Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E007903.494ON32732717240.0
NDAI0G009203.494ON29629213590.0
Smik_6.2283.494ON28728813010.0
Suva_7.4203.494ON28728812980.0
CAGL0I10472g3.494ON28828512701e-177
YGR132C (PHB1)3.494ON28728212661e-176
KAFR0C019803.494ON28328112531e-175
Skud_7.4433.494ON28728412411e-173
TDEL0D056203.494ON27927912291e-171
SAKL0F02728g3.494ON28228112271e-171
TPHA0D032903.494ON28528312141e-169
KLTH0F14872g3.494ON28028112131e-169
Kpol_1017.53.494ON28328211971e-166
TBLA0D029503.494ON28228211811e-164
KNAG0B007903.494ON28428311731e-162
Kwal_55.212403.494ON28326411621e-161
ZYRO0D09900g3.494ON28328111541e-160
Ecym_12353.494ON28328210951e-151
AFR313C3.494ON28328410571e-145
KLLA0D16302g3.494ON2262139421e-128
KAFR0B042505.98ON3102587472e-97
ADL141W5.98ON3072347429e-97
CAGL0L06490g5.98ON3132437411e-96
Suva_7.5235.98ON3102317374e-96
KLTH0C01672g5.98ON3072317366e-96
Kwal_27.127475.98ON3072357341e-95
TBLA0H022205.98ON3072317341e-95
TPHA0A050905.98ON3102317341e-95
YGR231C (PHB2)5.98ON3102317341e-95
NDAI0D025305.98ON3162617342e-95
NCAS0F006005.98ON3132557332e-95
Skud_7.5655.98ON3102317323e-95
SAKL0G15510g5.98ON3082317281e-94
TDEL0G012105.98ON3092347272e-94
Smik_16.755.98ON3102317244e-94
KLLA0E15731g5.98ON3082317236e-94
Kpol_1050.615.98ON3102557237e-94
KNAG0A015805.98ON2882317163e-93
ZYRO0B15136g5.98ON3102317123e-92
KLTH0F18546g7.518ON277793760.73
ZYRO0B06666g3.85ON659109721.6
Kpol_534.231.369ON496170685.5
YNL137C (NAM9)2.129ON48661676.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00790
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     668   0.0  
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     528   0.0  
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   505   0.0  
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   504   0.0  
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   493   e-177
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   492   e-176
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   487   e-175
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   482   e-173
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   478   e-171
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   477   e-171
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   472   e-169
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   471   e-169
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   465   e-166
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   459   e-164
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   456   e-162
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   452   e-161
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   449   e-160
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   426   e-151
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   411   e-145
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   367   e-128
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   292   2e-97
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   290   9e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   290   1e-96
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   288   4e-96
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   288   6e-96
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   287   1e-95
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   287   1e-95
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   287   1e-95
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   287   1e-95
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   287   2e-95
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   286   2e-95
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   286   3e-95
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   285   1e-94
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   284   2e-94
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   283   4e-94
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   283   6e-94
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   283   7e-94
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   280   3e-93
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   278   3e-92
KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON} sim...    34   0.73 
ZYRO0B06666g Chr2 complement(533122..535101) [1980 bp, 659 aa] {...    32   1.6  
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    31   5.5  
YNL137C Chr14 complement(368595..370055) [1461 bp, 486 aa] {ON} ...    30   6.6  

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MCMYVYIGLSFSEIRLKIQRRTGERDNKSTTTEPSKHKMAFNPQQGTKLLNVITRVALPL 60
           MCMYVYIGLSFSEIRLKIQRRTGERDNKSTTTEPSKHKMAFNPQQGTKLLNVITRVALPL
Sbjct: 1   MCMYVYIGLSFSEIRLKIQRRTGERDNKSTTTEPSKHKMAFNPQQGTKLLNVITRVALPL 60

Query: 61  GILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSI 120
           GILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSI
Sbjct: 61  GILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSI 120

Query: 121 ATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDA 180
           ATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDA
Sbjct: 121 ATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDA 180

