Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008103.492ON69269233070.0
NDAI0G009403.492ON65670613561e-179
Skud_7.4413.492ON80755610101e-125
YGR130C3.492ON81647010061e-125
Smik_6.2263.492ON83949010041e-124
Suva_7.4183.492ON8315099621e-118
CAGL0I10516g3.492ON8134257255e-84
SAKL0F02772g3.492ON7734707009e-81
ZYRO0D09988g3.492ON9943826011e-65
TDEL0D056003.492ON7003325882e-65
KLLA0D16236g3.492ON8715625891e-64
KLTH0F14828g3.492ON8364315521e-59
KNAG0B008103.492ON7576525472e-59
Kwal_55.212293.492ON7874625148e-55
Kpol_480.143.492ON6993665047e-54
TPHA0D042503.492ON6293674401e-45
KAFR0C019603.492ON5634693576e-35
Ecym_12373.492ON7272702172e-17
AFR310C3.492ON6232501887e-14
KAFR0G036903.492ON3633291544e-10
TBLA0C044803.492ON802941469e-09
KNAG0A079403.492ON2751601382e-08
NCAS0F035503.492ON44189940.010
ZYRO0B08228g5.88ON1293250850.17
SAKL0B11990g2.618ON90472790.84
NDAI0B058603.492ON681226780.97
Skud_4.1964.238ON1792281743.2
Skud_13.2602.452ON34463733.2
Kwal_26.83122.590ON89649733.9
KAFR0F030204.46ON824106724.4
ZYRO0B04290g3.479ON73156724.7
Kpol_1065.363.330ON1219113725.9
CAGL0L12914g2.590ON88549716.5
KLTH0F15598g5.453ON96050717.6
KNAG0D043404.238ON2220310709.1
Smik_4.6225.414ON944149709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00810
         (692 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...  1278   0.0  
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   526   e-179
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   393   e-125
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   392   e-125
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   391   e-124
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   375   e-118
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   283   5e-84
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   274   9e-81
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   236   1e-65
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   231   2e-65
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   231   1e-64
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   217   1e-59
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   215   2e-59
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   202   8e-55
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   198   7e-54
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   174   1e-45
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   142   6e-35
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    88   2e-17
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    77   7e-14
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    64   4e-10
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    61   9e-09
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    58   2e-08
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    41   0.010
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    37   0.17 
SAKL0B11990g Chr2 complement(1031509..1034223) [2715 bp, 904 aa]...    35   0.84 
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    35   0.97 
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   3.2  
Skud_13.260 Chr13 complement(443782..444816) [1035 bp, 344 aa] {...    33   3.2  
Kwal_26.8312 s26 complement(735774..738464) [2691 bp, 896 aa] {O...    33   3.9  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    32   4.4  
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...    32   4.7  
Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON} (76145...    32   5.9  
CAGL0L12914g Chr12 complement(1379249..1381906) [2658 bp, 885 aa...    32   6.5  
KLTH0F15598g Chr6 complement(1274669..1277551) [2883 bp, 960 aa]...    32   7.6  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    32   9.1  
Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356...    32   9.8  

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 1278 bits (3307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/692 (92%), Positives = 637/692 (92%)

Query: 1   MPSSILSFKRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXX 60
           MPSSILSFKRRDDPFDHLF         KHNTSMAPRTTSSFLQRVV             
Sbjct: 1   MPSSILSFKRRDDPFDHLFEEAEAAEAAKHNTSMAPRTTSSFLQRVVSTTSSTTQKQPKK 60

Query: 61  XIAASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQ 120
            IAASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQ
Sbjct: 61  KIAASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQ 120

Query: 121 NFAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAPTPVAS 180
           NFAKDIYFPNYLTENEQRQQA             YLQDSQNIIDLTKKQEPKKAPTPVAS
Sbjct: 121 NFAKDIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLTKKQEPKKAPTPVAS 180

Query: 181 TTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPAL 240
           TTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPAL
Sbjct: 181 TTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPAL 240

Query: 241 APMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQ 300
           APMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQ
Sbjct: 241 APMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQ 300

Query: 301 QHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQL 360
           QHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQL
Sbjct: 301 QHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQL 360

Query: 361 VKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSE 420
           VKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSE
Sbjct: 361 VKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSE 420

Query: 421 YDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSN 480
           YDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSN
Sbjct: 421 YDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSN 480

Query: 481 VKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXX 540
           VKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDER     
Sbjct: 481 VKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEE 540

Query: 541 XXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQE 600
                         NLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQE
Sbjct: 541 QLQLEAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQE 600

Query: 601 QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPL 660
           QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPL
Sbjct: 601 QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPL 660

Query: 661 AALAREITGEAKPSSKDNSLYDYETEEDVMYV 692
           AALAREITGEAKPSSKDNSLYDYETEEDVMYV
Sbjct: 661 AALAREITGEAKPSSKDNSLYDYETEEDVMYV 692

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  526 bits (1356), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 319/706 (45%), Positives = 442/706 (62%), Gaps = 80/706 (11%)

Query: 10  RRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSS-----------FLQRVVXXXXXXXXXXX 58
           +++DPF+HL                 P+TT S           FLQRV+           
Sbjct: 8   KKNDPFEHLLNPQ-------------PKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPT 54

Query: 59  XXXIAASEAKAMSDYASPFRAEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTT 115
               ++ +  +  +Y SPFR+     N   +QNEKT+RFPTVSATSNYT +  K+ GF  
Sbjct: 55  TSS-SSKKKVSTEEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKK 113

Query: 116 IKKGQNFAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAP 175
           I K +NFAKDI+FP+YLT+NEQRQQ              Y +DSQNIIDLTK+    ++P
Sbjct: 114 IPKDKNFAKDIFFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLTKQPSQSQSP 173

Query: 176 TPVASTTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPP 235
           +P+       D A      + + I+P                                  
Sbjct: 174 SPLD------DSANAEKPPLEKPIDP---------------------------------- 193

Query: 236 IDPALAPMVPFSLATP--NQKSKKETEAP---EKPSNPVASPTNQEEIVKTAQFGYLSKA 290
               L PMV F L+TP  N K+KK    P   EK  NP A+P ++EEIVKT +FG LSK+
Sbjct: 194 ---KLTPMVSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFGILSKS 250

Query: 291 VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTK 350
           +YD++QYD+QQH+++LA Y+ +  EKY+ KMQEY+  L+ +D ++   N+LIE+C+ DT 
Sbjct: 251 IYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTD 310

Query: 351 EKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDEL 410
            K+D+M+ +LVK++FD++ VQ +DKMKIF+ETK IK EK+ EK NV   + +V   ID+L
Sbjct: 311 AKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINVEELDDQVVGEIDQL 370

Query: 411 TNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEI 470
             EK KV  E++ WT NMTNI  +LDAKLFKI QIN+TQMNLQNKID L ++K  L  EI
Sbjct: 371 NKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEI 430

Query: 471 AKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKK 530
             NK  H +NV+ +E+VDNK+YLPKLN+ID++IN LLNQ+T++KQENANEK+QL+E+T+K
Sbjct: 431 EANKFTHANNVETIENVDNKQYLPKLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQK 490

Query: 531 LEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKL 590
           LE ER                   NLLGKQR+ELE KAN +Q+NH+ E+  LK  YE +L
Sbjct: 491 LEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQL 550

Query: 591 EEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSA 650
            +FK++L ++QD++D +K QK+RLEG KA+++Q RQK +D+VLKNEI  KQH+QAEA++A
Sbjct: 551 ADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQKQSDNVLKNEILSKQHQQAEAYNA 610

Query: 651 AQLKGRKHPLAALAREITGE----AKPSSKDNSLYDYETEEDVMYV 692
            QL  +K   + +A ++  E    A   +KD+SL++YETEE++MYV
Sbjct: 611 VQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFEYETEEEIMYV 656

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  393 bits (1010), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 235/556 (42%), Positives = 335/556 (60%), Gaps = 52/556 (9%)

Query: 175 PTPVASTTEEIDE-ATFP------HSNISEEINPDYE-------DEEQSSAQNNEQLVLV 220
           P P  ++   + E A  P       +++ +E+NP  E       DEE    + +EQ  + 
Sbjct: 266 PEPAVTSQSNVPESAVLPTEESKSETSVVKEVNPTEEGQTEEVHDEED---EKSEQSSVE 322

