Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008203.490ON2022029401e-130
TDEL0D055803.490ON1931943104e-35
ZYRO0D10032g3.490ON2091992923e-32
Suva_7.4173.490ON2122162881e-31
KLTH0F14784g3.490ON1952002801e-30
NDAI0G009503.490ON2132012768e-30
YGR129W (SYF2)3.490ON2152082593e-27
Smik_6.2253.490ON2132142584e-27
SAKL0F02816g3.490ON1922022556e-27
Kwal_55.212263.490ON1961982541e-26
CAGL0I10538g3.490ON2001962452e-25
Skud_7.4403.490ON2132112453e-25
Kpol_480.153.490ON2071902332e-23
Ecym_12393.490ON1931952112e-20
AFR308W3.490ON1921952061e-19
KLLA0E04643g3.490ON2211961992e-18
TBLA0C044703.490ON2222151826e-16
TPHA0D042403.490ON2092161581e-12
KNAG0B008203.490ON2071771132e-06
KAFR0C019503.490ON157197991e-04
Kwal_27.102108.852ON27878850.013
SAKL0H07876g8.624ON103241760.25
KLLA0F11814g3.292ON93188730.63
Ecym_83098.624ON102737720.74
NDAI0A022207.297ON47653720.78
Skud_16.1558.624ON103241711.1
KNAG0J014208.624ON105336701.4
Smik_6.3248.624ON103241692.1
NCAS0C014308.624ON102941692.1
Kpol_530.128.624ON103036682.6
YPL125W (KAP120)8.624ON103241682.7
KNAG0E027101.347ON42341673.0
Suva_16.1858.624ON103241673.6
TDEL0A057008.624ON103137664.2
TBLA0J004708.624ON103641665.2
NDAI0E021708.624ON102941655.4
ACR159C8.624ON102540656.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00820
         (202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   366   e-130
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   124   4e-35
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   117   3e-32
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   115   1e-31
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   112   1e-30
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...   110   8e-30
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   104   3e-27
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   103   4e-27
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   102   6e-27
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   102   1e-26
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    99   2e-25
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    99   3e-25
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    94   2e-23
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    86   2e-20
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    84   1e-19
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    81   2e-18
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    75   6e-16
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    65   1e-12
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    48   2e-06
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    43   1e-04
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...    37   0.013
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    34   0.25 
KLLA0F11814g Chr6 complement(1089699..1092494) [2796 bp, 931 aa]...    33   0.63 
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    32   0.74 
NDAI0A02220 Chr1 (500381..501811) [1431 bp, 476 aa] {ON} Anc_7.2...    32   0.78 
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    32   1.1  
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    32   1.4  
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    31   2.1  
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    31   2.1  
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    31   2.6  
YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}  KAP120Ka...    31   2.7  
KNAG0E02710 Chr5 (537156..538427) [1272 bp, 423 aa] {ON} Anc_1.3...    30   3.0  
Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL12...    30   3.6  
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    30   4.2  
TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.6...    30   5.2  
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    30   5.4  
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    30   6.8  

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  366 bits (940), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 185/202 (91%), Positives = 185/202 (91%)

Query: 1   MIDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEE 60
           MIDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEE
Sbjct: 1   MIDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEE 60

Query: 61  DADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTT 120
           DADDKVAKLMNYTLRQYEEWE                 LAMFSYDKGVSNLNRFRTDKTT
Sbjct: 61  DADDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTT 120

Query: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180
           TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI
Sbjct: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180

Query: 181 NERNKHFNEKLDRESRYGEEQN 202
           NERNKHFNEKLDRESRYGEEQN
Sbjct: 181 NERNKHFNEKLDRESRYGEEQN 202

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  124 bits (310), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 118/194 (60%), Gaps = 8/194 (4%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +DLE    + K+LK+++ D  I+ R + +RE+KD    GKP++Y+M+D   N++ T+  D
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDT--NEMGTRPVD 58