Query: 181 AELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERA 240
           AELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERA
Sbjct: 181 AELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERA 240

Query: 241 KFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           KFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN
Sbjct: 241 KFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300

Query: 301 ITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           ITYLPGQQGGRGNDSGSPNSLLLNIGR
Sbjct: 301 ITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/292 (88%), Positives = 273/292 (93%), Gaps = 4/292 (1%)

Query: 40  AFNPQQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTH 99
            FNPQQ  K  N++T+VALP+G+L TG++YSMYDVKGGSRGVIFDRLSGV+  V+GEGTH
Sbjct: 5   GFNPQQTQKFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTH 64

Query: 100 FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYD 159
           FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPN+ ELPKIYQNLGLDYD
Sbjct: 65  FLVPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYD 124

Query: 160 EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTF 219
           EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELS RA+EFG+RLEDVSITHMTF
Sbjct: 125 EKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTF 184

Query: 220 GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGL 279
           GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGL
Sbjct: 185 GPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGL 244

Query: 280 LLIRRLEASKDIAQTLANSPNITYLPGQ--QGGRGNDSG--SPNSLLLNIGR 327
           LLIRRLEASKDIAQTLANSPN+TYLPGQ    G G D G  SPNSLLLNIGR
Sbjct: 245 LLIRRLEASKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/288 (84%), Positives = 272/288 (94%), Gaps = 5/288 (1%)

Query: 42  NPQQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFL 101
           NP   ++L+++IT+VALP+GI+A+G++YSMYDVKGGSRGVIFDR++GV+++V+GEGTHFL
Sbjct: 3   NP---SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFL 59

Query: 102 VPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEK 161
           VPWLQKA+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+
Sbjct: 60  VPWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDER 119

Query: 162 VLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGP 221
           VLPSIGNEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGP
Sbjct: 120 VLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGP 179

Query: 222 EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL 281
           EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLL
Sbjct: 180 EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLL 239

Query: 282 IRRLEASKDIAQTLANSPNITYLPGQQGGRGN--DSGSPNSLLLNIGR 327
           IRRLEASKDIAQTLANS N+ YLP Q  G GN   SGSPNSLLLNIGR
Sbjct: 240 IRRLEASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 271/288 (94%), Gaps = 5/288 (1%)

Query: 42  NPQQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFL 101
           NP   ++ +++IT+VALP+G++A+GL+YSMYDVKGGSRGVIFDR++GV+++V+GEGTHFL
Sbjct: 3   NP---SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFL 59

Query: 102 VPWLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEK 161
           VPWLQKA+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+
Sbjct: 60  VPWLQKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDER 119

Query: 162 VLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGP 221
           VLPSIGNEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGP
Sbjct: 120 VLPSIGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGP 179

Query: 222 EFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL 281
           EFTKAVEQKQIAQQDAERAKF+VEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL
Sbjct: 180 EFTKAVEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLL 239

Query: 282 IRRLEASKDIAQTLANSPNITYLPGQQGGRGND--SGSPNSLLLNIGR 327
           IRRLEASKDIAQTLANS N+ YLP Q  G GN   SGSPNSLLLNIGR
Sbjct: 240 IRRLEASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  493 bits (1270), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/285 (83%), Positives = 263/285 (92%), Gaps = 1/285 (0%)

Query: 44  QQGTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVP 103
           QQ    + +IT+VA+P+GI  +GL+YSMYDV+GGSRGVIFDRL GV+  V+GEGTHFLVP
Sbjct: 3   QQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVP 62

Query: 104 WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVL 163
           WLQKA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VL
Sbjct: 63  WLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVL 122

Query: 164 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEF 223
           PSIGNEVLKSIVAQFDAAELITQREIVSQ+I+ ELS RA+EFGIRLEDVSITHMTFGPEF
Sbjct: 123 PSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEF 182

Query: 224 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 283
           TKAVEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAEYISKAL+KVGDGLLLIR
Sbjct: 183 TKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIR 242