Query: 221 QSEEEIHTPNVVEP-------PIDPALAPMVPF------------SLATPNQKSKKETEA 261
           +  EE  TP   E        PIDP+ AP VPF            +L      S  +   
Sbjct: 323 EHGEETSTPETSEAESVEDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGG 382

Query: 262 PEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKM 321
              PSNPVA+P N E IVKT + GYLSKAVYDKI YDE+ H+ WLAD + K+  KY+A  
Sbjct: 383 VTAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATS 442

Query: 322 QEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNE 381
             Y + LQD+ NQ+ E+ + ++    +T EKI+V   +LVK++ D      N K+ IF +
Sbjct: 443 TGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKD 502

Query: 382 TKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFK 441
           T+ +K +KL EK+ VL   T VK  IDEL + K  V+ E+++WTTN++N+  +LDA++FK
Sbjct: 503 TENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFK 562

Query: 442 ISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDN 501
           I+QIN+ Q  +QN+IDAL  +K +L  +  +NK +H+ NV+ +ESV+NKEYLP++NDIDN
Sbjct: 563 INQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDN 622

Query: 502 EINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQR 561
           +++ LLN+MTI++QENANEK +L+ ITK+LEDER                   NLL KQR
Sbjct: 623 QVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQR 682

Query: 562 DELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALD 621
            ELE +A+  Q++H+Q+I  +K  Y  +L E +++L  E+ +L+ VKR++TRL+GEKA++
Sbjct: 683 QELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIE 742

Query: 622 EQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITGEAKPSS-----K 676
           EQ RQK +D+ LK EI  KQHKQAE   AA+    KH        I     P +     K
Sbjct: 743 EQTRQKSSDEALKQEILGKQHKQAEGLHAAE----KH-------NIPNSHSPKNEILVPK 791

Query: 677 DNSLYDYETEEDVMYV 692
           D+SLY+Y TEEDVMY 
Sbjct: 792 DDSLYEYHTEEDVMYA 807

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 60/111 (54%), Gaps = 6/111 (5%)

Query: 62  IAASEAKAMSDYASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPKQKGFTT 115
           + ++E K   ++ SPFR +  + N      V + K ++FPTVSATS Y+ + PK  G+  
Sbjct: 42  VVSNEPKGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKN 101

Query: 116 IKKGQNFAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLT 166
           I K    AKDI FP YLT+NE+RQ               YL++ Q I DLT
Sbjct: 102 IPKNAKRAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLT 152

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  392 bits (1006), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 309/470 (65%), Gaps = 20/470 (4%)

Query: 236 IDPALAPMVPFS-------------LATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTA 282
           IDP+ AP VPF                +P   S ++++    PSNPVA+P N E IVKT 
Sbjct: 354 IDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTA-APSNPVATPENPELIVKTK 412

Query: 283 QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLI 342
           + GYLSKAVYDKI YDE+ H+ WLAD   K+ +KY+AK +EYK+ LQD+ NQ+ E+ + +
Sbjct: 413 EHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSM 472

Query: 343 EKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTE 402
           +    +T EKI+V   +LVKK+ D      N K+ I  +T+ +K +KL EK  VL+  T 
Sbjct: 473 KAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTN 532

Query: 403 VKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQ 462
           VK  ID+L NEK  V+ E+++WTTN++N+  +LDA++FKI+QIN+ Q  +QN+ID L  +
Sbjct: 533 VKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKK 592

Query: 463 KNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKV 522
           K +L  +  +NK +H+ NV+++ESV+NKEYLP++NDIDN+I+ LLN++TI+KQENANEK 
Sbjct: 593 KEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKT 652

Query: 523 QLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDAL 582
           QL+ ITK+LEDER                   NLL KQR ELE +A+  Q++H+Q+I  +
Sbjct: 653 QLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQV 712

Query: 583 KNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQH 642
           K  Y  +L E +++L  E+ +L+ VKR++TRL+ EKA++EQ RQK+AD+ LK EI  +QH
Sbjct: 713 KQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQH 772

Query: 643 KQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETEEDVMYV 692
           KQAE   AA+     H +     +      P  KD+SLY+Y TEEDVMY 
Sbjct: 773 KQAEGIHAAE----NHKIPNDRSQKNTSVLP--KDDSLYEYHTEEDVMYA 816

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 75/166 (45%), Gaps = 26/166 (15%)

Query: 9   KRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXXXIAASEAK 68
           ++ DDPF  L          +   +    +   FLQ+VV                ++E K
Sbjct: 7   RQEDDPFTQLINQSSANTQNQQ--AHQQESPYQFLQKVV----------------SNEPK 48

Query: 69  AMSDYASPFRAEYSNVNVQN-------EKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQN 121
              ++ SPFR + +  N QN        K R+FPTVSATS Y+ + PK  G+  I K   
Sbjct: 49  GKEEWVSPFRQD-ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAK 107

Query: 122 FAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTK 167
            AKDI FP YLT+NE+RQ               YL+  Q I DLTK
Sbjct: 108 RAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLTK 153

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  391 bits (1004), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/490 (45%), Positives = 312/490 (63%), Gaps = 29/490 (5%)

Query: 224 EEIHTPNVVEP-------PIDPALAPMVPF------------SLATPNQKSKKETEAPEK 264
           EE  TP   E        PIDP+ AP VPF            +L   +  S  +      
Sbjct: 358 EETSTPGTSESESEEDKVPIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAA 417

Query: 265 PSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEY 324
           PSNPVA+P   E IVKT + GYLSKAVYDKI YDE+ H+ WL D   ++  KY+AK +EY
Sbjct: 418 PSNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEY 477

Query: 325 KKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQ 384
           ++ LQD+ NQ+ E+ D ++    +T EKI+V   +LVK++ D      N K+ IF +T+ 
Sbjct: 478 EEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTEN 537

Query: 385 IKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQ 444
           +K +KL EK  VLN  T VK  IDEL +EK  V+ ++++WTTN++N+  +LDA++FKI+Q
Sbjct: 538 MKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQ 597

Query: 445 INVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEIN 504
           IN+ Q  +Q++ID+L  +KN L  +  +N+ +H+ NV+++ESV+N+EYLP++NDIDN+I+
Sbjct: 598 INLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVENREYLPQINDIDNQIS 657

Query: 505 GLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDEL 564
            LLN+MTI+KQENANEK QL+ ITK+LEDER                   NLL KQR EL
Sbjct: 658 TLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQEL 717

Query: 565 EAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQK 624
           E +A   Q++H+++I  +K  Y  +L E +++L  E+ +L+ VKR+KTRL+GEKA++EQ 
Sbjct: 718 EEQARQAQLDHEEQITQVKKTYNDQLTELQDKLAAEEKELETVKREKTRLQGEKAIEEQT 777

Query: 625 RQKDADDVLKNEIFEKQHKQAEAFSAAQLKG--RKHPLAALAREITGEAKPSSKDNSLYD 682
           RQ++AD+ LK EI  KQHKQAE   AA+       HP      +      P  KD+SLY+
Sbjct: 778 RQRNADEALKQEILSKQHKQAEGLHAAERYKIPNDHP------QKNKNVVP--KDDSLYE 829

Query: 683 YETEEDVMYV 692
           Y TEEDVMY 
Sbjct: 830 YHTEEDVMYA 839

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 75/166 (45%), Gaps = 25/166 (15%)

Query: 9   KRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXXXIAASEAK 68
           ++ DDPF  L          K   +        FLQ+VV                ++E K
Sbjct: 7   RQNDDPFTQLINQSSENGQSKQ--AQQKENPYQFLQKVV----------------SNEPK 48

Query: 69  AMSDYASPFR----AEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQN 121
              ++ SPFR    A   N N   V++ K R+FPTVSATS Y+ + PK  G+  I K   
Sbjct: 49  GKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAK 108

Query: 122 FAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTK 167
            AKDI FP YLT+NE+RQ               YL+  Q I DLTK
Sbjct: 109 RAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLTK 154

