L++DK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 205 VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQF 264
           VC KL ++ +     +    EL+STI+E F  EN+K CYQFGK YKL   KI +YSLP  
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 265 QFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKT 324
           Q Q  I  PM+  L  G+ ++SF+P+S NR+LLTVNN IYLLDL+H S LS+RELTH+KT
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 325 FQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSS 383
           FQLLK+AV+++  + N +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ  +
Sbjct: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420

Query: 384 TENNVQSLKSLFDDENDYSDKKKQVKNFNY----------EKIYKELVDSKNDVTXXXXX 433
            +++V  LK LFDD+ D +DK+ +  + +           E I K      ND+T     
Sbjct: 421 NDSSV-ILKPLFDDK-DINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDI 478

Query: 434 XXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFK-EEYPKTFTYLLTDPLFPLERTK 492
                    E+YTEKDR+I +  FL +++DLIF  F   +YPKT T+LLT PLFPL RT+
Sbjct: 479 FFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTR 538

Query: 493 GLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXX 552
            LL+ L + PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDS    
Sbjct: 539 NLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQE 598

Query: 553 XXXXXXXXXXXXXXXXXXXXXXXK----DTTNAPHLFQLLSLVVDSIGLFALDNAVLERL 608
                                       + + +  LFQLLSLV+DSIGLF+L+ A+LE L
Sbjct: 599 MKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENL 658

Query: 609 SKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEY 668
           + YID+QV IA+ NTELW+L+D           F +ST  D+ TS   Q+  LP Y++EY
Sbjct: 659 TLYIDKQVEIAERNTELWNLIDTKGF----QHGFASSTF-DNGTS---QKRALPTYTMEY 710

Query: 669 LDL 671
           LD+
Sbjct: 711 LDI 713

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/679 (48%), Positives = 427/679 (62%), Gaps = 32/679 (4%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPS SQPFRL +LPKI SLSN   Q   +Q+ D  FS  +NKITIGISGS++SQYI+NPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLIFNFPIPSTNIVTACN----VFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEE 116
           P L+FN PIPSTN VTACN    V +  GS  E W +    NK  TLN+      +T+++
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNI----SIKTSDD 115

Query: 117 ESGDSAPSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXXX-XXXQTYDFELKLLNSINM 175
           +    A S   V   +  K DD +                     Q YDF LKLL S+N+
Sbjct: 116 DK--YATSGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNV 173

Query: 176 AYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFP 235
            Y+++ FVEHF EDGK F  +L ++E  K+  KL+++  N +T   S  EL+STILE+  
Sbjct: 174 MYSDISFVEHFEEDGKQFAIILSNIEGKKISFKLYELFTNDKT---SINELSSTILEDAD 230

Query: 236 LENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRI 295
           L  ++ CYQFGK Y+L +D++ +Y+LPQ Q Q +I LP I   K+   V+SF PI+ NRI
Sbjct: 231 LGESQICYQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQ--KKDSDVLSFSPIANNRI 288

Query: 296 LLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDT-NINQN-RTLAIGVSTKFGS 353
           LLTVNNKIYLLDL+HNSIL+ER+L+H+K +QLLK+ VV +   N+N +T+AIGVS K G 
Sbjct: 289 LLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGP 348

Query: 354 NPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLF-DDENDYSDKKKQVKNFN 412
           +P SSLE++NVDVG+ T+KDSLGKSFQ ++ + N+  L+SLF +DE  Y+  K + K+F+
Sbjct: 349 SPISSLEVINVDVGSGTLKDSLGKSFQVANVKKNI-PLQSLFPEDETIYA--KGEQKSFD 405

Query: 413 YEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEE 472
           Y+ I +EL ++KND+               EYYTE+DRFIY+ +FL  ++DLIF  FK++
Sbjct: 406 YKNILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKD 465

Query: 473 YPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGEL 532
           YP+  T+LLT PLFP+  T+ LL +  N PRLFKQA+VTC            FTI+NGEL
Sbjct: 466 YPRALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGEL 525

Query: 533 SLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQLLSLVV 592
            LDISLRILQDYTRDS                           K   N P LFQLLSLV+
Sbjct: 526 CLDISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVIDTDSEDKSQFN-PQLFQLLSLVL 584

Query: 593 DSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNT 652
           D+ GLFAL+   LE+LS YID QV +A+ N  LWHLLD +      +DK   ST   +N 
Sbjct: 585 DASGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLDEN------SDK--RSTLNQAND 636

Query: 653 SLKLQEEVLPKYSVEYLDL 671
              LQ + L  YSVEYL+L
Sbjct: 637 QNVLQTKSLSAYSVEYLEL 655

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/724 (46%), Positives = 455/724 (62%), Gaps = 64/724 (8%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D TF+ +TN IT+GISGSS+SQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACNVFE-------------------QKGSSEET------WCFAT 95
           PKL F++PIPSTN++TAC+  E                   +K ++ +T      W F +
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 96  MANKTS-TLNLINK----NQYQTNE---EESGDS---APSDSSVTSEFKIKADDHVVDXX 144
           M NK + TLN+  K    N+  +NE   E+S DS   A +D  + S+ KIK    V++  
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFL-SQHKIKTKAKVMNIK 179