Query: 284 RLEASKDIAQTLANSPNITYLPGQQ-GGRGNDSGSPNSLLLNIGR 327
           RLEASK+IAQTLANS NITYLP    GG  +D GSPN+LLLN+GR
Sbjct: 243 RLEASKEIAQTLANSNNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  492 bits (1266), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/282 (86%), Positives = 268/282 (95%), Gaps = 2/282 (0%)

Query: 48  KLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQK 107
           KL++VIT+VALP+GI+A+G++YSMYDVKGGSRGVIFDR++GV+++V+GEGTHFLVPWLQK
Sbjct: 6   KLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQK 65

Query: 108 AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIG 167
           A+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPSIG
Sbjct: 66  AIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIG 125

Query: 168 NEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAV 227
           NEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGPEFTKAV
Sbjct: 126 NEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAV 185

Query: 228 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEA 287
           EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLIRRLEA
Sbjct: 186 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 245

Query: 288 SKDIAQTLANSPNITYLPGQQ--GGRGNDSGSPNSLLLNIGR 327
           SKDIAQTLANS N+ YLP Q   GG    SGSPNSLLLNIGR
Sbjct: 246 SKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  487 bits (1253), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/281 (83%), Positives = 263/281 (93%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           T+ +NV+T++A+P G+L T ++YSMYDVKGGSRGVIFDR+SGV+K VIGEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KA+IYDVRTKPKSI+TNTGTKDLQMVSLTLR+LHRPN+ ELP+IYQNLGLDYDE+VLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLKSIVAQFDAAELITQREIVSQRI+ E+S RA+EFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERA+FLVEKAEQERQASVIRAEGEAESAE ISKAL++VGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           ASKDIA+TL+ S NITYLPG +G  G++   PNSLLLNIGR
Sbjct: 243 ASKDIARTLSKSSNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  482 bits (1241), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 241/284 (84%), Positives = 270/284 (95%), Gaps = 2/284 (0%)

Query: 46  GTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWL 105
            ++L++VIT+VALP+GI+ATG++Y+MYDVKGGSRGVIFDR++GV+++V+GEGTHFLVPWL
Sbjct: 4   ASRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWL 63

Query: 106 QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPS 165
           QKA+IYDVRTKPKSIATNTGT+DLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPS
Sbjct: 64  QKAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPS 123

Query: 166 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTK 225
           IGNEVLKSIVAQFDAAELITQREI+SQ+I+ ELSTRA+EFGI+LEDVSITHMTFGPEFTK
Sbjct: 124 IGNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTK 183

Query: 226 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRL 285
           AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE+ISKALAKVGDGLLLIRRL
Sbjct: 184 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRL 243

Query: 286 EASKDIAQTLANSPNITYLPGQQ--GGRGNDSGSPNSLLLNIGR 327
           EASKDIAQTLANS N+ YLP Q    G G+ SGSPNSLLLNIGR
Sbjct: 244 EASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/279 (82%), Positives = 258/279 (92%), Gaps = 2/279 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           ++L+  + RVA+PLGI+ +G++YSMYDV+GGSR VIFDRLSGVQK+V+GEGTHFLVPWLQ
Sbjct: 2   SRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KA++YD+RTKPK IATNTGTKD+QMVSLTLRVLHRP++ +LP+IYQNLGLDYDE+VLPSI
Sbjct: 62  KAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQRE+VSQRI+ ELS RA EFGIRLEDVSITHMTFGPEFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERAKFLVEKAEQ R+ASVIRAEGEAESAEYISKALA+ GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLE 241

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNI 325
           ASK+IAQTLA S NITYLPG+    GN  GS NSLLLNI
Sbjct: 242 ASKEIAQTLAASSNITYLPGK--AHGNTEGSQNSLLLNI 278