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  375 bits (962), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 324/509 (63%), Gaps = 34/509 (6%)

Query: 204 EDEEQSSAQNNEQLVLVQSEEEIHTPNVVEP-------PIDPALAPMVPFS--------- 247
           E+ EQSSA         +  EE  TP   E        PIDP+ AP VPF          
Sbjct: 337 EETEQSSAD--------EHGEETSTPETSEAESDGDITPIDPSKAPKVPFQERPQKERTG 388

Query: 248 ----LATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHK 303
                 +P   S K+  A   P NPVA+P N E IVKT + GYLSKAVYDKI YDE+ H+
Sbjct: 389 FFALWKSPTSSSAKKG-AATAPLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQ 447

Query: 304 KWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKK 363
            WL D   ++  KY+AK  EYK+ LQD+ NQ+ E+ + +++   +T +KI+V   +LVK+
Sbjct: 448 AWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQ 507

Query: 364 VFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDN 423
           + D      N K+ IF +T+ +K +KL EK  VLN  T VK  IDEL +EK+ V+ E+++
Sbjct: 508 IIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFND 567

Query: 424 WTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKL 483
           WTTN++++  +LDA++FKI+QIN+ Q   QN+ID L  QK +L  +  +NK +H+ NV++
Sbjct: 568 WTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEV 627

Query: 484 VESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXX 543
           +ESV+NKEYLP++NDID +I+ LLNQMTI++QENANE+  L+ ITKKLEDER        
Sbjct: 628 LESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLK 687

Query: 544 XXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQ 603
                      NLL KQR ELE +A+  ++ H+++I  +K  Y  +L E +++L  E+++
Sbjct: 688 LEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQDKLAAEEEE 747

Query: 604 LDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAAL 663
           L+ VKR++T+L+GEKA++EQ RQK+AD++LK  I +KQHKQA    AA+   R +  ++ 
Sbjct: 748 LEAVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATGLHAAE--NRVNTPSSN 805

Query: 664 AREITGEAKPSSKDNSLYDYETEEDVMYV 692
            +E +  A P  K++SLY+Y TEEDVMY 
Sbjct: 806 LQE-SKRAVP--KNDSLYEYHTEEDVMYA 831

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 59/111 (53%), Gaps = 6/111 (5%)

Query: 62  IAASEAKAMSDYASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPKQKGFTT 115
           + ++E K   D+ SPFR +  + N      V + K R+FPTVSATS Y+ + P+  G+  
Sbjct: 40  VVSNEPKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKN 99

Query: 116 IKKGQNFAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLT 166
           I K    AKDI FP YLT+NE+RQ               YL+  Q I DLT
Sbjct: 100 IPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLT 150

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  283 bits (725), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 168/425 (39%), Positives = 260/425 (61%), Gaps = 29/425 (6%)

Query: 268 PVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKS 327
           P+A+P N E I KT ++GY+SK +YDK+ YDE  H++WL  ++  +  KY+ KM+EY   
Sbjct: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477

Query: 328 LQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKL 387
           L+++  ++  +N+ +E  + +T +KI+V    LVKK+F++  +    K KIF ET+ IK 
Sbjct: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKN 537

Query: 388 EKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINV 447
           +K+ +K+ +L+ +  V+  I +L + K +VR E+D WTTNMT +G +LDAK+ K++QI +
Sbjct: 538 QKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITM 597

Query: 448 TQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLL 507
            Q   Q +I+ L +QK   Q +I   K  H+   K+VES +NKEYLPK++ IDN+I+ LL
Sbjct: 598 KQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELL 657

Query: 508 NQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAK 567
           N++ I+KQENANE+ +L++ITK+LE+ER                   NLL KQR ELE K
Sbjct: 658 NELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEK 717

Query: 568 ANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQK 627
           A   +  H++++  +K  YE              ++L+ VK+QK  LE EK ++E  R +
Sbjct: 718 AEQQKREHEEQVRKMKEQYE--------------NELNNVKKQKESLETEKLVEEHNRNE 763

Query: 628 DADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETEE 687
           +    +K E+ +KQ KQAEA  AAQ K            I   A    +DNSLY+++TEE
Sbjct: 764 N----IKKEVLDKQRKQAEAQHAAQTKS-----------IATNAANDMQDNSLYEFKTEE 808

Query: 688 DVMYV 692
           ++MYV
Sbjct: 809 EIMYV 813

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 50/83 (60%)

Query: 87  QNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNYLTENEQRQQAXXXXX 146
           +N K  +FPTVSATS    ++PK+ GF T+ K    AKDI FP YLTENE RQQ      
Sbjct: 116 KNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKEL 175

Query: 147 XXXXXXXXYLQDSQNIIDLTKKQ 169
                   YL+DSQ IIDLT +Q
Sbjct: 176 ELKEGKLQYLKDSQKIIDLTIRQ 198

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  274 bits (700), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 180/470 (38%), Positives = 283/470 (60%), Gaps = 30/470 (6%)

Query: 235 PIDPALAPMVPFSLATPNQKSKKETEA----PEKPSNPVASPTNQEEIVKTAQFGYLSKA 290
           PIDP  AP VPF       K+K    A     +K   P+A+P + E IV+T + GY+SKA
Sbjct: 320 PIDPNKAPRVPF-------KAKTGVFALWTRSDKQDQPLATPQDPEYIVRTDK-GYMSKA 371

Query: 291 VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTK 350
           +YDK++YDEQ H+  LA +  +Q +KY+A  +EY   L  + +Q+ EL   +E+  LDTK
Sbjct: 372 IYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTK 431

Query: 351 EKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDEL 410
           EKI V   +L KK+ D     I+ K  IF ET+ IK +K++E++ +   + EVK  I+EL
Sbjct: 432 EKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEEL 491

Query: 411 TNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEI 470
              K +V +E++ +   + ++ ++LD+K+ KI ++N  QM +   I  L  +K  ++ E 
Sbjct: 492 NVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETET 551

Query: 471 AKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKK 530
              + +H  +  ++ES+ NKEYLPK+N ID+++  LL  +T++KQENAN+K + A ITK+
Sbjct: 552 RDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITKR 611

Query: 531 LEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKL 590
           LE+ER                     L KQR+ELEAKA   ++ H++E+  +K ++E  L
Sbjct: 612 LEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEKAL 671

Query: 591 EEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSA 650
            +   QL +E+++ + V+R+KTRL GEKA+ EQ+R ++AD  LK E+ EK+ KQAEA  A
Sbjct: 672 NDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRRKQAEAVDA 731

Query: 651 AQLKGRKHPLAALAREITGEAK-----PS---SKDNSLYDYETEEDVMYV 692
           A+           AR+I+ + K     PS   ++++SLYDYET E+++ V
Sbjct: 732 AE----------QARKISTQKKSVLSNPSQNLTRESSLYDYETVEEIITV 771

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 73/165 (44%), Gaps = 28/165 (16%)

Query: 4   SILSFKRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXXXIA 63
           SI   K++ DPF HL                 P+   +FL++VV                
Sbjct: 2   SIFKKKQQVDPFAHLLQPEQ------------PQEQPNFLRKVVTN-------------- 35

Query: 64  ASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFA 123
             + +   DY+SPFR++   +  +N K ++FPTVSATS     +    G+  I   +  A
Sbjct: 36  KKKEEEEKDYSSPFRSQQELIAAKNVKAKKFPTVSATSGTA--SAADLGYKVIDSAKRRA 93

Query: 124 KDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKK 168
           KDI  P YL   +++Q+              YL+DSQ I+D+ KK
Sbjct: 94  KDISVPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDVRKK 138

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  236 bits (601), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/382 (35%), Positives = 223/382 (58%), Gaps = 18/382 (4%)

Query: 230 NVVEPPIDPALAPMV---P--------FSLATPNQKSKKETEAPEKPSNPVASPTNQEEI 278
           +V  PP+D A  P V   P        FS+    +K K +  AP    NP+A+P N E +
Sbjct: 445 SVTSPPVDYAAVPRVVTFPEVEKKRSIFSIF--GRKKKSQNRAP----NPLATPENPEIL 498

