Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E007803.495ON1711719061e-126
NDAI0G009103.495ON1631635443e-71
TPHA0D042603.495ON1581614391e-55
ZYRO0D09878g3.495ON1531634313e-54
TDEL0D056303.495ON1501634252e-53
KLTH0F14894g3.495ON1661624229e-53
Kpol_480.133.495ON1571604131e-51
SAKL0F02706g3.495ON1611654104e-51
YGR133W (PEX4)3.495ON1831624101e-50
Kwal_55.212463.495ON1601664053e-50
Suva_7.4213.495ON1651624011e-49
Smik_6.2293.495ON1651624002e-49
CAGL0I10450g3.495ON1621733923e-48
Skud_7.4443.495ON1621623862e-47
KAFR0C019903.495ON1511633766e-46
TBLA0C045003.495ON1651703542e-42
KNAG0B007803.495ON1531623228e-38
AFR314W3.495ON1551693166e-37
Ecym_12343.495ON1611632951e-33
KLLA0E04027g3.495ON1581662445e-26
Suva_4.3263.308ON1481122035e-20
KNAG0J023403.308ON1611332045e-20
Suva_2.2183.308ON1481122026e-20
Skud_4.3143.308ON1481122026e-20
YDR059C (UBC5)3.308ON1481122026e-20
KAFR0C002703.308ON1471102027e-20
Smik_4.2973.308ON1481122019e-20
Ecym_60388.375ON2111542051e-19
SAKL0A00396g8.375ON2151542051e-19
Smik_15.5177.54ON1561222002e-19
CAGL0E04752g3.308ON1471121982e-19
Skud_2.2073.308ON1481051982e-19
Smik_2.2193.308ON1481051982e-19
YBR082C (UBC4)3.308ON1481051982e-19
Skud_15.5047.54ON1561151974e-19
CAGL0E00671g8.375ON2131422015e-19
NCAS0A108003.308ON1481051965e-19
NDAI0A054903.308ON1471051965e-19
Skud_4.4418.375ON2151552006e-19
YDR177W (UBC1)8.375ON2151552006e-19
Suva_2.3438.375ON2151552006e-19
Smik_4.4258.375ON2151552006e-19
KLTH0E14300g3.308ON1471121966e-19
SAKL0B06512g3.308ON1471121966e-19
AER173C3.308ON1471121966e-19
Ecym_74313.308ON1471121957e-19
NCAS0B031508.375ON2141371998e-19
ADR169C8.375ON2111431981e-18
Kwal_27.124013.308ON2361121982e-18
TDEL0F021003.308ON1471121932e-18
ZYRO0G12870g3.308ON1471121913e-18
TBLA0I021303.308ON1481051913e-18
Suva_8.3897.54ON1561061913e-18
KLLA0E12563g3.308ON1481121904e-18
Kpol_1052.23.308ON1481121904e-18
YOR339C (UBC11)7.54ON1561231904e-18
KAFR0B060608.375ON2131191945e-18
TBLA0H031308.375ON2141181945e-18
TDEL0H039707.54ON1561191906e-18
TPHA0A038503.308ON1481051897e-18
NDAI0A011608.375ON2161061921e-17
TDEL0F049908.375ON2171191902e-17
KLLA0C18656g8.375ON2281061893e-17
KNAG0A048108.375ON2141181883e-17
NDAI0E038707.54ON1641191853e-17
Kpol_1030.108.375ON2151191875e-17
Kwal_23.64858.375ON2151061866e-17
TPHA0L008508.375ON2161311867e-17
KLTH0A07546g8.375ON2151191867e-17
SAKL0H17930g8.230ON1531091811e-16
KNAG0H029808.230ON1521511802e-16
ZYRO0C03784g8.375ON2181401822e-16
YDR092W (UBC13)8.230ON1531511783e-16
KLLA0C17622g8.230ON1591001774e-16
Kpol_1065.127.54ON1591151775e-16
TBLA0F024406.109ON1741481785e-16
ZYRO0C04950g6.109ON168991776e-16
KAFR0A024208.230ON1471111756e-16
Kwal_56.234828.230ON1491101756e-16
Smik_7.2226.109ON171991776e-16
CAGL0I00352g6.109ON167991767e-16
Suva_7.2136.109ON173991777e-16
YGL058W (RAD6)6.109ON172991777e-16
TDEL0G036106.109ON169991767e-16
AAR156C6.109ON170991767e-16
Kpol_461.86.109ON167991768e-16
NCAS0D032206.109ON171991768e-16
SAKL0A07260g6.109ON169991768e-16
KNAG0F025706.109ON151991758e-16
Ecym_30776.109ON170991768e-16
TPHA0J017506.109ON169991769e-16
KLTH0G14366g8.230ON1491091749e-16
NCAS0B040108.230ON1531091759e-16
KLTH0H06732g6.109ON160991759e-16
KAFR0A047006.109ON153991741e-15
Skud_4.3528.230ON1431091741e-15
KLLA0C05632g6.109ON164991751e-15
ZYRO0D04466g7.54ON1591601741e-15
NDAI0I016506.109ON176991752e-15
TDEL0A013408.230ON157991732e-15
Suva_2.2538.230ON1431101722e-15
Kpol_1075.1b8.230ON1521531732e-15
ZYRO0B11682g8.230ON1511091713e-15
Ecym_55638.230ON164991705e-15
Kwal_14.18286.109ON152991695e-15
AGR121C8.230ON1541001696e-15
Smik_4.3358.230ON1431011696e-15
TPHA0B034108.230ON1521511696e-15
Skud_7.2226.109ON170991707e-15
NDAI0J015408.230ON1541091671e-14
TBLA0F037908.230ON1511091652e-14
KAFR0H012303.308ON110951571e-13
CAGL0G08063g8.230ON1491001601e-13
TPHA0B007704.249ON157971601e-13
SAKL0B10582g7.54ON1611221592e-13
Smik_4.1714.249ON1571061592e-13
Kwal_26.70097.54ON1611221583e-13
KNAG0D043904.249ON1571001583e-13
KNAG0H018701.436ON2101201587e-13
YDL064W (UBC9)4.249ON1571061558e-13
CAGL0M03399g1.436ON2141201579e-13
Suva_4.1864.249ON1571061541e-12
Skud_5.871.436ON2101201561e-12
KLTH0D01760g7.54ON1611221541e-12
Kpol_483.164.249ON122941502e-12
Suva_5.531.436ON2151201542e-12
Smik_5.981.436ON2151201543e-12
YEL012W (UBC8)1.436ON2181201534e-12
KAFR0H029601.436ON1871321514e-12
TDEL0B056701.436ON2031251525e-12
NDAI0D011401.436ON2451121535e-12
KLLA0E05039g4.249ON157971495e-12
NCAS0A024904.249ON1571001496e-12
CAGL0D00814g4.249ON157991496e-12
Kpol_1030.181.436ON2231201517e-12
TPHA0O009201.436ON2261211517e-12
KLTH0D14344g4.249ON1571001471e-11
Skud_4.1914.249ON1571061462e-11
SAKL0H03058g4.249ON157971452e-11
ZYRO0E06358g2.569ON1651221452e-11
KLTH0H13816g1.436ON2331031482e-11
TBLA0A012901.436ON2191181482e-11
NCAS0G031301.436ON2311221482e-11
KLLA0A11198g1.436ON2021211473e-11
Ecym_32704.249ON157971443e-11
AEL045W1.436ON2111031473e-11
CAGL0M07568g2.569ON1651221443e-11
NDAI0D043804.249ON157971443e-11
Kwal_23.42274.249ON122941423e-11
TBLA0H026102.569ON1651281434e-11
ZYRO0E03806g1.436ON2091211454e-11
Ecym_13481.436ON2111041454e-11
ZYRO0B12386g4.249ON1571061425e-11
KLLA0E19119g6.187ON1391311416e-11
TDEL0E012204.249ON157971426e-11
TDEL0B065702.569ON1651581411e-10
AER056C4.249ON157971401e-10
SAKL0D10560g1.436ON2071201421e-10
Kwal_34.161741.436ON2131031421e-10
Smik_13.1862.569ON1651221392e-10
Suva_13.1892.569ON1651221392e-10
YMR022W (UBC7)2.569ON1651221392e-10
ABR059W2.569ON1651221382e-10
Skud_13.1762.569ON1651221383e-10
TPHA0I024602.569ON1671581373e-10
KLLA0E07745g2.569ON1651581373e-10
KNAG0M021502.569ON1701221374e-10
Kpol_1056.52.569ON1651581374e-10
KAFR0G032404.249ON157941364e-10
TPHA0J022506.187ON1371191302e-09
KAFR0A021602.569ON1651601312e-09
TBLA0E015704.49ON194981323e-09
SAKL0D13552g2.569ON1651221294e-09
Kwal_26.82242.569ON1651221295e-09
KAFR0F030404.49ON169901286e-09
TBLA0I029604.249ON157971278e-09
KLTH0D07986g2.569ON1651201279e-09
Suva_7.1826.187ON1371231259e-09
NCAS0A059404.49ON1931021281e-08
Ecym_45782.569ON1651221261e-08
TDEL0G015806.187ON1381301251e-08
Smik_12.3894.49ON187911252e-08
NCAS0A127402.569ON1651241242e-08
TPHA0F003904.49ON1931111253e-08
ZYRO0G08228g6.187ON1381241223e-08
TBLA0A019006.187ON1391311223e-08
KNAG0F021306.187ON1381311214e-08
NDAI0B015202.569ON1651241224e-08
CAGL0H03157g6.187ON1391401214e-08
YGL087C (MMS2)6.187ON1371231206e-08
SAKL0A05192g6.187ON1401311191e-07
KAFR0C021406.187ON1381321181e-07
KNAG0I029404.49ON197821192e-07
Kpol_YGOB_414.24.49ON193911192e-07
Kpol_414.2singletonOFF192911192e-07
CAGL0D06468g4.49ON1871151182e-07
Skud_12.3894.49ON1871131173e-07