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  477 bits (1227), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/281 (81%), Positives = 255/281 (90%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           +KL + + R+ALP+GI  + L+YSMYDVKGG+R VIFDRLSGVQ++VIGEGTHFLVPWLQ
Sbjct: 2   SKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           +A++YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPSI
Sbjct: 62  RAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQREIVSQRI+ ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESA+YISKAL+K GDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLE 241

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           ASK+IAQTLANS N+TYLP    G     GSPNSLLLN+GR
Sbjct: 242 ASKEIAQTLANSSNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  472 bits (1214), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 261/283 (92%), Gaps = 2/283 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           TK+L+ + ++A+PLGI  +G++Y+MYDVKGGSR VIFDRLSGV+++VIGEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KA+++DVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++++LP IYQNLGLDYDE+VLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQREIVS +I+ ELS R++EFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERAKFLVE+AEQERQA+VIRAEGEAESAEYISKALAK GDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGND--SGSPNSLLLNIGR 327
           ASK+IA+TL+ S N+TYLP      GN+  +G+PNSLLLN+GR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  471 bits (1213), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/281 (80%), Positives = 256/281 (91%), Gaps = 2/281 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           ++L + + ++ALPLG+ A+ L+YSMYDVKGGSR VIFDRLSGVQ++V+GEGTHFLVPWLQ
Sbjct: 2   SRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KAV+YDVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 62  KAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQRE VSQRI+ ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERA+++VE AEQERQASVIRAEGEAESAEYISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           ASK+IA+TLANS N+TYLP       ++ GSPNSLLLN+GR
Sbjct: 242 ASKEIAKTLANSSNVTYLPSSHS--ASEQGSPNSLLLNLGR 280

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  465 bits (1197), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 221/282 (78%), Positives = 256/282 (90%), Gaps = 1/282 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           +K+++ + +VALP+GI+ +G+++SMYDVKGGSR VIFDR+SGV++ +IGEGTHFL+PWLQ
Sbjct: 2   SKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KA+IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 62  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
            NEVLK+IVAQFDAAELITQRE+VS RI++EL  R++EFGIRLEDVSITHMTFG EFTKA
Sbjct: 122 SNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VE KQIAQQDAERAKFLVEKAEQERQA+VIRAEGEAESAEYISKAL K GDGLLLIRRLE
Sbjct: 182 VELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLE 241

Query: 287 ASKDIAQTLANSPNITYLP-GQQGGRGNDSGSPNSLLLNIGR 327
           ASK+IA TL+ S N+TYLP G    RG   G+PN+LLLN+GR
Sbjct: 242 ASKEIAATLSQSSNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  459 bits (1181), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/282 (78%), Positives = 253/282 (89%), Gaps = 2/282 (0%)

Query: 46  GTKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWL 105
           G K+   + ++A+PLG+  + ++YSMYDVKGGSR VIFDR+ GV++ V+GEGTHFLVPWL
Sbjct: 3   GIKIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWL 62

Query: 106 QKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPS 165
           QK+VI+D+RTKPK+I TNTGT+DLQMVSLTLR+LHRP+I +LP IYQNLGLDYDE+VLPS
Sbjct: 63  QKSVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPS 122

Query: 166 IGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTK 225
           IGNEVLKSIVAQFDAAELITQREIVSQRI+ EL+ RA+EFGIRLEDVSITHMTFGPEFTK
Sbjct: 123 IGNEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTK 182

Query: 226 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRL 285
           AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRL
Sbjct: 183 AVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRL 242

Query: 286 EASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           E SK+IA+TLA SP++TYLPG  GG   +  S NSLLLN+GR
Sbjct: 243 ETSKEIAETLAGSPHVTYLPG--GGNQAEDASKNSLLLNLGR 282

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  456 bits (1173), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 232/283 (81%), Positives = 259/283 (91%), Gaps = 2/283 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           +K +NV++++A+P G+L    +Y+MYDVKGGSRGVIFDR+SGVQ+RV+GEGTHFLVPWLQ
Sbjct: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KA+IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP + ELP+IYQ+LGLDYDE+VLPSI
Sbjct: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLKSIVAQFDAAELITQRE+VSQRI+ ELSTRA EFGIRLEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIRAEGEAESAE ISKALAKVGDGLLLIRRLE
Sbjct: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLE 241