Query: 279 VKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSEL 338
           VKT + G+LSKAVYDK++Y+  +H +WL ++ + + ++YE K  +Y   L+++  ++ +L
Sbjct: 499 VKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKL 558

Query: 339 NDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLN 398
            + +++ + D  E I++ HG+L KK  +     I  K  IF+ETK I+ +K  E + + +
Sbjct: 559 EESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKH 618

Query: 399 DNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDA 458
              EV++ I  L  EK+ +  E+  WT  + +  + LDAK++ +  +       Q +ID 
Sbjct: 619 RQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDE 678

Query: 459 LTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENA 518
           L+ +K  L+ E+A +K  H  N K VE   NKEYLPK+++ID++I+ LL +++++KQE+A
Sbjct: 679 LSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESA 738

Query: 519 NEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQE 578
           NEK++L  ITKKLE ER                   +LLGKQR+E EA A  ++  H++E
Sbjct: 739 NEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEE 798

Query: 579 IDALKNDYETKLEEFK-NQLKQ 599
           +  +K DYE +L+E K +Q KQ
Sbjct: 799 LRKMKQDYEKRLQELKEHQSKQ 820

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 55/97 (56%)

Query: 70  MSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFP 129
           + ++ASPFR E +  + +  + +RFPTVS  S ++  +PK+ G+ T+ +G   AKDI FP
Sbjct: 66  LGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFP 125

Query: 130 NYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLT 166
            YL ENE RQ               Y+++SQ + D T
Sbjct: 126 IYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  231 bits (588), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/332 (39%), Positives = 203/332 (61%), Gaps = 3/332 (0%)

Query: 274 NQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDN 333
           N E +VKT   GYL+K +YDKI   ++QH +W+A Y+  + +K++ K  E  + +  +  
Sbjct: 347 NPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRA 405

Query: 334 QMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEK 393
           Q+ E+ + + +   DT  KI+V   +L +K F+   V I  K ++F +T+ IK +KLSEK
Sbjct: 406 QIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSEK 465

Query: 394 ENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQ 453
           ++VL+   EV++ IDEL  EK KV  E   WT ++  + + +DAK+  + ++NV Q N Q
Sbjct: 466 DSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNTQ 525

Query: 454 NKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIV 513
            +I+ L  QK ++ D+I KN   H  N K++E   NK YLPKLN++DN+I+ LL Q+T +
Sbjct: 526 EEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTTI 585

Query: 514 KQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQV 573
           +Q  ANE+ +L+ ITKKL+ ER                   +LLGKQR ELEAKA   + 
Sbjct: 586 RQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEARE 645

Query: 574 NHQQEIDALKNDYETKLE-EFKNQLKQEQDQL 604
            H+QE+  LK DY T+LE +FK + +Q++D L
Sbjct: 646 KHEQEMQKLKTDY-TQLEGKFKREQQQKKDAL 676

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (52%)

Query: 72  DYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNY 131
           DY SPFR E   ++ Q  +T+RFPT SA S Y    P++ G+  I  G+  AKDI FP Y
Sbjct: 39  DYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVY 98

Query: 132 LTENEQRQQAXXXXXXXXXXXXXYLQDSQ 160
           L E E++Q               YL+D Q
Sbjct: 99  LEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  231 bits (589), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 175/562 (31%), Positives = 300/562 (53%), Gaps = 50/562 (8%)

Query: 171 PKKAPTPVASTTEEIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPN 230
           PK+ P P A+     +       N    ++P+ E   + + +  ++   + +E     P 
Sbjct: 319 PKREPKPEAAVRAFEEAEAIVQDNEEPPVDPEAEPSPEEAVEAFQEAEAIATE----NPE 374

Query: 231 VVEPPIDPALAPMVPFSLATPNQ--------------------KSKKETEAPEKPSN--- 267
            + PP D   AP VPF+ +  N+                    +SKK   + +  +N   
Sbjct: 375 AISPPPDINSAPRVPFTPSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAA 434

Query: 268 ---------PVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYE 318
                    PVA+P + E IV+T Q GY+SK+VYDK+QYDE QH+  LA Y  +Q+E+YE
Sbjct: 435 GTVVPGDDAPVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYE 493

Query: 319 AKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKI 378
            K QEY++ +Q +  +++EL+  +E+  L+ +EK+ +   +  + + +     IN K  +
Sbjct: 494 TKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDL 553

Query: 379 FNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAK 438
           + +T++IK + +S+KE+    +  V+  IDEL   K++V  E     + +  + +ELD K
Sbjct: 554 YKQTEEIKNQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNK 613

Query: 439 LFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLND 498
              +++    +     +I AL  +K  L+ EI + + +H  NV  +ES+DNKEYLPK+N+
Sbjct: 614 TSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNE 673

Query: 499 IDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLG 558
           I+ EI+ LL  + +++QE AN+KV+ + +T++LE+ER                     L 
Sbjct: 674 INTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLE 733

Query: 559 KQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFK-------NQLKQEQDQLDQVKRQK 611
           KQR E E +A   ++ H++E+  LK  ++  L+E +        QL++EQ + +QV+R++
Sbjct: 734 KQRTEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERER 793

Query: 612 TRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITGEA 671
           TRL+GEKA++ Q+R    D  L+ E  EK  +QAEA SA +     + L +  ++     
Sbjct: 794 TRLQGEKAIEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVE-----NALKSSNKKTKAAV 848

Query: 672 KPSSKDN-SLYDYETEEDVMYV 692
            P++  N SLYDYET E+V+ V
Sbjct: 849 PPANTTNSSLYDYETVEEVITV 870

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 46/100 (46%), Gaps = 3/100 (3%)

Query: 72  DYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIK-KGQNFAKDIYFPN 130
           +Y SPFR        +  +  +FPT+S        +P+Q G++ +  K    AKDI  P+
Sbjct: 60  EYHSPFRTAEETQRARQVRQEKFPTLS--QGAVQLDPEQMGYSVVTDKSVKKAKDIIIPS 117

Query: 131 YLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQE 170
            L + E  Q+              Y + SQ I+DLTK QE
Sbjct: 118 GLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLTKPQE 157

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  217 bits (552), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 150/431 (34%), Positives = 236/431 (54%), Gaps = 10/431 (2%)

Query: 222 SEEEIHTPNVVEPPIDPALAPMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKT 281
           +E +I+   V E P D    P VPF+       ++ +     K   PVASP + E IVK 
Sbjct: 335 TEGKINADGVPEKPKDIKETPRVPFATGIFALWTRSD-----KRGQPVASPNDPEFIVKF 389

Query: 282 AQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDL 341
            + GY+SKA+YD ++Y+E  HK+ + DY  + + KYEAK  EY+  L  + +Q++EL   
Sbjct: 390 DK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEAT 448

Query: 342 IEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNT 401
           +E  + DT EKI++   +L  ++ D      + K  IF ET+ +K  K+ EKE V     
Sbjct: 449 METLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQE 508

Query: 402 EVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTS 461
           +VK  ++EL   + ++ +E       +  + +ELDAKL  I ++N  Q  LQ  ID L  
Sbjct: 509 DVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQ 568

Query: 462 QKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEK 521
           QK+ L  E       H SNV ++ES++NKEYLPKLN ID +I+ LL  +T+VKQE AN K
Sbjct: 569 QKDALISEANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHK 628

Query: 522 VQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDA 581
            + A ++K+LE+E                      L KQR+E + +   +Q  H++++  
Sbjct: 629 TEFAAVSKRLEEEDEERKEKLRQEEENRKRLEAERLQKQREEHDQQILLLQQEHERQL-- 686

Query: 582 LKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQ 641
              +   K  E +  L +E++Q + V+R++ +L+GEKA+ EQ+  K AD  L+ EI ++ 
Sbjct: 687 --AEASQKAAEHEQALLKEREQRELVERERVKLQGEKAIREQEEAKAADKALEEEIKQRN 744

Query: 642 HKQAEAFSAAQ 652
           H +A A   A+
Sbjct: 745 HSRALALDGAE 755

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 70/166 (42%), Gaps = 34/166 (20%)