Query: 145 X-XXXXXXXXXXXXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLEND 203
                            + YD +LKLL S +++Y+N+++ + F E+G DF+FVLC LE+D
Sbjct: 180 IDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDD 239

Query: 204 KVCLKLFQINENIETINDSAI-ELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLP 262
           KVC K+ ++++  E+ ++S I EL+STI+E F  E++K CYQFGK YKL   KI VYSLP
Sbjct: 240 KVCYKMLELSD-FESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLP 298

Query: 263 QFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHL 322
             Q Q  I LP+I      + ++SF+P+S NRILLTVNN IYLLDL+H SIL+ RELTH+
Sbjct: 299 HCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHV 358

Query: 323 KTFQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQT 381
           KTFQLLK+A++D+  + N +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ 
Sbjct: 359 KTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQV 418

Query: 382 SSTENNVQSLKSLFDDENDYSDKKKQ--------VKNFNYEKIYKEL-VDSKNDVTXXXX 432
              + +V  LK LFDDE+  ++  K+        V  F+Y+++ ++L V   ND+     
Sbjct: 419 GKNDASV-ILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDE 477

Query: 433 XXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETF-KEEYPKTFTYLLTDPLFPLERT 491
                     E+YTEKDRFI +  FL +++DLIF  F   +YPK  T+LLT PLFPL RT
Sbjct: 478 IFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRT 537

Query: 492 KGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXX 551
            GLL+ L + PRLFKQAIVTC            F+I N EL LDIS R+LQD+TRDS   
Sbjct: 538 HGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQ 597

Query: 552 XXXXXXXXXXXXXXXXXXXXXXXXK----DTTNAPHLFQLLSLVVDSIGLFALDNAVLER 607
                                        +  ++  LFQLLSLV+DSIGLF+L+ A+LE 
Sbjct: 598 EMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLEN 657

Query: 608 LSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVE 667
           L+ YID+QV IA+ NTELW+L+D    +      F T +S  + +    Q++ LP Y++E
Sbjct: 658 LTLYIDKQVKIAERNTELWNLID----IKGSQHGFATLSSGSTTS----QKQALPAYAME 709

Query: 668 YLDL 671
           YLD+
Sbjct: 710 YLDI 713

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/679 (46%), Positives = 426/679 (62%), Gaps = 38/679 (5%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQ F+L +LP++ASLSNFA Q++++QV D    PT+N+ITIGIS S++SQY++NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120
           PKL+ + PIPSTNIVTAC+V   +   +E WC+A  A K  TLN+ +K  +  N   S D
Sbjct: 60  PKLVLSIPIPSTNIVTACDV--ARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDD 117

Query: 121 SAPSDSSVTSEFKIKADDHVVDXXXXXX-XXXXXXXXXXXXQTYDFELKLLNSINMAYNN 179
                       K+K DD  V                    Q YDF+LKLL+S++++Y++
Sbjct: 118 V----------LKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSD 167

Query: 180 VRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAI-ELTSTILENFPLEN 238
           V   + F E   DF+F+LC L  DKVC KLF+++  +   N   I EL+S ILE+F L  
Sbjct: 168 VSVTKFFTEGANDFLFILCSLPEDKVCFKLFELS--LPNYNQVPIKELSSIILEDFSLAT 225

Query: 239 AKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLT 298
           +K CYQ G+ Y+L   ++LVY+LPQ Q   ++TLPM+    +G  V+S KPIS NRIL+T
Sbjct: 226 SKICYQSGRLYRLIGHEVLVYALPQCQLVQAVTLPMV----QGADVISMKPISSNRILVT 281

Query: 299 VNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQN----RTLAIGVSTKFGSN 354
            +NKIYLL+L HNSIL +RELTHLK+FQLLK+AV+D+ ++ +    +T  IGV TK G N
Sbjct: 282 ADNKIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKN 341

Query: 355 PTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKK-QVKNFNY 413
           PTSSLE++NVDVGT T+KDSLGK F T S E   Q LK LF DE++ ++ +  + ++F++
Sbjct: 342 PTSSLEIVNVDVGTGTLKDSLGKGF-TVSNEPISQVLKPLFSDEDNEAEDEDNKFEHFDF 400

Query: 414 EKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEEY 473
            +IY+ L  +K  ++              E+YTE DRFI + +FL  ++ LI + F+EEY
Sbjct: 401 NQIYQHLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEY 460

Query: 474 PKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELS 533
           PK  T+LLT PLFP++ T  LL+RL  HPRLFKQAIVTC            F+I NGELS
Sbjct: 461 PKALTFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELS 520

Query: 534 LDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPH-LFQLLSLVV 592
           LDISLRILQDYT D                            ++   + H LFQLLSLV+
Sbjct: 521 LDISLRILQDYTTD--MIKQEVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVL 578

Query: 593 DSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNT 652
           DSIGLFALD  +L+RL+ YI E+VAIA+ N++L HLLD        + +     +K    
Sbjct: 579 DSIGLFALDGVLLDRLADYIQERVAIAERNSKLCHLLD--------DKQNSRGFAKSGAG 630