Query: 287 ASKDIAQTLANSPNITYLP--GQQGGRGNDSGSPNSLLLNIGR 327
           ASK+IA+TL+ S N+TYLP  G  G  G + GS N+LLLNIGR
Sbjct: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  452 bits (1162), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/264 (81%), Positives = 243/264 (92%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           ++  + + ++ALPLG+ A+ L+YSMYDVKGGSR VIFDRLSGVQ++V+GEGTHFL+PWLQ
Sbjct: 2   SRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KAV++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LP IYQNLGLDYDE+VLPSI
Sbjct: 62  KAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLKSIVAQFDAAELITQRE VSQRI+ ELS RA EF IRLEDVSITHMTFG +FTKA
Sbjct: 122 GNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VEQKQIAQQDAERA+F+VE AEQERQASVIRAEGEAESAEYISKALAK GDGLLLIRR+E
Sbjct: 182 VEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIE 241

Query: 287 ASKDIAQTLANSPNITYLPGQQGG 310
           ASK+IA+TLANS N+TYLP  Q G
Sbjct: 242 ASKEIAKTLANSSNVTYLPSNQQG 265

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  449 bits (1154), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 226/281 (80%), Positives = 253/281 (90%), Gaps = 1/281 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           ++L   + +VA+PLGI+A+G++YSMYDV+GGSR VIFDRLSGVQ+ V+GEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KAVIYDVRTKPKSIATNTGTKD+QMVSLTLRVLHRP + +LP IYQNLGLDYDE+VLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVA++DAAELITQRE+VS  I+ ELS RA EF IRLEDVSITHMTFGPEFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VE KQIAQQDAERAKFLVEKAEQ R+ SVIRAEGEAE+AE ISKALAK GDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 287 ASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           ASKDIAQTLANS N+TYLP QQ G G + G+  SLLLN+GR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGGQE-GTSQSLLLNLGR 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  426 bits (1095), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/282 (71%), Positives = 245/282 (86%), Gaps = 1/282 (0%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           ++ L  I  +A+P+G+     +  +YDV+GG+R VIFDRLSGVQ++V+GEGTHFL+PWLQ
Sbjct: 2   SRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           KAVIYDVRTKPK+IATNTGTKDLQ+V+LTLRVLHRP++  LPKIYQ LGLDYDE+VLPSI
Sbjct: 62  KAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQRE+VSQ+I+ EL+ RA  F I+LEDV+ITHM FG EFTK+
Sbjct: 122 GNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKS 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286
           VE+KQIAQQ++ERAK+LV+ AEQER A+VIRAEG+AE+AEYISKAL K GDGLL+IRRLE
Sbjct: 182 VEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLE 241

Query: 287 ASKDIAQTLANSPNITYLP-GQQGGRGNDSGSPNSLLLNIGR 327
           ASK IAQTLA S NITYLP   +GG  +  G+P+SLLLN+GR
Sbjct: 242 ASKKIAQTLAGSSNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/284 (71%), Positives = 254/284 (89%), Gaps = 5/284 (1%)

Query: 47  TKLLNVITRVALPLGILA---TGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVP 103
           ++L + + R+ LPL  +A   + +++SMYDV+GG+R +IFDR+SGV+  V+GEGTHFL+P
Sbjct: 2   SRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIP 61

Query: 104 WLQKAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVL 163
           WLQKA+I+DVRTKP++IATNTGTKDLQMVSLTLRVLHRP++  L +IY+ LG DYDE+VL
Sbjct: 62  WLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVL 121

Query: 164 PSIGNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEF 223
           PSIGNEVLK+IVAQF+A+ELITQRE+VSQ+I++EL+ RA EF IRLEDVSITHMTFG EF
Sbjct: 122 PSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEF 181