Query: 62  ADDKV-AKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTT 120
           + ++   KLMNY++R+YEEW+                 LA +SY+K +S     R+ +  
Sbjct: 59  SSERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLS-----RSKQNN 113

Query: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180
             R V+I  ++KT ++ ++D++KLVN LA +L KT  +R++  KK ++     ++  GYI
Sbjct: 114 GNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYI 173

Query: 181 NERNKHFNEKLDRE 194
           NE+NK FN KLDR+
Sbjct: 174 NEKNKQFNLKLDRQ 187

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  117 bits (292), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 120/199 (60%), Gaps = 11/199 (5%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +DL+ + +    LK+K+ + ++ENR LV+ ESK++ +  KPRVY ++  + + L TQ   
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPS-LPTQ--- 66

Query: 62  ADDKVA-KLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNR--FRTDK 118
            DDK   +LMNYT++QYEEW                  +A ++YDK ++ L++     ++
Sbjct: 67  -DDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNR 125

Query: 119 TTTEREVQ-IQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARS--KDSS 175
            T    +Q +  N KTGK+ I+D+ +LV  LAK++ KTA +RY   +++++  +    SS
Sbjct: 126 YTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASS 185

Query: 176 AEGYINERNKHFNEKLDRE 194
             GYINE+NK FNEKLDR+
Sbjct: 186 GGGYINEKNKQFNEKLDRQ 204

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  115 bits (288), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 118/216 (54%), Gaps = 22/216 (10%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQL--ETQE 59
           +DLE    KLKELKR+  DA+++ R L DRE ++  S+ KPRVY+M+D  D++L  ET+ 
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 60  EDADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXX---LAMFSYDKGVSNL---NR 113
           +D D    +  +YT+++Y  WE                    LA  SYDK + NL   N 
Sbjct: 61  DDKD----RAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNY 116

Query: 114 FRTDKTTTEREVQ----------IQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVT 163
            + + +  E++ +          IQ NS TGK+ I D+ +LVN LA  L   + KR+   
Sbjct: 117 GKHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDAR 176

Query: 164 KKKLDARSKDSSAEGYINERNKHFNEKLDRESRYGE 199
           K++++     S  E +IN++NK FNEKL RESR  E
Sbjct: 177 KRQMENVKTPSGVESFINDKNKQFNEKLGRESRGSE 212

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  112 bits (280), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 114/200 (57%), Gaps = 7/200 (3%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +DL  Y+ +LK LKRK    +++N+  + +E K   +  KP VY+M+ ++    ET EE 
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXX-XXLAMFSYDKGVSNLNRFRTDKTT 120
              K AKL+ Y+++ +E+W+                  LA F+YDK V  L +  T+K  
Sbjct: 61  ---KEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKNYTNKVE 117

Query: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYI 180
             ++V I   +K GK+ ++D+  LV  LA +L KTAN+RY   +KK+  +    +  G+I
Sbjct: 118 KPKKVSI---NKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFI 174

Query: 181 NERNKHFNEKLDRESRYGEE 200
           NE+NK FN+K++R+++  EE
Sbjct: 175 NEKNKQFNDKIERQTKKREE 194

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score =  110 bits (276), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 118/201 (58%), Gaps = 10/201 (4%)

Query: 3   DLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQ--DDQDNQ------ 54
           +L+ Y   LK LKR   D   ENR   D+E K+   S KP+VY+++  +D DN       
Sbjct: 5   ELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDG 64

Query: 55  LETQEEDADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXX-XXLAMFSYDKGVSNLNR 113
           L     + + +  KLMNYT+R+YEEW+                  LA F+Y+K +S LN 
Sbjct: 65  LGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKLNS 124

Query: 114 FRTDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKD 173
            + +  + E++ QI VN++ GK+N++DE++L+N+L  NL +TA KRYMV KKKL +++  
Sbjct: 125 -KLENISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASS 183