Query: 8   FKRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSS---FLQRVVXXXXXXXXXXXXXXIAA 64
           FK+R DP +HLF                P+T  +   FL +VV                 
Sbjct: 2   FKKRQDPLEHLFQQSE------------PQTGDADKGFLHKVV----------------- 32

Query: 65  SEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAK 124
           S+ +  S Y SPFR   S    Q  K ++FPTVSA+ +    +    G+  I   +  AK
Sbjct: 33  SKEQEQSAYNSPFRTSQSLAAAQKRKMQKFPTVSASVSAHSSS--DMGYKVIDAARRRAK 90

Query: 125 DIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQE 170
           DI  P YL  N++RQ+              Y +DSQ I+D+   Q+
Sbjct: 91  DIAVPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDVRGGQD 136

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  215 bits (547), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 182/652 (27%), Positives = 316/652 (48%), Gaps = 79/652 (12%)

Query: 69  AMSDYASPFRA----EYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAK 124
           A  +Y SPFR     + S   +Q ++T++FPTVSATS Y   N ++ GF+ +   Q  A+
Sbjct: 44  ATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103

Query: 125 DIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLT------------KKQEPK 172
           DI FP YL ENE RQ+              +LQ  Q+++D T            K  EP 
Sbjct: 104 DIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPV 163

Query: 173 KAPT------------PVASTTEEIDEATFPHSNISEEINP------------------- 201
           K  T            PV  T EE DE       + E I                     
Sbjct: 164 KRDTTNRFAIDYDFVPPVDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANGGDASGDAS 223

Query: 202 --DYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVE--PPIDPALAPMV-----------PF 246
             DY+ +  +  QN  QLV  Q   ++   N +E   P+DPA  P +           P 
Sbjct: 224 GYDYDRDVLNIEQN--QLVDAQ---QMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPG 278

Query: 247 SLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWL 306
           S A      ++  + P   +NP A+    E ++K  ++G++S AV++K+ YD++ HK  +
Sbjct: 279 STAVGVSTKQRLMDTP--VTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEM 336

Query: 307 ADYETKQNEKYEAKMQEYKKSLQDMDNQ----MSELNDLIEKCELDTKEKIDVMHGQLVK 362
           ADY+ +Q  K+  K+QEY++ L  +D++    ++++ND     +LD   K +V+  Q +K
Sbjct: 337 ADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKMND----AKLDKIAKSEVIENQKIK 392

Query: 363 KVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYD 422
           ++FD      + K+K+ +E + +KL+KL + + +    T ++  +++LT EK+    +Y 
Sbjct: 393 QLFDSNATFNDSKVKVLHEAQLVKLQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYH 452

Query: 423 NWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVK 482
            WTTN+TNI   LDA+LFK+SQ N  Q  +  +I  LT +K  L+ EI  N+    +  +
Sbjct: 453 LWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADR 512

Query: 483 LVESVDNKEYLP--KLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXX 540
            +  ++  ++L   +L  + + I G L+ + +VKQE + E+++L  IT ++E  R     
Sbjct: 513 NLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNEMERARAERER 572

Query: 541 XXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQE 600
                         + LG++  +L+ +   + V H   +  ++  YE KL++   + ++ 
Sbjct: 573 IWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQDSAEKAEEA 632

Query: 601 QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQ 652
           + QL     +K ++E      EQ+ +K+ +D+ K   F ++  + E+  A Q
Sbjct: 633 EQQLKLAAEEKAQIEKSLLDQEQQAKKELEDMQKERDFAERRAKDESERADQ 684

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  202 bits (514), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 149/462 (32%), Positives = 257/462 (55%), Gaps = 22/462 (4%)

Query: 242 PMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQ 301
           P VPF+       ++ +     K   PVASP + E IVK  + GY+SKA+YD ++Y+E  
Sbjct: 327 PRVPFATGIFALWTRSD-----KRGQPVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAV 380

Query: 302 HKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLV 361
           HK+ +  Y  +  +KY+AK QEY+  L  + +Q++EL   +E+ +LDT +KI++   +L 
Sbjct: 381 HKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELS 440

Query: 362 KKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEY 421
            ++ +      N K  IF ET+  K  K+ EK  V+    EVK   +EL  ++ +  +  
Sbjct: 441 ARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATN 500

Query: 422 DNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNV 481
               + +  + ++LD+K   I ++N  Q  +Q  IDAL  QK+ L  +      +H+SN+
Sbjct: 501 QELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNI 560

Query: 482 KLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXX 541
            ++E + NK+YLPK+N +D++I+ LL+ + +VKQE AN+  + A ++K+LE+E       
Sbjct: 561 AILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEERKEK 620

Query: 542 XXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEI-DALKNDYETKLEEFKNQLKQE 600
                            KQRDE +    T+Q  H++++ +A +   +T+L      L+QE
Sbjct: 621 LRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTEL-----LLQQE 675

Query: 601 QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQHKQAEAFSAAQ-------- 652
           +++ + V+R++ RL+GEKA+ EQ++ K AD  L++E+ E+ H +A+A  AA+        
Sbjct: 676 REKRELVERERVRLQGEKAIQEQEQAKLADKALEDEVKERNHNRAQAIDAAEAARARNAK 735

Query: 653 -LKGRKHPLAALAREITG-EAKPSSKDNSLYDYETEEDVMYV 692
            +     P  +  +E      K ++ DNSLY+Y TE++V YV
Sbjct: 736 SISNNNAPALSTPKEDEKLNIKDATTDNSLYEYFTEKEVRYV 777

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 65/156 (41%), Gaps = 29/156 (18%)

Query: 8   FKRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXXXIAASEA 67
           FK++ DPF+HLF                  T+  FL++VV                    
Sbjct: 2   FKKKHDPFEHLFQQDQPKKE----------TSKGFLRKVVTKEQED-------------- 37

Query: 68  KAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127
              + Y+SPFR   S V  Q  K +RFPTVSA+S        + GF  I   +  AKDI 
Sbjct: 38  ---ATYSSPFRTSQSQVEAQKRKVQRFPTVSASSGGNSSA--EMGFKVIDAARKRAKDIA 92

Query: 128 FPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNII 163
            P YL  N++RQ+              Y +DSQ I+
Sbjct: 93  VPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  198 bits (504), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 214/366 (58%), Gaps = 17/366 (4%)

Query: 235 PIDPALAPMVPFSLATPNQKS-------KKETEAPEKP--SNPVASPTNQEEIVKTAQFG 285
           PI+P  APM+      P   S       K  + +  +P   NP++SP N E ++KT Q G
Sbjct: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHG 373

Query: 286 YLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKC 345
           YLSKAVYDK+QYD+  H++WL + ET + EKY+ K  EY+ +L D+ +++  ++DL+++ 
Sbjct: 374 YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDEL 433

Query: 346 ELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQ 405
           +L T +KI+VM  QLVK + D      + K KIF ET+ +KLEKL+ K++ ++   E+++
Sbjct: 434 KLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRK 493

Query: 406 TIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNN 465
            I+ L+ E+  V  +++ W + +  I ++LDAK+  I   N  +++++ ++  L   K  
Sbjct: 494 EIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKME 553

Query: 466 LQDEIAKNKNIHDSNVKLVESVD-NKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQL 524
           L++EI KN+ IH +N +L+  ++  K YLP++N+IDNEI G L +++ +K+E   E  +L
Sbjct: 554 LEEEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRL 613

Query: 525 AEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKN 584
             +TKKLEDER                     L KQ  EL+AK       H +E+  ++ 
Sbjct: 614 TILTKKLEDERIARENEIRLKNEKLKREQEQKLQKQLAELKAK-------HNEELLEIQK 666

Query: 585 DYETKL 590
            YE K+
Sbjct: 667 KYEKKM 672

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (56%), Gaps = 5/97 (5%)

Query: 72  DYASPFRAEYSNVNVQN----EKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127
           +Y SPFR + SNV   N    +K  RFPTVSA+S+++  +P + G+  I K    AKDI 
Sbjct: 37  EYVSPFR-DPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDIS 95

Query: 128 FPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIID 164
           FP++L  NE+RQ               YL++SQ +++
Sbjct: 96  FPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  174 bits (440), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 199/367 (54%), Gaps = 34/367 (9%)