Kwal_27.104443.301ON2781591193e-07
YLR306W (UBC12)4.49ON188731174e-07
KLTH0C04818g3.301ON2751001184e-07
CAGL0E04598g3.301ON2951001185e-07
KLLA0C17248g4.49ON1841051155e-07
NDAI0A055303.301ON2731021176e-07
KLLA0D09196g3.301ON292941176e-07
Suva_10.4014.49ON187961156e-07
TPHA0M012803.301ON4351001186e-07
NCAS0A107703.301ON2731001176e-07
AGL203C3.301ON2701001166e-07
Kpol_1065.453.301ON3231001177e-07
KAFR0H012703.301ON2871001167e-07
ZYRO0G12650g3.301ON285951168e-07
YDR054C (CDC34)3.301ON295951168e-07
KNAG0H010403.301ON2961001168e-07
TDEL0D032603.301ON2891001169e-07
Ecym_83714.49ON267861159e-07
Ecym_26693.301ON2681001159e-07
SAKL0D02530g3.301ON2721001159e-07
Skud_4.3063.301ON297951169e-07
Smik_4.2903.301ON297951159e-07
Suva_2.2113.301ON297951151e-06
NDAI0D029104.49ON1891051131e-06
TBLA0G032703.301ON3301001151e-06
NCAS0I014303.301ON2581001141e-06
TDEL0E055604.49ON187971112e-06
AFL064W6.187ON138821083e-06
Kpol_1002.656.187ON101861054e-06
NCAS0D036606.187ON1381461066e-06
Smik_7.1966.187ON100811021e-05
KLTH0H04796g6.187ON138851041e-05
KLTH0H09504g4.49ON184891051e-05
ADL035C4.49ON200911033e-05
NDAI0A075703.301ON2391061034e-05
ZYRO0G19910g4.49ON1791201015e-05
Kwal_27.111826.187ON10182967e-05
NDAI0I012306.187ON15785997e-05
Ecym_46837.392ON243871001e-04
KLLA0E20395g7.392ON25188991e-04
ZYRO0B03344g7.392ON25089991e-04
SAKL0H24112g4.49ON18574972e-04
Skud_7.1956.187ON10081932e-04
KNAG0J022803.301ON217104972e-04
Ecym_22306.187ON138137952e-04
TBLA0D006007.392ON256125963e-04
KAFR0L017507.392ON251127910.001
KNAG0B023607.392ON251131910.001
SAKL0F12474g7.392ON251125890.003
NCAS0A143907.392ON24084850.008
YER100W (UBC6)7.392ON25088850.008
Smik_5.2467.392ON25088850.009
NDAI0E041707.392ON257127840.011
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00780
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   353   e-126
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   214   3e-71
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   173   1e-55
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   170   3e-54
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   168   2e-53
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   167   9e-53
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   163   1e-51
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   162   4e-51
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   162   1e-50
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   160   3e-50
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   159   1e-49
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   158   2e-49
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   155   3e-48
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   153   2e-47
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   149   6e-46
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   140   2e-42
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   128   8e-38
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   126   6e-37
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   118   1e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    99   5e-26
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    83   5e-20
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    83   5e-20
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    82   6e-20
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    82   6e-20
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    82   6e-20
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    82   7e-20
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    82   9e-20
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    84   1e-19
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    84   1e-19
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    82   2e-19
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    81   2e-19
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    81   2e-19
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    81   2e-19
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    81   2e-19
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    80   4e-19
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    82   5e-19
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    80   5e-19
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    80   5e-19
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    82   6e-19
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    82   6e-19
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    82   6e-19
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    82   6e-19
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    80   6e-19
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    80   6e-19
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    80   6e-19
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    80   7e-19
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      81   8e-19
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    81   1e-18
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    81   2e-18
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    79   2e-18
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    78   3e-18
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    78   3e-18
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    78   3e-18
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    78   4e-18
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    78   4e-18
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    78   4e-18
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    79   5e-18
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    79   5e-18
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    78   6e-18
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    77   7e-18
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      79   1e-17
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    78   2e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    77   3e-17
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    77   3e-17
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    76   3e-17
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    77   5e-17
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    76   6e-17
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    76   7e-17
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    76   7e-17
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    74   1e-16