Query: 174 SSAEGYINERNKHFNEKLDRE 194
             A  Y  ++NK FNEKL+RE
Sbjct: 184 DIAGNYFKDKNKQFNEKLERE 204

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  104 bits (259), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/208 (35%), Positives = 111/208 (53%), Gaps = 19/208 (9%)

Query: 10  KLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           KLKELKRK  D +I++R L DRE +++ ++ KPRVY+M+D  D      + ++ +K  K 
Sbjct: 9   KLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEK-EKA 67

Query: 70  MNYTLRQYEEWEXXXXXXXXXXXXXXXXX---LAMFSYDKGVSNL-----NRFRTDKTTT 121
            +YT+++Y+ WE                    LA  SY+K + NL     N  + D +  
Sbjct: 68  FHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSAD 127

Query: 122 E----------REVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARS 171
           E          R  ++Q ++KTGK+ I D+ KLVN LA +L   + KRY   K+++    
Sbjct: 128 EEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAK 187

Query: 172 KDSSAEGYINERNKHFNEKLDRESRYGE 199
                E +IN++NK FNEKL RES+  E
Sbjct: 188 TLYGVESFINDKNKQFNEKLSRESKGSE 215

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  103 bits (258), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 114/214 (53%), Gaps = 17/214 (7%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           ++L+   ++LKELK+K  + +I+NR L DRE ++   + KPRVYNM+D  D        +
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXX---LAMFSYDKGVSNL------- 111
           + DK  +  +YT ++Y  WE                    LA  SY+K + NL       
Sbjct: 61  SSDK-DRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSE 119

Query: 112 -NRFRTDK-----TTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK 165
            + F  +K     +   R  +IQ ++KTGK+ I D+ KLVN LA +L   + KRY   K+
Sbjct: 120 YDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKR 179

Query: 166 KLDARSKDSSAEGYINERNKHFNEKLDRESRYGE 199
           ++++    S  E +IN++NK FNEKL RESR  E
Sbjct: 180 QMESAVIPSGVESFINDKNKQFNEKLSRESRNSE 213

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  102 bits (255), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 112/202 (55%), Gaps = 26/202 (12%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +DL     KLK LKRK  D +++NR   ++E K  + SGKP+VY+M +D+    + Q+E 
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDE--TFKDQKE- 57

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGV------SNLNRFR 115
            +D   KL+NY+++ YE+W+                 LA ++YDK +       +LNR +
Sbjct: 58  -EDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSLNRGK 116

Query: 116 TDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK---KLDARSK 172
             K         ++N K G++ I D+KK +  LA NL K+  +RY+  KK   KLD+   
Sbjct: 117 VTKA--------RLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS--- 164

Query: 173 DSSAEGYINERNKHFNEKLDRE 194
            S+  G+IN++NK FNEKL R+
Sbjct: 165 -STTGGFINDKNKQFNEKLSRQ 185

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  102 bits (254), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 116/198 (58%), Gaps = 11/198 (5%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +DL  Y+ +LK LKRK  D +++N+  V RE K + +S KP VY+M     N    +EE 
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSM-----NAEGAEEEI 55

Query: 62  ADD--KVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXX-LAMFSYDKGVSNLNRFRTDK 118
           A D  +  KL+ Y++ +YE+W+                  LA  +YDK V  L++   D 
Sbjct: 56  AKDVTEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSKI--DG 113

Query: 119 TTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG 178
               +  + +VN+K GK+ ++D+++LV  L + L KTA++RY   +KK+  +  ++++ G
Sbjct: 114 NRVNKNTKYRVNNK-GKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNTTSGG 172

Query: 179 YINERNKHFNEKLDRESR 196
           YINE+NK FN+KL+R+++
Sbjct: 173 YINEKNKQFNDKLERQTK 190

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 99.0 bits (245), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 107/196 (54%), Gaps = 8/196 (4%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           ++LE Y+ KLK LK+  QD  I NR L+ +E+++ E   KPRVY+M DD+D+  E +  D
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 62  -ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXX----XXLAMFSYDKGVSNLNRFRT 116
              D    L  YT++ + +WE                     LA  +YDK + NL   R 
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLP--RP 118