Query: 235 PIDPALAPMVPF--------------------SLATPNQKSKKETEA-----------PE 263
           PIDP++ PMV                      SL +  + S K  +A           PE
Sbjct: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311

Query: 264 KPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQE 323
             ++ VASP N E +V+T ++  +SKAVYD++ Y+++ H +WL ++   ++EKY  K QE
Sbjct: 312 --THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQE 369

Query: 324 YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETK 383
           Y+  L ++  Q+ ++ +  +   +  ++KI++M  QLVK V D +     DK K+  ET+
Sbjct: 370 YEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETE 429

Query: 384 QIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKIS 443
            +KL+K++ KE++L    +VK  I++L NEK  + +EY+ W  N+ N+ + LD K+ KI 
Sbjct: 430 LMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIE 489

Query: 444 QINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVD-NKEYLPKLNDIDNE 502
            IN   M +Q  I+ L  +K NL++EI  ++     N  +++ ++  K+YLP+LN+ID +
Sbjct: 490 AINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQ 549

Query: 503 INGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXXNLLGKQRD 562
           I    +++ I+K E  +E  QL+ +TKKLE+ER                    LL K+  
Sbjct: 550 IAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMKREQDELLQKKLT 609

Query: 563 ELEAKAN 569
           EL+ K N
Sbjct: 610 ELQEKHN 616

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 71  SDYASPFRAEYSNVN---VQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIY 127
           ++Y SPFR     V     ++ K ++FPT SATSN+    P + G++++ K    AKDI 
Sbjct: 35  TEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 94

Query: 128 FPNYLTENEQRQ 139
           FP YL +NE+RQ
Sbjct: 95  FPKYLLDNEKRQ 106

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  142 bits (357), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 130/469 (27%), Positives = 238/469 (50%), Gaps = 26/469 (5%)

Query: 73  YASPFR----AEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYF 128
           Y SPFR    +      +Q+ KT +FP VSATS Y      +  +  +   +NFA+DI F
Sbjct: 51  YNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYN--TDTKDVYKDLDPKKNFARDIKF 108

Query: 129 PNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAPTPVASTTEEIDEA 188
           P+ L +NE RQ                L+DS  +ID+       K        ++ + E 
Sbjct: 109 PSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDVEDLPRDDKEKGEEEKDSDPVPEQ 168

Query: 189 TFPHSNISE-EINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPALAPMVPFS 247
              + NI++ +   D  D    +A   +  ++  +   ++  N+++   D ++   + F 
Sbjct: 169 PSNNENITDKDALQDAYDLNSKAATKTDPDIVSHNYSVLNKNNLIDAK-DMSIENKL-FY 226

Query: 248 LATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLA 307
           L   ++K   + ++  +   PVASP N+E +VK      +SK VYDKI++D + + +++ 
Sbjct: 227 LKPIHRKDYPKVQSTTESKFPVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIV 286

Query: 308 DYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDL--IEKCELDTKEKIDVMHGQLVKKVF 365
            Y+  Q  K      EY + ++ +  Q+ +   L  IE   L++    +V+  +LVK + 
Sbjct: 287 KYQNDQLNKLNKLKSEYNEKIKSI--QLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLM 344

Query: 366 DKKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWT 425
           D      ++K+KI  +T Q+KL+KL+E + +      +++  + +  EK+  ++ ++   
Sbjct: 345 DSTATFSDNKVKILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYIN 404

Query: 426 TNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEI--AKNKNIH-DSNVK 482
            ++  I  ELDAKLFK+SQ N+   NL+++I+ L S+K  L DEI   + K +H D + K
Sbjct: 405 CSLNEILQELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSK 464

Query: 483 LVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKL 531
            +E          LN++D +IN  L+ + ++KQE  NEK++++++T  L
Sbjct: 465 QLE----------LNEMDEQINSKLSNLNLIKQEIINEKLKISKLTNDL 503

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 152/270 (56%), Gaps = 4/270 (1%)

Query: 263 EKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQ 322
           EKP    A+P + E IV T + GY+SK +YD+++Y+E+ H++ LA  +     KYE   +
Sbjct: 316 EKPEKLNATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTAR 374

Query: 323 EYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNET 382
            Y++ L  ++N+++E++  +++ +  T+ ++  +   L + + D +      K  +  E 
Sbjct: 375 AYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEA 434

Query: 383 KQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKI 442
           +  K  K++EK  +    T+V+  ++ L   + + + E   + + +  + +ELDA+L ++
Sbjct: 435 ENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGEL 494

Query: 443 SQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNE 502
             ++  Q  +   + AL  ++  ++ +I+++  +  +N +L+++++N    P +  +DN+
Sbjct: 495 QNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLENH---PSIAALDNQ 551

Query: 503 INGLLNQMTIVKQENANEKVQLAEITKKLE 532
           ++ +   ++ V+QE+A +K +L E++ K E
Sbjct: 552 VSEVTRTVSAVEQEHAAQKDELTELSTKKE 581

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 68/187 (36%), Gaps = 29/187 (15%)

Query: 3   SSILSFKRRDDPFDHLFXXXXXXXXXKHNTSMAPRTTSSFLQRVVXXXXXXXXXXXXXXI 62
           SSI    ++ DPF  L          KH T      T  F+++V               +
Sbjct: 2   SSIFKKNKQPDPFKELLDNEED----KHGT------TELFVKKVTNHRKASEDDGTQGNV 51

Query: 63  AASEAKAMSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLK-NPKQKGFTTIKKGQN 121
                +   +Y SPFR + +    +  +  +FPT    S   +K N K+K          
Sbjct: 52  -----EGGGEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTVRVKDNVKRK---------- 96

Query: 122 FAKDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAPTPVAST 181
            A+DI  P      + +QQ              YL++SQ I+D+ K    K   + V S 
Sbjct: 97  -AQDIAEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDVRKSSVGKG--SEVGSV 153

Query: 182 TEEIDEA 188
            EE   A
Sbjct: 154 GEEATSA 160

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 126/250 (50%), Gaps = 3/250 (1%)

Query: 268 PVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKS 327
           P  +P  + E+V     GY+SKAVYD++  +E+ H   L + +    + Y+   Q Y+K 
Sbjct: 279 PNGTP-EEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 328 LQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQI-K 386
           + D+D ++S+L   I   + +T+ +ID +   L K + D K  +  DK  + +E  +  +
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMK-AENADKQHVLHEQAEAQR 396

Query: 387 LEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQIN 446
            E+L++KE +++ N E++  ID L   K     E       +  +  +LDA+  ++  + 
Sbjct: 397 AEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVT 456

Query: 447 VTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGL 506
             Q  +   +  L  QK  L+ E+A +      N + +E ++  +Y   + +ID + + +
Sbjct: 457 DQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEI 516

Query: 507 LNQMTIVKQE 516
           L ++  ++QE
Sbjct: 517 LTEIAKIRQE 526

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 131/329 (39%), Gaps = 76/329 (23%)

Query: 73  YASPFRAEYSNVN------VQNEKTRRFPTVSATSNYTLKNPKQKGFTTI---KKGQNFA 123
           Y SPFR    N+N      ++  K  ++   +  S++   N    G+ TI   +K +  A
Sbjct: 39  YQSPFR---RNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIA 95

Query: 124 KDIYFPNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAPTPVASTTE 183
           KDI FP  L ENE+ Q               +L+DSQN++                    
Sbjct: 96  KDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV-------------------- 135

Query: 184 EIDEATFPHSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPALAPM 243
            IDE      +IS E +  Y+                          ++E PI+    P 
Sbjct: 136 YIDE-----DDISYEGDSKYK--------------------------IIEKPINIYSVPK 164

Query: 244 VPFSLAT--PNQKSKKETEAPEKPSNPVASPTNQEEIV----KTAQFGYLSKAVYDKIQY 297
           +P  + T  P  K KKE +      N +A+P N+E+++    K     Y SK V+D IQY
Sbjct: 165 IPSYVFTKVPGNK-KKELK------NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQY 217

Query: 298 DEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMH 357
           + + H   L     K +E++ +K+ EY   + +++ ++   N+ I K         D   
Sbjct: 218 ENKIHHDKLKKLNAKGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSD 277

