Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E008003.493ON1741749061e-126
NDAI0G009303.493ON1761766721e-90
CAGL0L08448g3.493ON1731755879e-78
CAGL0I10494g3.493ON1721755834e-77
KAFR0C019703.493ON1791795732e-75
YPR149W (NCE102)3.493ON1731745671e-74
Smik_16.4023.493ON1731745627e-74
Skud_16.4443.493ON1731745601e-73
Suva_16.4783.493ON1661745295e-69
NDAI0B058803.493ON1821825262e-68
YGR131W (FHN1)3.493ON1741745174e-67
KNAG0B008003.493ON1821824985e-64
Smik_6.2273.493ON1741744792e-61
Suva_7.4193.493ON1741744732e-60
KNAG0A079503.493ON1821824723e-60
TDEL0D056103.493ON1751754654e-59
Skud_7.4423.493ON1741744524e-57
Kpol_1017.63.493ON1871874394e-55
SAKL0F02750g3.493ON1701744369e-55
TPHA0D032803.493ON1841844265e-53
KLLA0D16280g3.493ON1691744123e-51
KAFR0G037003.493ON1861864143e-51
ZYRO0D09966g3.493ON1781784064e-50
TBLA0D029603.493ON1891894004e-49
NCAS0F035603.493ON1831833961e-48
KLTH0F14850g3.493ON1711753942e-48
TBLA0C044903.493ON1861563873e-47
Kwal_55.212383.493ON1701743812e-46
Ecym_12363.493ON1691743012e-34
AFR312W3.493ON1681452803e-31
Suva_4.272.61ON322116790.059
Smik_4.212.61ON31694691.1
TDEL0H00180singletonON25732627.6
Skud_12.524.52ON156194639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00800
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   353   e-126
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   263   1e-90
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   230   9e-78
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   229   4e-77
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   225   2e-75
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   223   1e-74
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   221   7e-74
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   220   1e-73
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   208   5e-69
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   207   2e-68
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   203   4e-67
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   196   5e-64
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   189   2e-61
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   186   2e-60
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   186   3e-60
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   183   4e-59
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   178   4e-57
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   173   4e-55
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   172   9e-55
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   168   5e-53
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   163   3e-51
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   164   3e-51
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   160   4e-50
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   158   4e-49
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   157   1e-48
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   156   2e-48
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   153   3e-47
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   151   2e-46
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   120   2e-34
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   112   3e-31
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     35   0.059
Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)     31   1.1  
TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON}                  28   7.6  
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...    29   9.3  