Query: 117 DKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSA 176
           +     +E Q ++N  +GKVNI+D K+LV  L++NL +TA +RY  + +K+    + +S 
Sbjct: 119 EFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRY-DSNRKIANDKEHTSL 177

Query: 177 EGYINERNKHFNEKLD 192
            G IN +N  FN+ LD
Sbjct: 178 SGSINAKNLQFNKSLD 193

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 99.0 bits (245), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 110/211 (52%), Gaps = 17/211 (8%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           ++L+   +KLK LKRK  + +I+NR L DRE ++   + KP+VY+M+D  D     ++ +
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXX---LAMFSYDKGVSNL------- 111
             DK  K  +YT+++Y  W+                    +A  SY+K + NL       
Sbjct: 61  TSDK-DKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLVTQNSNK 119

Query: 112 -----NRFRTDKTTTEREVQ-IQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK 165
                N+  ++ +     +  IQ N KTGK+ I D+ KLVN LA  L   + KRY   +K
Sbjct: 120 NENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRK 179

Query: 166 KLDARSKDSSAEGYINERNKHFNEKLDRESR 196
           +++     SS E +IN++NK FNEKL RE +
Sbjct: 180 QMENAKTPSSVESFINDKNKQFNEKLSREPK 210

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 94.4 bits (233), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/190 (33%), Positives = 107/190 (56%), Gaps = 9/190 (4%)

Query: 11  LKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQD-DQDNQLETQEEDADDKVAKL 69
            K LKRKA D  IENR L+D  +++++ + KP+ Y+M++  +D+ + T   D  D+   L
Sbjct: 12  FKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTVDEADR---L 68

Query: 70  MNYTLRQYEEWEXXXXXXX-----XXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTTTERE 124
           +NY++R+YEEWE                      +A F+YDK +  L + ++      + 
Sbjct: 69  LNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTNDNRGKI 128

Query: 125 VQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINERN 184
            +I+ + KTGK+ + D K+L+  LA++L +T  +RY  T +K    S  +    YINE+N
Sbjct: 129 SKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINEKN 188

Query: 185 KHFNEKLDRE 194
           K FN+KL+R+
Sbjct: 189 KEFNDKLERQ 198

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 85.9 bits (211), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 108/195 (55%), Gaps = 10/195 (5%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRL-LVDRESKDIESSGKPRVYNMQDDQDNQLETQEE 60
           +D++  S +L+ LK K  D +I+NR  +V  E   +  S KP VY++ D+     E Q  
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNEVQST 59

Query: 61  DADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTT 120
              ++  KL+NY+L  YE+W+                 +A  +Y   +  L   R    T
Sbjct: 60  SNTER-RKLLNYSLIDYEKWDEKEKQANFDGTYSGD--IAYSTYKNEIKQL---RKGGLT 113

Query: 121 TEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG-Y 179
             +  + ++ S++GKV I+DEK+LVN LA+ L KT+ +R++  KK+LD    ++S  G +
Sbjct: 114 KGKITKGRI-SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNF 172

Query: 180 INERNKHFNEKLDRE 194
           +NE+N+HFNEKL R+
Sbjct: 173 VNEKNRHFNEKLSRQ 187

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 84.0 bits (206), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 103/195 (52%), Gaps = 7/195 (3%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           + +E  +R+L++LK+K  DA+I NR     E +   + GKPRVY+M ++  ++ E  +  
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ 60

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTTT 121
           ++    KL+NY +  YE+W+                 LA  +Y    S L++        
Sbjct: 61  SEQ--LKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYR---SELHQLHRRGVVK 115

Query: 122 EREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYIN 181
            R    ++ S +GKV + DE +LV  LA  + +TA +R+   +KK  A+    +  G +N
Sbjct: 116 GRATNGRI-SASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKA-AKDGGRATAGSLN 173