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    74   2e-16
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    75   2e-16
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    73   3e-16
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    73   4e-16
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    73   5e-16
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    73   5e-16
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    73   6e-16
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    72   6e-16
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    72   6e-16
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    73   6e-16
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    72   7e-16
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    73   7e-16
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    73   7e-16
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    72   7e-16
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    72   7e-16
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    72   8e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      72   8e-16
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    72   8e-16
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    72   8e-16
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    72   8e-16
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    72   9e-16
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    72   9e-16
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    72   9e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    72   9e-16
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    72   1e-15
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    72   1e-15
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    72   1e-15
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    72   1e-15
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      72   2e-15
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    71   2e-15
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    71   2e-15
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    71   2e-15
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    70   3e-15
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    70   5e-15
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    70   5e-15
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    70   6e-15
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    70   6e-15
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    70   6e-15
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    70   7e-15
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    69   1e-14
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    68   2e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    65   1e-13
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    66   1e-13
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    66   1e-13
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    66   2e-13
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    66   2e-13
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    65   3e-13
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    65   3e-13
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    65   7e-13
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    64   8e-13
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    65   9e-13
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    64   1e-12
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    65   1e-12
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    64   1e-12
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    62   2e-12
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    64   2e-12
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    64   3e-12
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    64   4e-12
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    63   4e-12
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    63   5e-12
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    64   5e-12
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    62   5e-12
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    62   6e-12
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    62   6e-12
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    63   7e-12
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    63   7e-12
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    61   1e-11
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    61   2e-11
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    60   2e-11
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    60   2e-11
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    62   2e-11
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    62   2e-11
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                62   2e-11
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    61   3e-11
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    60   3e-11
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    61   3e-11
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    60   3e-11
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    60   3e-11
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    59   3e-11
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    60   4e-11
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    60   4e-11
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    60   4e-11
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    59   5e-11
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    59   6e-11
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    59   6e-11
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    59   1e-10
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    59   1e-10
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    59   1e-10
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    59   1e-10
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    58   2e-10
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    58   2e-10
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    58   2e-10
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    58   2e-10
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    58   3e-10
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    57   3e-10
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    57   3e-10