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  353 bits (906), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  263 bits (672), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 133/176 (75%), Positives = 150/176 (85%), Gaps = 2/176 (1%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML VADNLLR+LNA+FLVICIGLNSALLNT+  +NSRINYCMFTC YCL TDS +GI AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           FF+ L+ P + F LDFLNF+FTFVAGTVLATGIR+HSC ++ Y++ NKITQG  NRCRES
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHI-GRRRRRN-AAEIGVPSISQV 174
           QALVAFFYFSM IFL KL MSTI+MIQNGAF+     RRRRRN AAE+GVPSISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  230 bits (587), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 138/175 (78%), Gaps = 3/175 (1%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML V DNLLRI+N VF+VICIGL S L+ T+  ++SR+NYCMF  AY + TDS+YG+FAN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           FF+ILA P + F LDFLNFAF   AG VLA GIRAHSC + HY  +NKI QG + RCRES
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAF-TQHIGRRRRRNAAEIGVPSISQV 174
           QA VAFF+FSMAIFLAK+IMS +N+  NGAF T+ I  RRRRN AE+GVPS+SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFI--RRRRNNAEVGVPSVSQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  229 bits (583), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 139/175 (79%), Gaps = 4/175 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML VADNLLRI+NAVFL+ICIGL S+L+NT+  ++SR+N+C+F  AY + TDS+YGIFAN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVN-SNKITQGFKNRCRE 119
           FF+ LA P + F LDFLNF FTF AGTVLA GIRAHSC ++ Y+    KI QG   RCR+
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           +QALVAFFYFSMAIFLAK+IMS ++++ NGAF   +   RR++  E+GVPSISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  225 bits (573), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (78%), Gaps = 5/179 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKT-HNNSRINYCMFTCAYCLTTDSIYGIFA 59
           MLGVADN+LR++NAVFL+I I L SAL+NT+  H+NSR+NYCMF CA+ L  DSIYGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
           NFF +LA P L F LDFLNFAFTF A T LA GIRAHSC ++ Y++SNKI +G   RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGR---RRRRNAAEI-GVPSISQV 174
           +QALVAF YFS AIF+AK+IMS IN+ QNGAF+    R   RR+++A ++ GVP+ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  223 bits (567), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 111/174 (63%), Positives = 134/174 (77%), Gaps = 1/174 (0%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML +ADN+LRI+N +FLVI IGL S+LLNT+  ++SR+NYCMF CAY + TDS+YG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F + LA P + F LDFLNF FTF AGTVLA GIRAHSC +  YV+SNKITQG   RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  221 bits (562), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 133/174 (76%), Gaps = 1/174 (0%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML +ADN+LRI+N +FLVI I L S+LLNT+  ++SR+NYCMF CAY + TDS+YG+FAN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F + LA P + F LDFLNF FTF AGTVLA GIRAHSC +  YV+SNKITQG   RCR++
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  220 bits (560), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 132/174 (75%), Gaps = 1/174 (0%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML  ADN+LRI+N +FLVI IGL S+LLNT+  N+SR+N+CMF  AY + TDS+YG+FAN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           FF+ LA P + F LDFLNF FTF AGTVLA GIRAHSC +  YV+SN ITQG   RCR++
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  208 bits (529), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 106/174 (60%), Positives = 128/174 (73%), Gaps = 8/174 (4%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML   DN+LRI+N +FLVI IGL S+LLNT++ N+SRINYCMF  AY + TDS+YG+FAN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           FF+ LA P + F LDFLNF FTF       T IRAHSC+++ Y+ SN ITQG  NRCRE+
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTF-------TAIRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YFS AIFLAK +MS  NMI NGAF      +RRR   ++GVP+ISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGSFSKRRRT-GQVGVPTISQV 166

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  207 bits (526), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 111/182 (60%), Positives = 130/182 (71%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML   DN+LR++NA+FLV+ +   SALLNT+ +N+SRIN+CMF  A+ L TDS +G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FFDILA-LPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
            FD LA  P L F  DFLNF FTF AGTVLA  IRAHSCK+E YVNSN ITQG +NRCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAF---TQHIGRRRRR----NAAEIGVPSIS 172
           SQA VAFFYFS  IFLAK+IMS INM  NG F   T    R +RR     A E+GVP+IS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  203 bits (517), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 126/174 (72%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML  ADNL+RI+NAVFL+I IGL S L+ T+T ++SR+N+CMF   Y L TDS+YG  AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F+  L  PA+   LDFLNF FTFVA T LA GIR HSCK++ Y+  NKI QG  +RC +S
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAFFYFS  +FL K+ ++T+ M+QNG F  + G  RRR   ++G+P+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  196 bits (498), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 122/182 (67%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           MLGVADNLLR+LN  FLVIC+   S L+NT+  + SR+NYCMF  AY + TD +YG+ AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F++ LA P + F LDFLNFAFT  AG VLA GIRAHSCK+  Y   N I QG +NRCR S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGR--------RRRRNAAEIGVPSIS 172
           QA  AFF+FSM IF+AK++MS IN+  NGAFT    +                 GVPSIS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  189 bits (479), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 124/174 (71%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML  ADNL+RI+NAVFL+I IGL S L++T+  ++SR+N+CMFT AY L TDS+YG  AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F+  L  PA+   LD LNF FTFVA T LA GIR HSCK++ Y+  NKITQ   +RC +S
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAFFYFS  +FL K+ ++    IQNG F  + G  RRR   ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  186 bits (473), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 92/174 (52%), Positives = 126/174 (72%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML VADN++RI+NA+FL+I IGL S L++++T ++SR+N+CMF  AY L TDS YG  AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
            +  L  P + F LDFLNF FTF+AGT LA GIR HSC ++ Y+++NKITQG  +RC ++
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           +A V FFYFS  +FL K+++S   M+QNG F       RRR   ++G+P+ISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  186 bits (472), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 128/182 (70%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML +AD  LR++N VFLVIC+GL SALLNT+  ++SRINYCMFT AY +TTDS YG+ AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F++ L+ P L   LDFLNF FT  AG VLA GIRAHSCK+  Y N NKI QG +NRCR++
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAF--------TQHIGRRRRRNAAEIGVPSIS 172
           QA VAFF+FSMAIFLAK IMS +N+  NG F             +R+R      GVP+IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 173 QV 174
            V
Sbjct: 181 TV 182