Query: 653 SLKLQEEVLPKYSVEYLDL 671
           S+    E +PKY+VEYLDL
Sbjct: 631 SVGSTREAVPKYTVEYLDL 649

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/685 (45%), Positives = 427/685 (62%), Gaps = 35/685 (5%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPS+ QPFRL++LP+I +LSN+ +QSDY++V+ S  SP +NKITIGIS S++SQYI+NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120
           PKL+ N  IPSTN+V+AC+V       +E WC+   + K+   + +N +    + +   D
Sbjct: 60  PKLLSNISIPSTNVVSACDV-ATLADDKEIWCYCVKSGKS---HFLNASVKPVDADTVLD 115

Query: 121 SAPSDSSVTSEFKIKADDHVVDXXXX-XXXXXXXXXXXXXXQTYDFELKLLNSINMAYNN 179
           +   D   T +FKIK D  VV                    Q YDF+L+ L+S++++Y N
Sbjct: 116 TDGGDK--TEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQN 173

Query: 180 VRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENA 239
           V+ V +F E+G++FMFVL   EN+KVC KLF++  +    +    EL++TILENF L+ +
Sbjct: 174 VKVVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQS 233

Query: 240 KFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTV 299
           K CYQ GK Y+L    I  Y+LPQ     +  LPMI D     + VS  P+S NRILLTV
Sbjct: 234 KLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILD--PNSQKVSLAPVSTNRILLTV 291

Query: 300 NNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNIN------QNRTLAIGVSTKFGS 353
           NN++YLLDL+H+S+LSER LTH KTFQLL++A ++ + +        RTLAIGV+TK G+
Sbjct: 292 NNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGN 351

Query: 354 NPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLF-DDENDYSDKKK--QVKN 410
           NPTS+LE++NVDVGT T+KDSLGKSFQ S  ++   +L+ LF DDE+D  D     +V  
Sbjct: 352 NPTSALEVINVDVGTGTLKDSLGKSFQ-SINDSKTHNLQPLFSDDESDAGDNADSDEVVA 410

Query: 411 FNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFK 470
           F YE I+KEL  +   ++              E+YT+++RFI + EFL +++ LI ++F 
Sbjct: 411 FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD 470

Query: 471 EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNG 530
           +EYP+  T+LLT PLFP + T+GLL R  NHPRLFKQAIVTC            F+I+NG
Sbjct: 471 QEYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNG 530

Query: 531 ELSLDISLRILQDYT----RDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQ 586
           EL LDISLRILQD+T    +D                            K T     LFQ
Sbjct: 531 ELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTY---ELFQ 587

Query: 587 LLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTST 646
           LLSLV+D+IGLFALD A+L+RLS YIDEQV +A+ N  LW+LLD  N    KN     S 
Sbjct: 588 LLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRN----KNRGATGSL 643

Query: 647 SKDSNTSLKLQEEVLPKYSVEYLDL 671
           +  S    + +E+ LPKY+VEYL+L
Sbjct: 644 AGSS----RAKEQTLPKYTVEYLEL 664

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  519 bits (1337), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 288/636 (45%), Positives = 397/636 (62%), Gaps = 28/636 (4%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           M S+SQPFRL+ LPKI SL+N+A Q+DY+QV D+  SP+ NK+ IGISGSS+SQY++NPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120
           PKL+FN PIPSTNIVTAC+V E   ++E  WC+   A K S L+L  K   Q        
Sbjct: 60  PKLVFNLPIPSTNIVTACDVVEDAANTE-VWCYGLEARKVSHLHLATKPMIQ------DA 112

Query: 121 SAPSDSSVTSEFKIKADDHVVDXXX-XXXXXXXXXXXXXXXQTYDFELKLLNSINMAYNN 179
            + S++ +TS+FK K    VV                    QT+D+ELKL N+I+++Y++
Sbjct: 113 VSSSNAEITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDD 172

Query: 180 VRFVEHFHE-DGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLEN 238
           +RFV+ F +  G DF FVLC L ++K+C KLFQ+    E++  S IEL S ILEN+ LEN
Sbjct: 173 IRFVQFFQDGQGNDFFFVLCQLSDEKICYKLFQVRS--ESV--SCIELNSIILENYTLEN 228

Query: 239 AKFCYQFGKFYKLTD-DKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILL 297
           AK C++FGK Y L + +++ +Y LP  Q Q SI LP I+     + VVS KP+S NR+LL
Sbjct: 229 AKLCFEFGKLYVLKNSNELSIYQLPHLQLQTSIQLPFIS----KDAVVSIKPVSSNRVLL 284

Query: 298 TVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNR-TLAIGVSTKFGSNPT 356
           T +N IYL+DL++N+IL +++L ++K  QLL TAVV  N   NR T+A+ V+TK G+NPT
Sbjct: 285 TADNTIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPT 344

Query: 357 SSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKI 416
           S L+++N+DVGT T+KD++GK F         Q L+ LF++ N+  D   ++ + +YE+I
Sbjct: 345 SYLDVINIDVGTGTLKDAMGKGFMVKQK----QKLQKLFEESNE--DDDVELPSPDYERI 398

Query: 417 YKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKT 476
            K+L   K  +               EYYT+ DRF+ + + L QIID +F  FK+EYPK 
Sbjct: 399 IKQLHICKK-IENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKA 457

Query: 477 FTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDI 536
            TYLLT PLFP    KGLL +L N+PRLFKQAIVTC            F I+N EL  DI
Sbjct: 458 LTYLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDI 517