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    57   4e-10
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    57   4e-10
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    57   4e-10
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    55   2e-09
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    55   2e-09
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    55   3e-09
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    54   4e-09
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    54   5e-09
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    54   6e-09
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    54   8e-09
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    54   9e-09
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    53   9e-09
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     54   1e-08
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    53   1e-08
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    53   1e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    53   2e-08
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    52   2e-08
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    53   3e-08
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    52   3e-08
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    52   3e-08
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    51   4e-08
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    52   4e-08
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    51   4e-08
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    51   6e-08
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    50   1e-07
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    50   1e-07
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    50   2e-07
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    50   2e-07
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    50   2e-07
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    50   2e-07
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    50   3e-07
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    50   3e-07
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    50   4e-07
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    50   4e-07
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    50   5e-07
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    49   5e-07
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    50   6e-07
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    50   6e-07
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    49   6e-07
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    50   6e-07
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    50   6e-07
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    49   6e-07
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    50   7e-07
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                49   7e-07
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    49   8e-07
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    49   8e-07
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                49   8e-07
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    49   9e-07
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    49   9e-07
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    49   9e-07
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    49   9e-07
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    49   9e-07
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    49   9e-07
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    49   1e-06
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       48   1e-06
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    49   1e-06
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                49   1e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    47   2e-06
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    46   3e-06
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    45   4e-06
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    45   6e-06
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    44   1e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    45   1e-05
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    45   1e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    44   3e-05
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    44   4e-05
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    44   5e-05
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    42   7e-05
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    43   7e-05
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    43   1e-04
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    43   1e-04
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    43   1e-04
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    42   2e-04
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    40   2e-04
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    42   2e-04
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    41   2e-04
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    42   3e-04
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    40   0.001
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    40   0.001
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    39   0.003
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    37   0.008
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    37   0.008
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    37   0.009
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    37   0.011
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    37   0.012
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    37   0.012
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    37   0.013
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    37   0.016
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    37   0.016
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    36   0.019
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    36   0.019
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    36   0.025
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    36   0.027
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    36   0.030
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    35   0.049
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    29   6.2  