Query: 224 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIR 283
           TKAVEQKQIAQQ+++RAKF+VE+AEQER+A+VIRAEGEAE+AE+ISKAL K GDGLL+IR
Sbjct: 182 TKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIR 241

Query: 284 RLEASKDIAQTLANSPNITYLPGQQGGRGNDSGSPNSLLLNIGR 327
           RLEASK IA+TLANSPN+TYLP +  G+  DSG+PNSLLLN+GR
Sbjct: 242 RLEASKGIAETLANSPNVTYLPSK--GQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  367 bits (942), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 200/213 (93%)

Query: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106
           +++ +V+ R+A+P+G+  + ++YSMYDV+GG R VIFDRL GVQ+ VIGEGTHFLVPWLQ
Sbjct: 2   SRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQ 61

Query: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166
           K++++DVRTKPK+IATNTGTKDLQMVSLTLRVLHRP++ +LPKIYQNLG+DYDE+VLPSI
Sbjct: 62  KSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSI 121

Query: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226
           GNEVLK+IVAQFDAAELITQREIVSQRI++ELS RADEF I+LEDVSITHMTFG EFTKA
Sbjct: 122 GNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKA 181

Query: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAE 259
           VEQKQIAQQDAERA+FLVEKAEQER+A+VIRAE
Sbjct: 182 VEQKQIAQQDAERARFLVEKAEQERKAAVIRAE 214

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  292 bits (747), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 195/258 (75%), Gaps = 13/258 (5%)

Query: 67  LEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 126
           L+ S+++V GG R +++ R++GV  R+  EGTHF++PWL+  ++YDVR KP+++A+ TGT
Sbjct: 53  LQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGT 112

Query: 127 KDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 186
           KDLQMV++T RVL RP++R LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 113 KDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 172

Query: 187 REIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 246
           RE VS+ I+  L  RA +F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+K
Sbjct: 173 REKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDK 232

Query: 247 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITYLPG 306
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ LANSPN   L  
Sbjct: 233 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVLDN 291

Query: 307 QQGGRGNDSGSPNSLLLN 324
           +            SLLLN
Sbjct: 292 E------------SLLLN 297

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  290 bits (742), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 187/234 (79%), Gaps = 1/234 (0%)

Query: 67  LEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 126
           L  S+++V GG R +++ RLSGVQ+ V GEGTHF++PWL+  V+YDVR+KP+++++ TGT
Sbjct: 54  LNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGT 113

Query: 127 KDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 186
            DLQMV++T RVL RP+++ LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 NDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 187 REIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 246
           RE VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VEK
Sbjct: 174 RESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEK 233

Query: 247 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           A+QE+Q+ +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN
Sbjct: 234 AKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  290 bits (741), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 137/243 (56%), Positives = 188/243 (77%), Gaps = 1/243 (0%)

Query: 58  LPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKP 117
           L LG  A     ++++V GG R +++ R+ GV +++  EGTH ++PW++  ++YDVR KP
Sbjct: 47  LVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKP 106

Query: 118 KSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ 177
           +++A+ TGTKDLQMV++T RVL RPN+ +LP IY+ LG DYDE+VLPSI NEVLK++VAQ
Sbjct: 107 RNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQ 166

Query: 178 FDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDA 237
           F+A++LITQRE VS+ I+  L  RA  F I L+DVSIT+MTF PEFT+AVE KQIAQQDA
Sbjct: 167 FNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDA 226

Query: 238 ERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLAN 297
           +RA F+V+KA QE+Q  V++A+GEA+SAE I  A+ K  D + L +RL+ +KDIA+ LAN
Sbjct: 227 QRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILAN 285