Query: 537 SLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKD-TTNAPHLFQLLSLVVDSI 595
           +LR+LQDY ++S                            D   N P +FQL+SL++DSI
Sbjct: 518 TLRVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSI 577

Query: 596 GLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDY 631
           GLFALD+  LE+LS ++D QV++   N EL HL ++
Sbjct: 578 GLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEH 613

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  518 bits (1333), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 297/681 (43%), Positives = 413/681 (60%), Gaps = 41/681 (6%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPS+SQPFRLT LPKIASL+N+A Q +Y+QV D T +PTTN I +G+SGS+VSQYI+NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSE----ETWCFATMANKTSTLNLINKNQYQTNEE 116
           PKL++N PI STN+V+AC V E   +SE    E  C+   +N+  +L    K        
Sbjct: 60  PKLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIK-------- 111

Query: 117 ESGDSAPSDSSVTSEF---KIKADDHVVDXXX-XXXXXXXXXXXXXXXQTYDFELKLLNS 172
               S  SDSS    +   K+   D +V+                   Q +DFELKL +S
Sbjct: 112 -PVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHS 170

Query: 173 INMAYNNVRFVEHF-HEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTIL 231
           ++ +Y NV +V+HF  E G+ + F+L D++  KV  KLF+I ++       A EL+S IL
Sbjct: 171 LDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSAT--PATELSSVIL 228

Query: 232 ENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPIS 291
           EN  L++++  YQFG+ Y+L  + + +Y+LP FQ   +I LP +      E ++SFKPIS
Sbjct: 229 ENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPFLAP----ESIISFKPIS 284

Query: 292 PNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNIN-QNRTLAIGVSTK 350
            NR LLT +NKI+LLDL+HN+ILS+RE+ H+K FQLL+TAV+  N    N+T+A+GVS K
Sbjct: 285 TNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIK 344

Query: 351 FGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKN 410
            GSNP+SSL+++N+DVGT T++DS+GK F   S EN  Q L+ L    ND      +   
Sbjct: 345 HGSNPSSSLDIINIDVGTGTLRDSMGKGFM--SRENKSQHLQPLISTLND-----TEAAE 397

Query: 411 FNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFK 470
           FNY++I KEL  + +++                YYT+ DRF+ + EFL  +  LIF++FK
Sbjct: 398 FNYDRILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK 457

Query: 471 EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNG 530
            EYPK  TYLLT+PLFP+  T  LL +L +HPRLFKQAIVTC            FT+ N 
Sbjct: 458 SEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVIND 517

Query: 531 ELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQLLSL 590
           EL LD+SLRILQD+ +DS                               N P LFQLLSL
Sbjct: 518 ELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKPRLFQLLSL 577

Query: 591 VVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDS 650
           V+DS+GLFAL+N +LE+L+KYID+Q+++ + N EL++L++  N   +KN         D+
Sbjct: 578 VLDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKN---FKNG--FGQPLGDT 632

Query: 651 NTSLKLQEEVLPKYSVEYLDL 671
           +TS    E V+  YS+E L+L
Sbjct: 633 STS---GEPVITAYSIEQLEL 650

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  513 bits (1320), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 295/676 (43%), Positives = 399/676 (59%), Gaps = 33/676 (4%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           M  ++QPFRL  LPKI+SL+N+A Q+ Y+QV D    PT+N +T+G+SGSS+SQY++NPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMAN-KTSTLNLINKNQYQTNEEESG 119
           PKL++N PIPSTN+VT C+V      +E  W +A  AN K  TL+ + +      +E   
Sbjct: 60  PKLVYNIPIPSTNVVTGCDVLAMSDGAE-LWSYALTANGKVHTLHAVLRKAGAAPQETGL 118

Query: 120 DSAPSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXX-XXXXQTYDFELKLLNSINMAYN 178
           D++  +      FK      VV                    QTYD++L+LL+S++++Y 
Sbjct: 119 DASEDE-----HFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYT 173

Query: 179 NVRFVEHFHED-GKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLE 237
           NV  VE+F +  GKD+MFVLCD++N K C KLFQ+N + E  N    EL S ILE+F L 
Sbjct: 174 NVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAE--NLPITELNSVILEDFALA 231

Query: 238 NAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILL 297
            +K  YQFGK Y+L D K+ VYSLP FQ  + + LP +      +  VS + IS NR+LL
Sbjct: 232 ESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV----RKDDQVSLQAISTNRLLL 287

Query: 298 TVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVD--TNINQNRTLAIGVSTKFGSNP 355
           T  NKI+LLDL+HN+IL EREL+++K FQLL+ AV+   T    NRT AIGVSTK GSNP
Sbjct: 288 TCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNP 347

Query: 356 TSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEK 415
           +S+L+++ + VGT T+KDSLGK F  S      ++LK LF  ++D S       N ++  
Sbjct: 348 SSALDVVTIAVGTGTLKDSLGKGF-LSGEHRRTEALKPLFGTDDDES------PNIDFAA 400

Query: 416 IYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPK 475
           I  EL  S+                  EYYTE DRFI N EFL  I+D IF TF +E+PK
Sbjct: 401 ILAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPK 459