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  353 bits (906), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
           ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPSTTK 171
           MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPSTTK
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPSTTK 171

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  214 bits (544), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 120/163 (73%), Gaps = 5/163 (3%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS-TSDLTHWQAQIKGPQGTP 59
           MSR++KEYK IQ  L+ N     NN DDEFN II  L PI    DLT W+A IKGPQGTP
Sbjct: 1   MSRIIKEYKTIQKQLNNNR----NNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTP 56

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119
           Y    F L I  P  YP  PP   FQP SMPHCNVN+ TG ICLDIL++ HWTP WNLM+
Sbjct: 57  YYGFNFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMS 116

Query: 120 TMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           T+KAIW+LLKDPVP+SPLNVD+AN+LR  D SAYNGL+NYYL+
Sbjct: 117 TLKAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  173 bits (439), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 82/161 (50%), Positives = 107/161 (66%), Gaps = 12/161 (7%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           + RLLKE + I+  LS             +++ I  L P++  +   W+A +KGP  TPY
Sbjct: 3   LKRLLKEKRLIEKELSG------------YSESIELLEPVAFENFLKWRAVLKGPVNTPY 50

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
             H F+L IE P  YP+ PP I F+P SMPHCNV F TG ICL+ILE +HW+P WNLM  
Sbjct: 51  HKHSFKLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYV 110

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           M A++ LL++PV DSPLN+D+ANILR  D SAY+GL+NYYL
Sbjct: 111 MVALYQLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  170 bits (431), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 81/163 (49%), Positives = 108/163 (66%), Gaps = 10/163 (6%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  KEYK I   L           D+ ++Q+I  + P    DLT W+A I+GP GTPY
Sbjct: 1   MSRAAKEYKTITKVL--------KEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPY 50

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
               F+L +  P  YP+ PP + F+P +MPH NV+F+TG ICLDIL KQHW+PAW+L+  
Sbjct: 51  EGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHV 110

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163
           ++AI  LL +PV  SPLNVDIANIL+ ND +AY GL++YY+ +
Sbjct: 111 VQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  168 bits (425), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 107/163 (65%), Gaps = 13/163 (7%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           M+R+ +EYK IQ TL   S+            ++  L PI   DL+ W  +I+GP GTPY
Sbjct: 1   MARIAREYKHIQATLGSESS------------LVVSLEPID-GDLSRWAGEIRGPTGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
             H F L++     YP  PP + F   SMPHCNVN++TG+ICL+IL  +HW+PAW+L+  
Sbjct: 48  EGHTFSLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHV 107