Query: 182 ERNKHFNEKLDRESR 196
           ++N+HFNEKLDRE R
Sbjct: 174 DKNRHFNEKLDREFR 188

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 81.3 bits (199), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 107/196 (54%), Gaps = 14/196 (7%)

Query: 1   MIDLEGYSRKLKELKRKAQDATIENR-LLVDRESKDIESSGKPRVYNMQDDQDNQLETQE 59
           M DL    +KLK L+++  + +I N+  ++  E K+ E     RVY+M DD +++  + +
Sbjct: 36  MNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKKNSER----RVYSMADDGEDKARSNK 91

Query: 60  EDADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXX-XXXLAMFSYDKGVSNLNRFRTDK 118
            + +D + KL NY++R+YE+WE                  +A  SY K V  L +     
Sbjct: 92  SEPEDPI-KLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPK----- 145

Query: 119 TTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEG 178
                 ++  + ++ GKV ++D  +LV  +  +L + + KRYMV K+KLD ++K +  +G
Sbjct: 146 -DISHPLKGGI-TEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDG 203

Query: 179 YINERNKHFNEKLDRE 194
           +IN++NK FN KL+ E
Sbjct: 204 FINDKNKRFNAKLNSE 219

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 74.7 bits (182), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 106/215 (49%), Gaps = 25/215 (11%)

Query: 1   MIDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQD-NQLETQE 59
           M D+       K LK KA++  I N+  +        ++ KP+VY+M D+ D ++L   +
Sbjct: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60

Query: 60  EDA------DDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXX-------XXLAMFSYDK 106
           E+A      +++++KLMNYTLR+Y++WE                        LA  +YDK
Sbjct: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120

Query: 107 GVSNLN---RFRTDKTTTEREVQIQVNSK--TGKVNIQDEKKLVNDLAKNLTKTANKRYM 161
            +  LN   R       + +  +I  N +  + K+ I+D+K LV +L  NL   +++ Y 
Sbjct: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLY- 179

Query: 162 VTKKKLDARSKDSSA--EGYINERNKHFNEKLDRE 194
              K L  R K+ S    G++N +N+ FNEKL RE
Sbjct: 180 ---KHLGERRKNYSTTLSGHVNTKNQEFNEKLTRE 211

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 65.5 bits (158), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 102/216 (47%), Gaps = 33/216 (15%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNM-------QDDQDNQ 54
           +D+     + K LK++A D+ IE+R  ++ + K+ +S  KP+VY++        D  D+ 
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 55  LETQEEDADDKVAKLMNYTLRQYEEWEXXXXXXXXXXX-----XXXXXXLAMFSYDKGVS 109
           L    E A      L+ YT+R YEEWE                       A F+YDK + 
Sbjct: 61  LTNNSERA------LLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIH 114

Query: 110 NL----NRFRTDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKK 165
            +     +F TD+  T      +V    GK+ I+D+K LVN    ++ K +N RY + + 
Sbjct: 115 RMKKRQGKFATDEEITRGSAMKEV-LDDGKLLIKDDKHLVNGFISDINKVSNDRY-IKRM 172

Query: 166 KLDARSKDSSAE---------GYINERNKHFNEKLD 192
           KL+A + D++            Y N +NK FN+KL+
Sbjct: 173 KLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 81/177 (45%), Gaps = 38/177 (21%)

Query: 26  RLLVDRESKDIESSGKPRVYNMQ------DDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79
           R+ + ++  ++E   KP+VY++Q      D  D       E  D+   KL+N  LRQ E 
Sbjct: 55  RVRIRKQQAEVE---KPKVYSLQAAEPSVDGIDG-----AEVVDNVTVKLLNTPLRQLEA 106

Query: 80  WEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTTTEREVQIQVNSKTGKVNIQ 139
            E                     + D  V+ +   R  K T ++E+ + +  K+ +   +
Sbjct: 107 REARRGE----------------NGDDAVARVEGDRVAKDTYKKELAL-LGRKSTRGTYR 149