Query: 476 TFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLD 535
              YLLT PLFP   TKGLL +L  HPRLFKQA+VTC            FT+ N ELSLD
Sbjct: 460 ALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLD 519

Query: 536 ISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNA-PHLFQLLSLVVDS 594
           +SLR+LQ++T++                            ++   A P LFQLLSLV+D+
Sbjct: 520 LSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDA 579

Query: 595 IGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSL 654
           +GL AL+  +L RLS +ID QVA+A    EL +LL+ S+    K  K + S ++   + +
Sbjct: 580 VGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSST---KKGKHLNSVTRLDESPV 636

Query: 655 KLQEEVLPKYSVEYLD 670
                 +P YSVEYLD
Sbjct: 637 A---ATIPLYSVEYLD 649

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  511 bits (1317), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 312/681 (45%), Positives = 415/681 (60%), Gaps = 39/681 (5%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           M S+SQPFRLT LPKIASL+NF+ Q+DY+QV + T +P+ NKI IG+SGSS+SQYI+NPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFE---QKGSSE--ETWCFATMANKTSTLNLINKNQYQTNE 115
           PKL+ N  IPST+IVTAC+V E    +G +E  E WC+A +ANK+ TLN I K       
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIK------- 112

Query: 116 EESGDSAPSDSSVTSE-FKIKADDHVVDXXXX-XXXXXXXXXXXXXXQTYDFELKLLNSI 173
             + D+   +S+ T E +K+     V                     QT+DF+LKLL+S 
Sbjct: 113 PLTADAPSVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSA 172

Query: 174 NMAYNNVRFVEHF-HEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAI---ELTST 229
           +++Y N+  V++F +E  +DFM VL DL +DKVC KLF+I  +     DS +   EL S 
Sbjct: 173 DISYGNISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHH-----DSNVPLKELNSV 227

Query: 230 ILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKP 289
           ILE F L+N+K  YQFGK Y L++ KI +YSLP FQ   +I LP +T     E VVSFKP
Sbjct: 228 ILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTH----ENVVSFKP 283

Query: 290 ISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQN-RTLAIGVS 348
           IS NR LLTV+N+IYLLDL+HN+ILS+RELTH+KTFQLL TA++  N  +N +T+AIGVS
Sbjct: 284 ISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVS 343

Query: 349 TKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQV 408
           TK  +N TS+L+++N++VG+ T+KDS+ K F T      V  L SLFD++ D    +   
Sbjct: 344 TKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEV--LNSLFDEQ-DDELDEDGT 400

Query: 409 KNFNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFET 468
             F+Y +I  EL  +K+                 EYYTE DRF  +  FL +++ LIFE 
Sbjct: 401 SQFDYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFEN 460

Query: 469 FKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTIS 528
           F +EYP+  TYLLT PLFP +    LL++   HPRLF+QAIVTC            FT+ 
Sbjct: 461 FNKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVI 520

Query: 529 NGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQLL 588
           N EL LD+SLRILQD+T+DS                           +   + P LFQLL
Sbjct: 521 NDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEERNKSKPQLFQLL 580

Query: 589 SLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSK 648
           +LV+DSIGLFALD   LE L ++I+ QV I + N EL +LLD ++  +       TS   
Sbjct: 581 NLVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDTSAKS-------TSIIS 633

Query: 649 DSNTSLKLQEEVLPKYSVEYL 669
             + S    E+ LP YSVEYL
Sbjct: 634 SYSASSSTTEQALPSYSVEYL 654

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  506 bits (1302), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 301/719 (41%), Positives = 422/719 (58%), Gaps = 69/719 (9%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL +LPKIASLSN++LQ+DY+QV   TF+  TNK+T+GISGS +SQYI+NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLIFNFPIPSTNIVTACNV------FEQKGS---------------------------- 86
           PKL+FN  IPSTN VTA N+       E   S                            
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 87  ----SEETWCFATMANKTSTLNLINKNQYQTNEEESGDSAPSDSSVTSEFKIKADDHVVD 142
               S E W +  +ANK++TLN+      +T   +   + P +  +  +  IK D  VV+
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNI----SVKTTGLDEFSTTPGE--IIRKKTIKVDSKVVN 174

Query: 143 XXXXXX-XXXXXXXXXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLE 201
                              + +DF+L L +S+++AYN+V+FV+HF E  ++F+ +L +++
Sbjct: 175 IKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNID 234

Query: 202 NDK--VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVY 259
            +K  VC KL+Q+   +++ ++   EL+ +IL++F L  +K  YQFGK Y+LT  ++ VY
Sbjct: 235 EEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVY 292

Query: 260 SLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSEREL 319
           SLPQ Q   +I+L  I        V S KP++ NR++L +NN +YL+D +H SIL+ERE 
Sbjct: 293 SLPQCQLLQNISLAEI--FPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREF 350

Query: 320 THLKTFQLLKTAVV-DTNINQNRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKS 378
           TH+KTFQLL++A + D+NI Q RT+AIGVSTK G    S+LEL+N++VG+ T+KDSLGK 
Sbjct: 351 THVKTFQLLQSATIGDSNITQ-RTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKG 409

Query: 379 FQTSSTENNVQSLKSLFDDENDYS------DKKKQVKNFNYEKIYKELVDSKNDVTXXXX 432
                +E +   LK LFD+ ++ S           VK+FN+ KI  +L  S + ++    
Sbjct: 410 VSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDK 468