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  183 bits (465), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 96/175 (54%), Positives = 126/175 (72%), Gaps = 1/175 (0%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR++N  FLVI +GL   L++++  ++SR+N+CMF  A+ + TDS YGI AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
            +++ A P + F LDFLNFAFTF A T LA GIR HSCK++ Y++SN ITQG   RCR +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIG-RRRRRNAAEIGVPSISQV 174
           QA VAFFYFS  IFLAK+IMS I +I NG F+       RRR +A++GVP+ISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  178 bits (452), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 97/174 (55%), Positives = 122/174 (70%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML  ADNL+RI++AVFL+I IGL   L+ T+T+ +SR+N+CMF  AY L TDS YG  AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F+  L  PA+   LDFLNF FTF A T LA GIR HSCK++ Y+  N ITQG  +RC +S
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAFFYFS  +FL K+ +S   M+QNG F  + G  RRR   ++GVP+ISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  173 bits (439), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 127/187 (67%), Gaps = 13/187 (6%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML +ADN++R +N  F VIC+GL  +LL T+  ++SR+NYCMF   + + TDS YGI AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FFDI-LALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
            +    A P + F  DFLNFAFTF AGTVL+ GIR HSCK+ +Y+++NKI QG  +RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAF---TQHIGRRRRRNA---------AEIG 167
           +QA +AFFYFS  IF  K++MS IN++ NGA    T  IGRRR   A          ++G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 168 VPSISQV 174
           VP+ISQV
Sbjct: 181 VPNISQV 187

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  172 bits (436), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (66%), Gaps = 4/174 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR++N  FLVI +GL  +L+ T+  ++ R+N+ +FT A+ L TDS Y +FAN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
            F   A P L    DFLNF FTF A T LA GIR HSC +E Y+ SN ITQG  +RCR++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YFS  IFL KL++S IN+  +GAF    G RR    A +GVP+ISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSGSRR----ANVGVPTISQV 170

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  168 bits (426), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 122/184 (66%), Gaps = 10/184 (5%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           MLG+ADN+LR +N  F VIC+GL  +LL T+  ++SR+NYC+F   + L TD+ YG  AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FFDI-LALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
            +   LA P + FC DFLNFAFTF AGTVLA G R HSC ++ Y++SN ITQG  +RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQ---------HIGRRRRRNAAEIGVPS 170
           +QA  AFFYFS  IFLAKLIMS+IN+  NGA                     + +IGVP+
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 171 ISQV 174
           ISQV
Sbjct: 181 ISQV 184

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  163 bits (412), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 112/174 (64%), Gaps = 5/174 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR +N VFL+I +GL   L+ T+ H++SR+N+ +F   + +  DS+Y + AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F   LA P +   LDFLN+ FTF A T LA GIR  SC ++ + + NKI +G K+RCR++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA   F YFS AIFL K I+S +N I +GAF     R+      ++GVP+ISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNRK-----TQVGVPTISQV 169