Query: 298 SPN 300
           SPN
Sbjct: 286 SPN 288

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  288 bits (737), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ RL+GV  R+  EGTHF+ PW+   +IYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANSPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  288 bits (736), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           S+++V GG R +I+ RL+GVQ R+  EGTHF +PW +  ++YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RPN+ +LP +++ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ SPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 186/235 (79%), Gaps = 1/235 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           S+++V GG R +++ RL+GVQ R+  EGTHF +PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 57  SLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP +++ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITYL 304
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L++SPN   L
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 138/231 (59%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           S+++V GG R +++ RLSGV  ++  EGTHF++PWLQ  +IYDVR KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP+I  LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ SKDIA+ LA S N
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  ++  EGTHF++PW++  VIYDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RPN+ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +KDIA  LA SPN
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  287 bits (734), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  R+  EGTHF+ PWL   +IYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+SPN
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  287 bits (734), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 143/261 (54%), Positives = 191/261 (73%), Gaps = 13/261 (4%)

Query: 64  ATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATN 123
           A  L  ++++V GG R +++ R+SGV  R+  EGTHF +PW++  +IYDVR KP+++A+ 
Sbjct: 56  AMLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASL 115

Query: 124 TGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAEL 183
           TGTKDLQMV++T RVL RPN+ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++L
Sbjct: 116 TGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQL 175

Query: 184 ITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFL 243
           ITQRE VS+ I+  L  RA+ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+
Sbjct: 176 ITQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFV 235

Query: 244 VEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITY 303
           V+KA QE+Q  V+RA+GEA+SAE I  A+ K  D + L +RL+ +++IA+ LA SPN   
Sbjct: 236 VDKARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVV 294

Query: 304 LPGQQGGRGNDSGSPNSLLLN 324
           L  +            SLLLN
Sbjct: 295 LDNE------------SLLLN 303

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  286 bits (733), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 188/255 (73%), Gaps = 13/255 (5%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           S+++V GG R +++ R+SGV  ++  EGTHF++PW++  +IYDVR KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RPN+  LP IY+ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  R+  F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITYLPGQQG 309
           E+Q  V+RA+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN   L  +  
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVLDNE-- 295

Query: 310 GRGNDSGSPNSLLLN 324
                     SLLLN
Sbjct: 296 ----------SLLLN 300

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  286 bits (732), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  ++  EGTHF+ PWL   +IYDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LG DYDE+VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LANSPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  285 bits (728), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ G+Q+R+  EGTHF VPWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTGTKDL 117

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP + +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA+ L+ SPN
Sbjct: 238 EKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  284 bits (727), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 182/234 (77%), Gaps = 1/234 (0%)

Query: 67  LEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGT 126
           L  ++++V GG R +++ R+ GV  R+  EGTH ++PWL+  V+YDVR KP+++A+ TGT
Sbjct: 56  LNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGT 115

Query: 127 KDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQ 186
           KDLQMV++T RVL RPN+ +LP IY+ LG DY E+VLPSI NEVLK++VAQF+A++LITQ
Sbjct: 116 KDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQ 175

Query: 187 REIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 246
           RE VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 176 REKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 235

Query: 247 AEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           A QE+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IAQ LA SPN
Sbjct: 236 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  283 bits (724), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 183/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  ++  EGTHF+ PWL   ++YDVR KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ ++DIA+ LA+SPN
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  283 bits (723), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 129/231 (55%), Positives = 184/231 (79%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R++GVQ R+  EGTHF++PW++  V+YDVR KP+++++ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RPN+  LP IY+ LG+DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  +++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  L+ SPN
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPN 287

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  283 bits (723), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 137/255 (53%), Positives = 190/255 (74%), Gaps = 13/255 (5%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  ++  EGTHF++PWL+  V+YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LG DYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITYLPGQQG 309
           E+Q  V++A+GEA+SAE I +A+ K  D + L +RL+ +++IA  LA SPN   L  +  
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVLDNE-- 296

Query: 310 GRGNDSGSPNSLLLN 324
                     SLLLN
Sbjct: 297 ----------SLLLN 301

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  280 bits (716), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 181/231 (78%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  R+  EGTHF++PWL+  ++YDVR KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP +Y+ LG DYD++VLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A GEA+SAE I +A+ K  D + L +RL+ +K+IA  LA SPN
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPN 264

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  278 bits (712), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 182/231 (78%), Gaps = 1/231 (0%)