Query: 433 XXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKTFTYLLTDPLFPLERTK 492
                      +YTE DRFI + +F+   IDLIF+ F  E+PK FT+LLT PLFP++ T 
Sbjct: 469 TFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTV 528

Query: 493 GLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXX 552
           GLL +L +HPRLFKQAIVTC            FT+ NGEL+LDISLR+LQDY+R+     
Sbjct: 529 GLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRND-VKQ 587

Query: 553 XXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYI 612
                                  +  TN P LFQLLSLV+DSIGLFAL   +LERLS YI
Sbjct: 588 EIKKLDNVDIENFIEFIITPTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYI 647

Query: 613 DEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671
           +EQV IA+ ++ELWHLLD S       + ++ S   +        +E L  YSV+YLD+
Sbjct: 648 NEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGN--------KETLSVYSVDYLDI 698

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  493 bits (1268), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 292/684 (42%), Positives = 421/684 (61%), Gaps = 45/684 (6%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL ILPKIA LS++ +QS  +QV D  F+  +NKITIG+SG +VSQY++NPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEE----TWCFATMANKTSTLNL----INKNQYQ 112
           P +    PIPSTN VTACNV + K +  E     W +    NK +TL++    ++ +++ 
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFS 119

Query: 113 TNEEESGDS--APSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXXXXXXQTYDFELKLL 170
           T + ++ ++     D+SV    KI  +D  +                   Q +DF+LKLL
Sbjct: 120 TTQSDALETYTVKCDASVVG-IKINKEDKTI----------VVTLGNGFIQIFDFKLKLL 168

Query: 171 NSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTI 230
           NS+N +Y+N+ F EHF E+ K F  +L  +E +K+  KL+++    +T   S  EL+STI
Sbjct: 169 NSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLSYKLYELFGQDKT---SIKELSSTI 225

Query: 231 LENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPI 290
           LE+   +++K  YQFGK Y+L  +++ VYSLPQ Q   +ITLP I DLK+ +  +SFKP+
Sbjct: 226 LEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQI-DLKKSQ-AISFKPV 283

Query: 291 SPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTN--INQNRTLAIGVS 348
           S NRILLTV+NKI++LDL+H + L+ER L H+K FQLLK+ V++TN   N ++T+AIGVS
Sbjct: 284 SNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVS 343

Query: 349 TKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTS-STENNVQSLKSLFDDENDYSDKKKQ 407
            K G +P ++LE++N +VGT T+KDSLG SF  S S ++N+  L+ LF D+ +   +   
Sbjct: 344 VKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKSNI--LQPLFTDDANLVKRH-- 399

Query: 408 VKNFNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFE 467
             +F YE I K+L  ++ND+                YYT+ +RFI++  FL  +IDLIF+
Sbjct: 400 --DFKYEAILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFK 457

Query: 468 TFKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTI 527
            F++EYP   T+LLT PLFP+ +TK LL +L  HPRLFKQA+VTC            F+I
Sbjct: 458 NFQKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSI 517

Query: 528 SNGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPHLFQL 587
           +NGELS+DISLRILQDYT+DS                           +   N   LF L
Sbjct: 518 TNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEEEKKHNE-QLFVL 576

Query: 588 LSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTS 647
           LSLV+D+ GLF+++  +L +LS+YID+QV + + + +LWHL+D    L  +N+ + TS +
Sbjct: 577 LSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLID--GTLGKRNNHYQTSGA 634

Query: 648 KDSNTSLKLQEEVLPKYSVEYLDL 671
                      + L  YSVEYL+L
Sbjct: 635 TVPEI------KALTAYSVEYLEL 652

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  469 bits (1206), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 272/709 (38%), Positives = 412/709 (58%), Gaps = 69/709 (9%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPSLSQPFRL +LPKIASL NF+ +  YI+V DS F+P +N + +GISGSS+S+Y++ PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVF----------EQKGSSEET-------------------W 91
           P+LIFN PIPST++V+ACN+           + + +++ET                   W
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 92  CFATMA-NKTSTLNLINKNQYQTNEEESGDSAPSDSSVTSEFKIKADDHVVDXXXXXXXX 150
           C+A  A NKT TLN + +        E  ++  S +    +F  K  + +++        
Sbjct: 120 CYALSANNKTHTLNCLIR--------EVDNNNTSITENNPQFNAKFKEQIINIEVDTKHK 171

Query: 151 XXXXX-XXXXXQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDKVCLKL 209
                      Q YD +LKLLNSIN  Y +++ V+ F E+G ++M ++ DL++ KV L+L
Sbjct: 172 VIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQL 231

Query: 210 FQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYS 269
           ++++    T      ELTS+I+ENF L+++  CYQFG+ Y+L  D+I VYS+P  Q    
Sbjct: 232 YEVS----TEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSK 287

Query: 270 ITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLK 329
           + +P ++++++   ++S KPI+ NR+LLTV NKIYLLDL+H SILSERE++H+KTFQ+LK
Sbjct: 288 VKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILK 347

Query: 330 TAVVDTNINQNRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQ 389
           TA+         TLA+G+STK G NPTS+LE++N+DVG++++KDSLGKSF   +  N +Q
Sbjct: 348 TAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRN--NQIQ 405