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  164 bits (414), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 124/186 (66%), Gaps = 12/186 (6%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKT-HNNSRINYCMFTCAYCLTTDSIYGIFA 59
           ML +ADN LR++N  F+VI +   + LLNT+  HN++R+NYCMF  A+ + TDSIYG+FA
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
           NFF+ LA P + F  DFLNF F F AGTVLA GIRAH+C +E Y NSNKI +G + RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGA-----FTQHIGRRRRRNAA------EIGV 168
           +QA VAFFYFSMAIFL K + S +  I  G            RR+RR+A         GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 169 PSISQV 174
           P++S+V
Sbjct: 181 PTVSEV 186

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  160 bits (406), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 94/178 (52%), Positives = 123/178 (69%), Gaps = 4/178 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA 59
           ML + DN+LR +N  F VI +GL   L+ ++ H +NSR+N+CMF  A+ +  DS YGI A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
           N F   A P + F LDFLNF FTF A T LA GIR HSC + HY++SNKITQG  +RCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGA---FTQHIGRRRRRNAAEIGVPSISQV 174
           +QA+VAFFYF+  IFL K++MS ++++ NGA    +    RRRR   A +GVP+ISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  158 bits (400), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 111/189 (58%), Gaps = 15/189 (7%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTK-THNNSRINYCMFTCAYCLTTDSIYGIFA 59
           ML + DN+ RI N  F VI  G+   LLNT+  H++SR+NYCMF  A+ L +DS YGI A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFF-DILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCR 118
           N   +  A P + F  DFLNF FTF AGTVLA GIR HSC ++ Y   N I QG + RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 ESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQ----------HIGRRRRRNAAE--- 165
           E+QA +AFFYFSM +FL K++++ +     G   Q            GRR R  A     
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 166 IGVPSISQV 174
            G  SISQV
Sbjct: 181 KGGISISQV 189

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  157 bits (396), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 119/183 (65%), Gaps = 9/183 (4%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML   DN LR  N +FLV+ I   S LL+T+ H +SR+NYCMF  A+ L TDS +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FFDILA-LPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
             D L+  P + F  DFLNF FTF AGTVLA GIR HSC +  Y+ SNKI QG   RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH--IGRRRRRN------AAEIGVPSI 171
           SQA VAFFYF+  +FLAK+IMS I+M  NGAF     + RR+RR+          GVP+I
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 172 SQV 174
           S+V
Sbjct: 181 SEV 183

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  156 bits (394), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 92/175 (52%), Positives = 114/175 (65%), Gaps = 5/175 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNT-KTHNNSRINYCMFTCAYCLTTDSIYGIFA 59
           ML + DN LR LN  FLVI +GL  +L  T KTHNN ++N+ +FT A+ L  DS+Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119
           NF   LA P L    DFLNF FTF A T LA  IR HSC ++ Y++SN +TQG  +RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           +QA VAF YFS  IFLAKL +S +N+I  GAF    G    R    +GVP+ISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAF----GAGSSRRTGNVGVPTISQV 171

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  153 bits (387), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 2/156 (1%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNS-RINYCMFTCAYCLTTDSIYGIFA 59
           ML    N+LRI+N  FLVI  G+   L+ ++   +S R+NYCMF   + L TDS Y I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFFD-ILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCR 118
           NF+    A P L +  DFLNF FTF AGTVL+ GIR HSC ++HY+ SNKITQG   RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 ESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH 154
            +QA +AF+YFS  I+L +L+ S++ M +NG F   
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPE 156