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163
           ++AI  LL DP PDSPL++D+ANILR  D+SAY GL+NYYL +
Sbjct: 108 LEAIIQLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  167 bits (422), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 10/162 (6%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RL KEY+ +  TL           D E+  II+ L P+S  +L  W++ I GP  TPY  
Sbjct: 4   RLAKEYRALSKTL---------GRDPEYAYIIS-LAPVSEENLRKWESLITGPPDTPYFG 53

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122
           HEF LQIE    YP+EPP + FQ   MPHCNV+F +G ICL +L+  HWTPAW+L+  + 
Sbjct: 54  HEFTLQIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVH 113

Query: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
           AIW+LL  P PDSPL+VD+A ++R  D+SA+N L+ YYL+  
Sbjct: 114 AIWLLLASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGG 155

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  163 bits (413), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 12/160 (7%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLLKEY+ ++  L     +H N        II+ L PI + DLT+W A I GP  TPY  
Sbjct: 5   RLLKEYQVVKKELG----NHKN--------IISSLEPIDSDDLTNWTATILGPPNTPYHG 52

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122
           H F L+I   P YP++PP + F    MPHCN+ F+TG ICL+IL+  +W+P WNL+T + 
Sbjct: 53  HSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVL 112

Query: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           AI+ LL DPV DSPLN+D++NIL++ D SAY GL+ YYL+
Sbjct: 113 AIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  162 bits (410), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 108/165 (65%), Gaps = 13/165 (7%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           + R+ KE+K ++ TL+         +D  +N I+  L P  T ++ HW A I GP  TPY
Sbjct: 3   LQRITKEFKSVRKTLA---------EDPSYNHILK-LEPKDTGNMYHWIADISGPPETPY 52

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLS---MPHCNVNFQTGAICLDILEKQHWTPAWNL 117
           A+  F L +E P  YP+EPP + F P S   + HCNV+F+TG ICLDIL ++HW+P W+L
Sbjct: 53  ASAVFALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDL 112

Query: 118 MTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           +  + AIWILL +PVP+SPLNVDIAN+L+  D  AY GL+ YY+ 
Sbjct: 113 VHVIHAIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  162 bits (410), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 108/162 (66%), Gaps = 5/162 (3%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR++KEYK I  TL+ +    N      +  II  L+PI  +DL+ W+A I GP  TPY
Sbjct: 19  MSRIVKEYKVILKTLASDDPIAN-----PYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
            NH+F++ IE P +YP+ PP I F   ++ HCNV   TG ICL+IL+ + WTP W+L+  
Sbjct: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHC 133

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           + A+W LL++PV DSPL+VDI NI+R  D SAY G++ Y+L+
Sbjct: 134 VHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  160 bits (405), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 104/166 (62%), Gaps = 10/166 (6%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RL KEYK +  TL  +  + +          I  L P+S  +L  W+A I GP  TPY  
Sbjct: 4   RLAKEYKTLLKTLKEDPAYSH----------IRKLRPVSDDNLYVWEADITGPSDTPYQG 53

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122
           HEF L I  P  YP+EPP + F    +PHCNV+F++G IC+++LE+ HW+PAW+L+  + 
Sbjct: 54  HEFSLLITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVH 113

Query: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPS 168
           AIW+LL +P PDSPL+VD+A + R  D SA+NGL+ YYL+     S
Sbjct: 114 AIWLLLANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSRGS 159

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  159 bits (401), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR+ KEY+ I+ TL+ +    N      +  II  L+P   +DL+ W+A I GP+ TPY
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVN-----PYRGIIESLNPTDETDLSKWEATICGPEHTPY 55

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
             ++F++ I+ P +YP+ PP I F+  ++ HCN+N  TG ICLDIL+ Q WTP W+L+  
Sbjct: 56  ERYQFRMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHC 115

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           + A+W LL++PV DSPL+VD+ NI+R  D+ AY G++ Y+L+
Sbjct: 116 VHAVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  158 bits (400), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 109/162 (67%), Gaps = 5/162 (3%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR+ KEY+ I  TL+ +    N      +  II  L+PI  +DL+ W+A+I GP  TPY
Sbjct: 1   MSRITKEYRVILKTLASDDPIVN-----PYRGIIRSLNPIDETDLSRWEAKIYGPSHTPY 55