Query: 390 S-LKSLFDDENDYSDKKKQVKNFNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEK 448
             LK+LF       + K ++ + N+ +I  +L ++ N                 E +TE 
Sbjct: 406 GQLKNLF------PEPKYELPSINFPEILGKLKNA-NSAEKFDETFFNLLNIKEEMFTEN 458

Query: 449 DRFIYNHEFLVQIIDLIFET--FKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFK 506
            RF+ +  FL  ++DLIF    + +  P++  +LLT PLFP E+  GLL ++ ++ RLFK
Sbjct: 459 SRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFK 518

Query: 507 QAIVTCXXXXXXXXXXXXFTISNGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXX 566
           QAIVTC            FTI N EL +DIS+RILQDYT+D+                  
Sbjct: 519 QAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMN 578

Query: 567 XXXXXXXXXKDTTN----APHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSN 622
                       ++     P +F+LLSL++DSIGLF L+ ++L +LS  I+++V IA+ N
Sbjct: 579 FIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERN 638

Query: 623 TELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671
            ELW+++D          K ++     S  + KL E     Y VEY+D+
Sbjct: 639 VELWNIMDA---------KMLSVKKSSSTAASKLAENSQTPYIVEYIDI 678

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  303 bits (776), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 173/388 (44%), Positives = 234/388 (60%), Gaps = 16/388 (4%)

Query: 285 VSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNR-TL 343
           +SF PIS NR LLT +NK+YLLDL+HN+ILS+RE TH+KTFQLL TAV+  N + N  T+
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 344 AIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSD 403
           AIGV+TK G+  TSSL+++N+DVGT T+KDS+GK F +S T+  VQ  +SL    ND   
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTK--VQCPQSLLGTPND--- 115

Query: 404 KKKQVKNFNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIID 463
              +V+  NY +I K+L  +K++                +YYT+ DRF+ + EFL   + 
Sbjct: 116 --TEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLK 173

Query: 464 LIFETFKEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXX 523
           LIFE F+ EYPK  TYLLT PLFP+  T  LL +L +HPRLFKQAIVTC           
Sbjct: 174 LIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLLQE 233

Query: 524 XFTISNGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNAPH 583
            FT+ N EL LD+SLRILQD+++DS                               N P 
Sbjct: 234 LFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRVKNKPR 293

Query: 584 LFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFV 643
           LFQLL+LV+DS+GLFAL++  L++LS YID Q+++ + N +L++L+D  N        F 
Sbjct: 294 LFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERN--------FK 345

Query: 644 TSTSKDSNTSLKLQEEVLPKYSVEYLDL 671
               +    SL + E  +  YSVE L+L
Sbjct: 346 NILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  270 bits (689), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 227/693 (32%), Positives = 341/693 (49%), Gaps = 106/693 (15%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPS+SQPF +T +PK +S S   + S  +  N       +N + + IS  +VS++++NPT
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSHSLTAN-------SNSLDVAISKYAVSKFVINPT 53

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120
           PKLI + PIPS  +VTA +        +  +  AT+ N+  TL+L            +G 
Sbjct: 54  PKLINSIPIPSNEVVTAFH--------DTVFATATV-NQKYTLHL------------NGK 92

Query: 121 SAPSDSSVTSEFKIKADDHVVDXXXXXXXXXXXXXXXXXXQTYDFELKLLNSINMAYN-- 178
             P  S +   F  ++    +                   + YD  L     I   Y   
Sbjct: 93  KVPIQSKIMKLFSDESQTITI-------------LENGTIEKYDSNL-----IKSTYKTP 134

Query: 179 -----NVRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILEN 233
                NV F+E          + L   +N    + L+ IN  IE  N + ++    +  +
Sbjct: 135 HKDLVNVEFIES--------KYALLISQN---SISLYDINTMIELRNVANVQ--DIVDSD 181

Query: 234 FPLENAKFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPN 293
           F   + K  YQF +  KL+  K  ++ +        IT+P I D+++   VVSF  +  N
Sbjct: 182 FKSLDGKL-YQFNQ--KLS--KFDIWEISSMTIVNIITIPFINDVEKD--VVSFTVVDDN 234

Query: 294 RILLTVNNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGS 353
            +++ VN+ IY L+L  +S++S  EL +LK F+L+         N +    +G+S    +
Sbjct: 235 CVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLID--------NLSNQFVLGLS---FN 283

Query: 354 NPTSSLELLNVDVGTS-TIKDSLGKSFQT----SSTENNVQSLKSLFD----DENDYSDK 404
           N     EL+N+D+ ++  +KDSLGK F+       +E     LKSLF     DE+ ++D 
Sbjct: 284 NENYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDS 343

Query: 405 KKQVKN-FNYEKIYKELVDSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIID 463
              V++ FNY+KI  +L  +  + +              E+YTE DRF+ N +FL ++I+
Sbjct: 344 DSDVEHTFNYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIE 403

Query: 464 LIFETFK-----EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXX 518
           LI + +K       YPKT TYLLT PLFP+  TK LL +    PRL+KQAIVTC      
Sbjct: 404 LILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLG 463