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  151 bits (381), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (65%), Gaps = 4/174 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR  N VFL+I +GL  +L  T+ +NN ++N+ +F  A+ L  D++Y I AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F   LA P L    DFLNF FTF A T LA  IR HSC +  YV++NK+TQG  +RCR++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA VAF YF+  +FL KL +S +N+   GAF+   GR+    +A +GVP+ISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGRK----SANVGVPTISQV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  120 bits (301), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 103/174 (59%), Gaps = 5/174 (2%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR  N +FL+I + L  +L+N +  ++SR+N+ +FT  + L  DS+Y + AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F   LA P L    D LN  FTF A T L   I  HSC +  ++  N I++G + RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174
           QA   F +FS  IFLAK ++S +N++  GAF+   GR+        GVP+ISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGRKTGG-----GVPTISQV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  112 bits (280), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 90/145 (62%)

Query: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60
           ML + DN LR +N VFL+I +GL  +L++ + +++SR+N+ +FT  + L TDS Y I AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120
           F    A P +   LD LN  FTF A T L   I AHSC +  +++ N I++   +RCR+ 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QALVAFFYFSMAIFLAKLIMSTINM 145
           QA   F +FS  IFLAK + S +N+
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNI 145

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 17/116 (14%)

Query: 65  LALPALC-----FCLDFLNFAFTFVAGTVLATGIRAHSCKS-----EHY--VNSNKITQG 112
           LALP L      FC + +       A  VLA     HSCKS     E+Y   +    T  
Sbjct: 64  LALPTLIYIGMYFCAELIMCMLWLAAFVVLAKAQGQHSCKSRNSSGEYYDPYSGQYTTTN 123

Query: 113 FKNRCRESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGV 168
            +  C  SQA +AF      +FL  +++  +N++     T  +GR + +     G 
Sbjct: 124 HRRACNSSQAAIAFAGLCFLLFLTSVVLLGVNIL-----TPIMGRYKSQGLWRTGA 174

>Smik_4.21 Chr4 (44522..45472) [951 bp, 316 aa] {ON} YDL218W (REAL)
          Length = 316

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 41/94 (43%), Gaps = 12/94 (12%)

Query: 65  LALPALC-----FCLDFLNFAFTFVAGTVLATGIRAHSCKSEH----YVN--SNKITQGF 113
           LALP L      FC + +       A  VLA     HSC S +    Y N  S + T   
Sbjct: 64  LALPTLIYIGMYFCAELIVCMLWLAAFVVLAKAQGEHSCGSTNANGLYYNPYSGQYTANS 123

Query: 114 KNR-CRESQALVAFFYFSMAIFLAKLIMSTINMI 146
             R C  SQA +AF      +FL  +I+  IN++
Sbjct: 124 HRRACNSSQAAIAFSGLCFLLFLTSVILLGINVL 157

>TDEL0H00180 Chr8 (19833..20606) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (65%)

Query: 113 FKNRCRESQALVAFFYFSMAIFLAKLIMSTIN 144
           + +RCRE++A +A   F+M ++ A L +  +N
Sbjct: 120 YSSRCREAKAAIAMCAFNMVLYAASLTLLVLN 151

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
           (REAL)
          Length = 1561

 Score = 28.9 bits (63), Expect = 9.3,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 9/94 (9%)

Query: 36  SRINYCMFTCAYCLTTDSIYGIFANFFDILALPALCF----CLDFLNFAFTFVAG---TV 88
           S + Y  + C   + T S +G+F+ F D    PA+ F      + LN A   V     T+
Sbjct: 517 SNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSLFNILNSAIYSVPSMINTI 576

Query: 89  LATGIRAHSCKSEHYVNSNKITQGFKNRCRESQA 122
           + T +     KS  ++ S++I   F  R   S +
Sbjct: 577 IETSVSMERLKS--FLLSDEIDDSFIERIDPSMS 608

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,144,164
Number of extensions: 595335
Number of successful extensions: 2392
Number of sequences better than 10.0: 44
Number of HSP's gapped: 2399
Number of HSP's successfully gapped: 44
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 62 (28.5 bits)