Query: 140 DEKKLVNDLAKNLTKTANKRYMVTKKKL---DARSKDSSAEGYINERNKHFNEKLDR 193
           D    V  L  +L   + KRY+V K K+    AR   SS +GYINE+NK FN+KL R
Sbjct: 150 DN---VERLVTHLNDVSKKRYLVRKNKMKRQGARG-GSSLDGYINEKNKQFNKKLQR 202

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 87/197 (44%), Gaps = 44/197 (22%)

Query: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61
           +D+     + ++L++K ++  IENR L       I  + KP+ Y++++++     + E++
Sbjct: 3   MDMANLREEFRDLRKKCREIKIENRKL-------ISIASKPKTYSIREEEIGAEVSDEDE 55

Query: 62  ADDKVAKLMNYTLRQYEEWEXXXXXXXXXXXXXXXXXLAMFSYDKGVSNLNRFRTDKTTT 121
            D ++ KL+   LR++E                    +   +Y+K V +L +        
Sbjct: 56  DDSEIIKLLTKPLREFE---------TEAHVAENKEDIDRLTYNKEVMSLGK-------- 98

Query: 122 EREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYIN 181
                              EK+ V  L   + + +++RY    +K   R KD+   G+IN
Sbjct: 99  ------------------REKRDVESLVSEMNRISDERYKKGAQK-RRRLKDTE-RGFIN 138

Query: 182 ERNKHFNEKLDRESRYG 198
           E+NK FN +L++E   G
Sbjct: 139 EQNKAFNLRLEKEKENG 155

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 129 VNSKTGKVNIQD---EKKLVNDLAKNLTKTANKRYMVTKKKLD-ARSKDSSAEGYINERN 184
           V   +G++N +    E K ++D+ K + K  N+RY+ +  K+D  R K SS   ++ ++ 
Sbjct: 71  VTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSSVAEFVPQKV 130

Query: 185 KHFN-EKLDRESRYGEEQ 201
            H+  E+L  +S+ G  Q
Sbjct: 131 VHYKLEELPFKSKSGRTQ 148

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 28/41 (68%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           V+  SKD ++S + R+++M D+Q+NQL  Q   A  ++A+L
Sbjct: 85  VNAISKDEKASIRSRLFDMIDEQNNQLCIQNAQASARIARL 125

>KLLA0F11814g Chr6 complement(1089699..1092494) [2796 bp, 931 aa]
           {ON} similar to uniprot|P38086 Saccharomyces cerevisiae
           YBR073W RDH54 DNA-dependent ATPase stimulates strand
           exchange by modifying the topology of double-stranded
           DNA involved in the recombinational repair of
           double-strand breaks in DNA during mitosis and meiosis
           proposed to be involved in crossover interference
          Length = 931

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 99  LAMFSYDKGVSNLNRF-RTDKTTTEREVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTAN 157
           L + +  K + N  R  +TD    ER  Q+Q +S +GK      + L++ L +  TKT  
Sbjct: 594 LGLITLFKKICNSTRLIKTDPYYEERLSQVQTSSTSGKFTSGKLRILLSLLHELKTKTDE 653

Query: 158 KRYMVT--KKKLDARSKDSSAEGYINER 183
           K  +++   + LD      S+EGY + R
Sbjct: 654 KVVVISNYTQTLDIIEGHCSSEGYTSAR 681

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 32.3 bits (72), Expect = 0.74,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 26/37 (70%)

Query: 33  SKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           SKD +SS + R+++M ++++NQL  Q   A  K+A+L
Sbjct: 86  SKDEKSSIRDRLFHMVNEENNQLAIQNAHATAKIARL 122

>NDAI0A02220 Chr1 (500381..501811) [1431 bp, 476 aa] {ON} Anc_7.297
           YDL133W
          Length = 476