Query: 358 GQLVKKVFDKKGVQINDKMKIFNETKQIK 386
            +  K    K     N K +++ E + IK
Sbjct: 278 FKSTKNYLFKMTEYNNTKTRLYGEIEAIK 306

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 73  YASPFR--AEYSNVNVQ-NEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFP 129
           Y SPFR     SN+NV   +K  R+PT+SATS Y+   P+  G+  I      AKDI FP
Sbjct: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115

Query: 130 NYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNII 163
             L ENE RQ               YLQ SQ +I
Sbjct: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 7/100 (7%)

Query: 267 NPVASPTNQEEIVKTAQFG---YLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQE 323
           NP A+P N E +VKT        LSK+VYD + Y+ + H K + DY    N KY+ K +E
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435

Query: 324 YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKK 363
           +  S+ ++D ++      IEK  +D K KID +    V+K
Sbjct: 436 FNNSINELDLKIKS----IEKDIIDYKAKIDSLMNDNVEK 471

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 74/160 (46%), Gaps = 12/160 (7%)

Query: 230 NVVEPPIDPALAPMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSK 289
           +VV  P+D    P +P+S      +  +  EA  +  NPVA+P   EE+V        +K
Sbjct: 91  DVVREPVDIQKVPKIPYS------EYGQCNEAEFR--NPVATPETPEEVVIYKHLNGTNK 142

Query: 290 A----VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKC 345
           A    ++D IQ D   H  WL   E K N++   KM+EY K L  +D+Q+      +   
Sbjct: 143 AYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNL 202

Query: 346 ELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQI 385
               +  ID+   +L K    +      +K KI+ ET+++
Sbjct: 203 RRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETERL 242

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 262 PEKPSNPVASPTNQEEIVKTA--QFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEA 319
           P  P  P+A+P N E +V+    Q   +SK  YD++   + +H  WL  Y  +    Y  
Sbjct: 174 PPSPKYPIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQ 233

Query: 320 KMQEYKKSLQDMDNQMSELNDLIEKCELD 348
           + Q Y+K +  +D ++    ++    E D
Sbjct: 234 RHQWYQKQIDVLDEKIRYYQEMSNVLEAD 262

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar to
            uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and some
            similarites with YHR158C uniprot|P38853 Saccharomyces
            cerevisiae YHR158C KEL1 Protein required for proper cell
            fusion and cell morphology functions in a complex with
            Kel2p to negatively regulate mitotic exit interacts with
            Tem1p and Lte1p localizes to regions of polarized growth
            potential Cdc28p substrate
          Length = 1293

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 106/250 (42%), Gaps = 37/250 (14%)

Query: 292  YDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKE 351
            YD +  + +  K  LA  ET+    +   +++Y   L +   Q  E N L E  ELD   
Sbjct: 1065 YDNLAAENESLKTKLAGSETE----FRQSVKQYSLQLNNFMEQWREHNPLRETGELDADG 1120

Query: 352  KID---VMHGQLVKKVFDKKGVQINDKMKIFNETKQIKLE------KLSEKENVLNDNTE 402
            +     V  G   +    K   +++D ++   E  Q + +      +L+ K   LN+N E
Sbjct: 1121 RPKRELVPGGSYHEAAMQKLQQRLDDLLQTNEELTQSRHKLTDDHRELTTKHGELNENLE 1180

Query: 403  VKQT-IDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTS 461
             +Q  ++E+ +   +V +  +N +  +    SELD    K  QIN     LQN++D L  
Sbjct: 1181 ARQRELEEIQSNYQEVLNSANNSSKALEMSQSELD----KYKQIN---KKLQNELDEL-- 1231

Query: 462  QKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEK 521
                      +  +  + +   +    N  Y  K+ND+  E       + I KQE  N K
Sbjct: 1232 -------RFVREPSTGNDSASNIGIAGNNHYSMKINDLKAE-------LYIFKQERDNLK 1277

Query: 522  VQLAEITKKL 531
             ++ ++ KKL
Sbjct: 1278 DEVLQLKKKL 1287

>SAKL0B11990g Chr2 complement(1031509..1034223) [2715 bp, 904 aa]
           {ON} similar to uniprot|P36016 Saccharomyces cerevisiae
           YKL073W LHS1 Molecular chaperone of the endoplasmic
           reticulum lumen involved in polypeptide translocation
           and folding member of the Hsp70 family localizes to the
           lumen of the ER regulated by the unfolded protein
           response pathway
          Length = 904

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 324 YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETK 383
           Y  +LQ MD  +S++ DL++   ++TK + ++     VK +FD    ++ +  K FN   
Sbjct: 782 YNDTLQTMDIILSDIKDLLDADNIETKTREELFE---VKLLFDAVYGELTESFKTFNAAH 838

Query: 384 QIKLEKLSEKEN 395
           + ++++LS   N
Sbjct: 839 EYRIKELSSTYN 850

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 46/226 (20%), Positives = 86/226 (38%), Gaps = 54/226 (23%)

Query: 129 PNYLTENEQRQQAXXXXXXXXXXXXXYLQDSQNIIDLTKKQEPKKAPTPVASTTEEI-DE 187
           PN+L EN+ +Q               +L++ Q II  ++ +     P     T ++I D 
Sbjct: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQSELESQDLTP-----TMQKIKDS 344

Query: 188 ATFP---HSNISEEINPDYEDEEQSSAQNNEQLVLVQSEEEIHTPNVVEPPIDPALAPMV 244
             +P   + N +   +P   +++ S  Q                   + PP +P L    
Sbjct: 345 KIYPKVYYKNFNMTKHPPNINQQLSQNQK------------------IYPPFNPQL---- 382

Query: 245 PFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVK-TAQFGYLSKAVYDKIQYDEQQHK 303
                                 NP+A+ TN E ++K       ++K  YDK+    Q H 
Sbjct: 383 ----------------------NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHA 420

Query: 304 KWLADYETKQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDT 349
            W+ +   + +  Y  K + Y++ L  ++ Q++  N +I   + DT
Sbjct: 421 NWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDT 466

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 124/281 (44%), Gaps = 62/281 (22%)

Query: 379  FNETK-----QIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGS 433
            FN +K     QI L K  + E V  +N E    I EL++  + ++ E +       ++ +
Sbjct: 1045 FNSSKEDYESQIGLLK-EQLETVATENGESVNKISELSHNIDDLKGELETQKNFKDDLEA 1103

Query: 434  ELDA--KLFKISQINVT-----QMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVE- 485
            +L+A  K+ K +Q N       ++ L+ +I  +  Q +NL+D +   +  +  +V  VE 
Sbjct: 1104 KLEASKKVLKETQANEQHLKEEKLQLEGEITKIKEQLDNLRDNLKSLEKENKESVAQVEE 1163

Query: 486  -----SVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXX 540
                 S   KEY  KL++++NEIN +  +   + Q N   K ++ EI K  ED+      
Sbjct: 1164 YKKQISDKEKEYNGKLSELNNEINSVQQKNETICQNNEKLKGEIEEIEKASEDQ------ 1217

Query: 541  XXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQE 600
                          NL G + + L A+         +E++  K   ETKL          
Sbjct: 1218 -------------SNLKGSKIEALNAQI--------EELEESKQITETKL---------- 1246

Query: 601  QDQLDQVKRQKTRLEGEKALDEQKRQKDADDVLKNEIFEKQ 641
               LD VK  KT +E    + E +++ DA  V  NE+ EKQ
Sbjct: 1247 ---LDSVKNMKTEME---KMRELQKESDAKMVKINELEEKQ 1281

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 108/243 (44%), Gaps = 58/243 (23%)

Query: 390  LSEKENVLNDNTEVK---QTIDELTNE-KNKVRSEYDNWTTNMTNIGSELDAKLFKISQI 445
            L EKE++  +  E K   Q+ D L  +   K++S  +N+  ++      L A + +I + 
Sbjct: 933  LKEKEHISKELVECKLRFQSHDILVAKLTEKLKSLANNY-RDLQATHESLIASMEEIKKE 991