Query: 70  SMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDL 129
           ++++V GG R +++ R+ GV  R+  EGTH L+PW +  V+YDVR KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 130 QMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREI 189
           QMV++T RVL RP++ +LP IY+ LGLDYDE+VLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 190 VSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 249
           VS+ I+  L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 250 ERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPN 300
           E+Q  V++A+G+A+SAE I +A+ K  D + L +RL+ +++IAQ L+ SPN
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>KLTH0F18546g Chr6 (1498810..1507143) [8334 bp, 2777 aa] {ON}
           similar to uniprot|Q06179 Saccharomyces cerevisiae
           YLR454W FMP27 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 2777

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 207 IRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAE 266
           I+L DVSI++     + TK++E     Q+ AER++    ++ ++   + ++     ES E
Sbjct: 197 IKLRDVSISY----DQLTKSIESA-YQQKAAERSEAPANESHKDHFQTNMQPVTTGESIE 251

Query: 267 YISKALAKVGDGLLLIRRLEASKDIAQTLANSP 299
           YI   L K  D + +  R   + D    LA+ P
Sbjct: 252 YIKSLLLKASDFVTMFDRFYVALDTV-CLADIP 283

>ZYRO0B06666g Chr2 complement(533122..535101) [1980 bp, 659 aa] {ON}
           similar to Q04373 YDR496C uniprot|Q04373 Saccharomyces
           cerevisiae PUF6 Pumilio-homology domain protein that
           binds ASH1 mRNA at PUF consensus sequences
          Length = 659

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 119 SIATNTGTKDLQMVSLTLR-VLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQ 177
           S +   G+   Q++   +R  +H  N +E+ ++ + L   + E V    G+EV  +++A+
Sbjct: 305 SASVEKGSTGFQILHAAMRQFVHIANDKEIEELIEILHESFAELVHTPEGSEVACTLIAR 364

Query: 178 FDAAE----LITQREIVSQRIKSELSTRAD-EFGIRLEDVSITHMTFGP 221
            +A E    + + R+     IK+E  T A       ++D  + H TFGP
Sbjct: 365 TNAKERKQIIRSLRDHTEALIKNEYGTAAFITLLFCVDDTVLVHKTFGP 413

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 69/170 (40%), Gaps = 23/170 (13%)

Query: 139 LHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQFDAAELITQREIVSQRIKSEL 198
           LH   I EL + ++NL     E V+P +   +L+    QF  AE+     I  Q+   EL
Sbjct: 152 LHYKLISELKRCFENLQKKSYESVMPVVFLNLLRKCYPQF--AEVDNANGIFKQQDAEEL 209

Query: 199 STRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRA 258
            T+           S  ++ FG +FT   E          + +  ++ +  E   ++   
Sbjct: 210 FTQL---------FSSLNIVFGEKFTDDFEV---------QFRTTIKDSNNEDDVTIKEN 251

Query: 259 EGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANSPNITYLPGQQ 308
           E +++   +IS     + +GL+     E  K    T  NS   TYL  +Q
Sbjct: 252 EIDSKLKCHISGTTNFMKNGLIESLHEEIEKRSEHTGVNS---TYLVDKQ 298

>YNL137C Chr14 complement(368595..370055) [1461 bp, 486 aa] {ON}
           NAM9Mitochondrial ribosomal component of the small
           subunit
          Length = 486

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 31/61 (50%)

Query: 168 NEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAV 227
           NE  K  ++    + L + + I+++ +K       D F  R+ D+S   +TF P++ K +
Sbjct: 321 NETTKKELSDGAKSALRSGKRIIAESVKLWTKNITDHFKTRMSDISDGSLTFDPKWAKNL 380

Query: 228 E 228
           +
Sbjct: 381 K 381

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,920,520
Number of extensions: 1220165
Number of successful extensions: 4218
Number of sequences better than 10.0: 60
Number of HSP's gapped: 4367
Number of HSP's successfully gapped: 60
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)