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 26/53 (49%)

Query: 144 LVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINERNKHFNEKLDRESR 196
            + ++  N+  +  +RY+V  +  D  S   S +G   E+N HF    D E+R
Sbjct: 124 FIANIGSNVAYSNKQRYVVDSESTDTESSAHSFDGSFREKNAHFLSSYDDETR 176

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           ++  SKD ++S + R++ M D+Q+NQL  Q   A  ++A+L
Sbjct: 82  INAISKDEKASIRGRLFEMIDEQNNQLCIQNAQAAARIARL 122

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 25/36 (69%)

Query: 34  KDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           KD ++S + R++++ D+Q+NQL  Q   A  K+A+L
Sbjct: 90  KDEKASIRARLFDLIDEQNNQLCIQNAQATSKIARL 125

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           V+   KD ++S + R++ M D+Q+NQL  Q   A  ++A+L
Sbjct: 82  VNAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQAAARIARL 122

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           V   +KD ++S + R+++M D+Q+NQL  Q   A  ++A+L
Sbjct: 84  VHCINKDEKASIRTRLFDMIDEQNNQLGIQYAQATARIARL 124

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 24/36 (66%)

Query: 34  KDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           KD ++S + R++ + D+Q+NQL  Q   A  K+A+L
Sbjct: 86  KDEKASIRARLFELIDEQNNQLAIQNSQAAAKIARL 121

>YPL125W Chr16 (313388..316486) [3099 bp, 1032 aa] {ON}
           KAP120Karyopherin responsible for the nuclear import of
           ribosome maturation factor Rfp1p
          Length = 1032

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           ++   KD ++S + R++ M D+Q+NQL  Q   A  ++A+L
Sbjct: 82  INAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQASARIARL 122

>KNAG0E02710 Chr5 (537156..538427) [1272 bp, 423 aa] {ON} Anc_1.347
           YJL046W
          Length = 423

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 133 TGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKD 173
           T K+NI+ E  L+ND   NLT TA     V   KL  RS+D
Sbjct: 75  TSKINIKTEIDLLNDELANLTDTA-----VPPHKLPLRSED 110

>Suva_16.185 Chr16 (322908..326006) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 26/41 (63%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           ++   KD ++S + R++ M D+Q+NQL  Q   A  ++A+L
Sbjct: 82  INAIPKDEKASIRGRLFEMIDEQNNQLCIQNAQAAARIARL 122

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 30.0 bits (66), Expect = 4.2,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 25/37 (67%)

Query: 33  SKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           +KD + S + R++++ D+Q+NQL  Q   A  K+A+L
Sbjct: 88  NKDEKISIRGRLFDLIDEQNNQLSIQNAQAAAKIARL 124

>TBLA0J00470 Chr10 (85713..88823) [3111 bp, 1036 aa] {ON} Anc_8.624
           YPL125W
          Length = 1036

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 27/41 (65%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           ++  SKD ++S + R++ + D+Q+NQL  Q   A  ++A+L
Sbjct: 85  INAISKDEKASIRNRLFEVLDEQNNQLCIQNAQATARIARL 125

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 26/41 (63%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKL 69
           V   +KD ++S + R++ + D+Q+NQL  Q   A  K+A+L
Sbjct: 84  VHAINKDEKASIRARLFELIDEQNNQLGIQYAQAIAKIARL 124

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 29.6 bits (65), Expect = 6.8,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 29  VDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAK 68
           V+  SKD + S + R++ M D+Q+NQL  Q   A  ++A+
Sbjct: 82  VNAISKDEKQSIRARLFEMVDEQNNQLCIQNAHACARIAR 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,250,373
Number of extensions: 843280
Number of successful extensions: 6515
Number of sequences better than 10.0: 164
Number of HSP's gapped: 6455
Number of HSP's successfully gapped: 165
Length of query: 202
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 98
Effective length of database: 41,556,135
Effective search space: 4072501230
Effective search space used: 4072501230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)