Query: 519 XXXXXXFTISNGELSLDISLRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDT 578
                 FTI N ELSLDISLR+LQDYT+DS                           +D 
Sbjct: 464 ELLADLFTIENNELSLDISLRVLQDYTKDS----IKEQIKLLPKVDIRNFIEFVTQDEDQ 519

Query: 579 TNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYK 638
             +  LFQLLSL++DSIGLFALD  +L R+S +I+E+  +A+ N+EL HLLDY+     K
Sbjct: 520 QVSSQLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYN---PSK 576

Query: 639 NDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671
                 S+   +N +  L  + LP Y+VE+LDL
Sbjct: 577 QSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  222 bits (566), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 150/435 (34%), Positives = 223/435 (51%), Gaps = 26/435 (5%)

Query: 244 QFGKFYK--LTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNN 301
             GK Y+  L  +   ++ L        + +P ++  K     ++F  +  +R+ L + N
Sbjct: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAP--LTFTVVGDSRVCLALAN 249

Query: 302 KIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGSNPTSSLEL 361
           +IYLLDL   S+LS  +   LK  +L+  A       ++ + AI +S     N  S L++
Sbjct: 250 EIYLLDLHLGSVLSHNKFAQLKQVELIAGA-------RDGSFAIALSHGPQDNAVS-LDI 301

Query: 362 LNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKIYKELV 421
           +N+++G+ +IKDSLGK F T   E      +       D  DK K  ++F+Y  I K+L 
Sbjct: 302 INLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTK--RSFDYASILKKLT 359

Query: 422 DSKNDVTXXXXXXXXXXXXXXEYYTEKDRFIYNHEFLVQIIDLIFETFKEE----YPKTF 477
            +  D                E YTE DRFI +  FL + + +I + +  E    YP  F
Sbjct: 360 AAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAF 419

Query: 478 TYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCXXXXXXXXXXXXFTISNGELSLDIS 537
           TYLLT PLFP ++T+ LL+++   PRL+KQ IVTC            F I N ELSLD+S
Sbjct: 420 TYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLS 479

Query: 538 LRILQDYTRDSXXXXXXXXXXXXXXXXXXXXXXXXXXXKDTTNA-PHLFQLLSLVVDSIG 596
           L+ILQDYT+DS                            +++ A P LFQLLSLV+DSIG
Sbjct: 480 LKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIG 539

Query: 597 LFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKL 656
           LFALD  +L  L+ YID  V IA+ NTELW+LL+      ++ +K   + S  S   +K 
Sbjct: 540 LFALDGELLTELAGYIDNMVKIAEMNTELWNLLE------FRTNKASVAGSNRSKY-VKT 592

Query: 657 QEEVLPKYSVEYLDL 671
           Q++V P Y V++L++
Sbjct: 593 QKKVFPPYLVDHLEI 607

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 51/92 (55%), Gaps = 8/92 (8%)

Query: 3  SLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPTPK 62
          S+SQPF +  +P+ AS +        + ++  + +   N + + +S  S+SQYI+NPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LIFNFPIPSTNIVTAC-NVFEQKGSSEETWCF 93
          L+ +  IPS   VTA  N      S+ +++C 
Sbjct: 57 LVNSKAIPSNLTVTAFDNGVYATQSNNKSFCL 88

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  173 bits (438), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 135/223 (60%), Gaps = 22/223 (9%)

Query: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60
           MPS+SQPFRLT LPKIASL+N+A Q  Y+QV D T +P TN++ +GISGS++SQY++NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVAD-TLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLIFNFPIPSTNIVTACNVFEQKGS-------SEETWCFATMANKTSTLNLINKNQYQT 113
           PKL++N PI STN+VTAC+V E  G+       + E  C+A  ANKT ++  + K     
Sbjct: 60  PKLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPI--- 116

Query: 114 NEEESGDSAPSDSSVTSEF---KIKADDHVVDXXX-XXXXXXXXXXXXXXXQTYDFELKL 169
                  SA +DSS    +   K+   +  V+                   Q +D++LKL
Sbjct: 117 ------PSAATDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKL 170

Query: 170 LNSINMAYNNVRFVEHF-HEDGKDFMFVLCDLENDKVCLKLFQ 211
            +SI+ +Y NV+FV+HF  E  +DFMF+L DL+  KV  KL +
Sbjct: 171 QHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>Suva_4.458 Chr4 (799298..802066) [2769 bp, 922 aa] {ON} YBR203W
           (REAL)
          Length = 922

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 201 ENDKVCLKLFQINENIETINDSAIELTSTILENFPLEN-----AKFCYQFGKFYKLTDDK 255
            ++K+  + + +      IND  IEL + IL  F L +      +  Y   KFYK T  K
Sbjct: 168 RHEKLRKRKYHVFGKFADINDLPIELVAEILSEFELGHDQKTLVRCLYVSKKFYKAT--K 225

Query: 256 ILVYSLPQFQFQYSIT 271
           I++Y  P F   Y + 
Sbjct: 226 IVLYEQPYFTSTYRVA 241

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,774,874
Number of extensions: 3106661
Number of successful extensions: 14192
Number of sequences better than 10.0: 72
Number of HSP's gapped: 14626
Number of HSP's successfully gapped: 79
Length of query: 671
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 555
Effective length of database: 40,180,143
Effective search space: 22299979365
Effective search space used: 22299979365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)