Query: 446  NVTQM-NLQNKIDALTSQKNNLQDEIAKNKNIHDSNV-KLVESVDN-----KEYLPKLN- 497
            N  QM NL++K D+L+ +K + Q E    + + + N+ KL E++       +E + K N 
Sbjct: 992  NTMQMSNLESKFDSLSQEKESFQSE----RELLEENIRKLKETISTLELTKEEAITKFNS 1047

Query: 498  ---DIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERXXXXXXXXXXXXXXXXXXX 554
               D +++I  L  Q+  V  EN     +++E++  ++D                     
Sbjct: 1048 SKEDYESQIGLLKEQLETVATENGESVNKISELSHNIDD--------------------- 1086

Query: 555  NLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRL 614
                  + ELE + N             K+D E KLE  K  LK+ Q     +K +K +L
Sbjct: 1087 -----LKGELETQKN------------FKDDLEAKLEASKKVLKETQANEQHLKEEKLQL 1129

Query: 615  EGE 617
            EGE
Sbjct: 1130 EGE 1132

>Skud_13.260 Chr13 complement(443782..444816) [1035 bp, 344 aa] {ON}
           YMR101C (REAL)
          Length = 344

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 36/63 (57%), Gaps = 6/63 (9%)

Query: 576 QQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKAL---DEQKRQKDADDV 632
           ++E+D L N +  KL+EF    K+  D  D++   K R+ G+++L   + ++R  + +D+
Sbjct: 128 KEEVDTLMNLFTVKLDEFA---KRANDYKDRLYGSKIRIVGDRSLLSPEMRERIANVEDI 184

Query: 633 LKN 635
            K 
Sbjct: 185 TKG 187

>Kwal_26.8312 s26 complement(735774..738464) [2691 bp, 896 aa] {ON}
           YMR031C - Hypothetical ORF [contig 59] FULL
          Length = 896

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 32/49 (65%)

Query: 576 QQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQK 624
           QQE++ + N+ +++L   + QLK+E+  L +  R  T L+GE  LDE+K
Sbjct: 572 QQEVETMINERQSELNATELQLKKERLTLLEAMRGVTELKGEDKLDEEK 620

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 55/106 (51%)

Query: 370 VQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMT 429
           V+  DK+K FN++     E +S+  N+ N+ T +K+  D + NE +  R E +N  T ++
Sbjct: 317 VEAKDKIKEFNQSSNANDELISKNSNLENEITRIKEENDNVKNEISAARQENENLKTEIS 376

Query: 430 NIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKN 475
            + ++ D     I  I      L+N+I  +  + + L+ E+  +KN
Sbjct: 377 TLKTDTDNLNGHIQSIKNDNNKLENEIQLVKKENSKLETEVKTSKN 422

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 577 QEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQKDADDV 632
           QE+ AL+     KL+  +N LKQ QD    +KRQ   ++G+    ++KRQ+  D +
Sbjct: 292 QEVAALRG----KLQNLQNSLKQRQDDTQSMKRQIDEIKGKTVQTKRKRQELHDYI 343

>Kpol_1065.36 s1065 (76145..79804) [3660 bp, 1219 aa] {ON}
           (76145..79804) [3660 nt, 1220 aa]
          Length = 1219

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 425 TTNMTNIGS-ELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKL 483
           TTN+  + + E+D   F+I QI+ T   ++N I++L   +N L+      +N+++SNVK 
Sbjct: 141 TTNLGWLSALEIDMHYFQI-QISDTLDYIKNIIESLKICQNYLELYCYDVENLYNSNVKF 199

Query: 484 VESVDNKEYLPK-LNDIDNEINGL--LNQMTIVKQENANEKVQLAEITKKLED 533
           +  + N E L   LN  DN +  L  +N   +    N NE   L  I+ K+E+
Sbjct: 200 LNQLANNEILKNWLNYYDNILTKLSDINGNKLSSYLNKNE---LVSISSKIEE 249

>CAGL0L12914g Chr12 complement(1379249..1381906) [2658 bp, 885 aa]
           {ON} similar to uniprot|Q05050 Saccharomyces cerevisiae
           YMR031c
          Length = 885

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 34/49 (69%)

Query: 576 QQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQK 624
           Q E+DA+ N+ +++L + + QLK+E+ QL +  R K +  G++ +DE+K
Sbjct: 634 QLEVDAMVNERKSELNQTEIQLKKEKLQLLESMRNKAQARGDEKIDEEK 682

>KLTH0F15598g Chr6 complement(1274669..1277551) [2883 bp, 960 aa]
           {ON} weakly similar to uniprot|Q06407 Saccharomyces
           cerevisiae YDR379W RGA2 GTPase-activating protein for
           the polarity-establishment protein Cdc42p implicated in
           control of septin organization pheromone response and
           haploid invasive growth
          Length = 960

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 442 ISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKE 491
           ++Q+  T+M L + ID L S K +LQ+EI    NI      + ESV++ E
Sbjct: 607 VNQLQSTKMQLTHDIDLLKSSKESLQEEIKSLNNIKAQKAVISESVESFE 656

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 82/310 (26%), Positives = 136/310 (43%), Gaps = 56/310 (18%)

Query: 319  AKMQEYKKSLQDMDNQMSE-LNDLIEKCELDTKEK--IDVMHGQLVKKV---------FD 366
             K+ E    L D  N + E L D+ EK E  TKEK  +D++  ++V  +          D
Sbjct: 753  GKLTEEHSVLLDKYNDIDEQLEDITEKLEQMTKEKERLDLLQKEMVVNLETKDSHLEELD 812

Query: 367  KKGVQINDKMK---IFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDN 423
            +    +NDK+K   +  E  +  + K+S +   LN N    QT+DE   ++ K +++ + 
Sbjct: 813  ESTKALNDKLKQMTVMKEKAEEGINKMSRELFALNRNN---QTLDEKIKQQAKDQAKENE 869

Query: 424  WTTNMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDE-------IAKNKNI 476
                +  I +  D     IS  N     L NKI  L +QK  L+DE       +A+ K+ 
Sbjct: 870  --KRLKEIKTLNDT----ISSKNSENSKLNNKIKELETQKKFLEDERTTILKELAEWKSK 923

Query: 477  HDSNVKLVESVDNKEYLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERX 536
              S+  LV         PKL +   ++  L N    ++ EN N K +L E     E  + 
Sbjct: 924  FQSHDSLV---------PKLTE---KLKSLANNYKDLEIENTNIKTRLNE-----EQSKH 966

Query: 537  XXXXXXXXXXXXXXXXXXNLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQ 596
                                L +++ +LE K ++++     EI++ K D++TK+E    Q
Sbjct: 967  LSEVSDLNEKIESLERTEISLTEEKKDLETKLSSLE----HEINSFKGDHDTKIE----Q 1018

Query: 597  LKQEQDQLDQ 606
            L  E+D L+Q
Sbjct: 1019 LCTEKDGLEQ 1028

>Smik_4.622 Chr4 (1112573..1115407) [2835 bp, 944 aa] {ON} YDR356W
           (REAL)
          Length = 944

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 72/149 (48%), Gaps = 21/149 (14%)

Query: 396 VLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIG-------SELDAKLFKISQINVT 448
           +LN   ++ ++ DEL + K+  R E +NW     N+        +E D+ L K  ++++ 
Sbjct: 649 ILNLENKLIESEDELRSLKDSQRIEIENWKRKYNNLSLENDRLLAEKDSTLDKEHEVSI- 707

Query: 449 QMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPK----LNDIDNEIN 504
              L  K+D L  +K NLQ+   K K       +L + +   E L +    LN+  N I 
Sbjct: 708 ---LNRKVDELNKEKWNLQESKEKYKR------ELQKVITANERLRREKEELNENGNNIR 758

Query: 505 GLLNQMTIVKQENANEKVQLAEITKKLED 533
            + ++MT +K+   +E   L E  ++LE+
Sbjct: 759 VMEDKMTRIKKSYLSEITSLQEENRRLEE 787

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,032,073
Number of extensions: 3436421
Number of successful extensions: 33610
Number of sequences better than 10.0: 2238
Number of HSP's gapped: 31450
Number of HSP's successfully gapped: 3502
Length of query: 692
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 575
Effective length of database: 40,065,477
Effective search space: 23037649275
Effective search space used: 23037649275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)