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
            N++F + I+ P +YP+ PP I+F+   + HCNV   TG ICLDIL+ + WTP W+L+  
Sbjct: 56  ENYQFHILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHC 115

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           + A+W LL++PV DSPL+VD+ NI+R  D+SAY G++ Y+L+
Sbjct: 116 VHAVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  155 bits (392), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 81/173 (46%), Positives = 112/173 (64%), Gaps = 17/173 (9%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           M+R+ KE  KI+  L         + D EF   +  L P+  SDL+ W A IKGP  TPY
Sbjct: 1   MARISKELLKIRKAL--------EHGDSEF---LVDLAPVDDSDLSRWFAVIKGPAETPY 49

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSM------PHCNVNFQTGAICLDILEKQHWTPA 114
             +EF+L IE P +YP+ PP I F   +       PHCNV+ +TG ICLDIL+ + W+P 
Sbjct: 50  YPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPI 109

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167
           W+++  ++AI ILL++PVPDSPL+VD+ANIL+ ND SAYNG++ Y+L+   SP
Sbjct: 110 WDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  153 bits (386), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 74/162 (45%), Positives = 105/162 (64%), Gaps = 5/162 (3%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR+ KEY  IQ TL+ N    N      +  +I  L+PI  +DL+ W+A I GP  TPY
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVN-----PYQGLIESLNPIDETDLSKWEAIIIGPTHTPY 55

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
            ++ F++ I+ P +YP+ PP I F   ++ HCN+   TG ICLDIL+ + WTP W+L+  
Sbjct: 56  EHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHC 115

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
           + AIW LLK+PV DSPL+VD+ NI+R  D  AY G++ Y+L+
Sbjct: 116 VHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLA 157

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  149 bits (376), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 78/163 (47%), Positives = 108/163 (66%), Gaps = 16/163 (9%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61
           SR+LKEYK  ++  S               Q I  L PIST DLTHW+  IKGP  +P+A
Sbjct: 3   SRILKEYKDSRSLQS---------------QYILALDPISTDDLTHWECTIKGPLHSPFA 47

Query: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
           NH F+L+I+ P TYP+  PI  F+P +MPH NVNF+TG ICLDIL+  +W+P +N+   +
Sbjct: 48  NHTFKLRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIV 106

Query: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
           +AI  LL +P   SPLN+D+AN+LR +D  AY+ L++Y+L+ S
Sbjct: 107 EAIVWLLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHLNNS 149

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  140 bits (354), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 106/170 (62%), Gaps = 16/170 (9%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS--TSDLTHWQAQIKGPQGT 58
           MSR++KEY  I+     N+   N          +T LHP+S  TSDL++W + I GP+ +
Sbjct: 1   MSRIIKEYNHIRKL---NALPDN----------MTTLHPVSNATSDLSNWHSIILGPKDS 47

Query: 59  PYANHEFQLQIECPPTYPIEPPIIHFQPLSMP-HCNVNFQTGAICLDILEKQHWTPAWNL 117
           PY N  F L+I  P  YP  PP+I F   S+P HCNVNF TG ICL+IL+ ++W+P WNL
Sbjct: 48  PYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNL 107

Query: 118 MTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167
           + +++AI  LL  P P SPLN+D++ +L + D  AYN L+ YYL   P P
Sbjct: 108 LYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  128 bits (322), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 96/162 (59%), Gaps = 15/162 (9%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           R+L+EY+++   ++     + +N           LHP   +DLTHW+A ++GPQGTPY  
Sbjct: 4   RVLREYRRL---VAAGGAANESN-----------LHPTDPADLTHWEATLEGPQGTPYEG 49

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122
           H F L++  P  YP  PP + F   +MPH NV + TG +CLD L    WTP  +L   + 
Sbjct: 50  HSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG-WTPVMDLQYAVM 108

Query: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
           A+  LL +P P+SPLN+++A + R+ D  AY+G++ Y L+ S
Sbjct: 109 AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  126 bits (316), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 98/169 (57%), Gaps = 16/169 (9%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS--TSDLTHWQAQIKGPQGT 58
           M R+L+EYK++Q  L+              +  +  L P+     DL  W+A  +GP+ T
Sbjct: 1   MRRILREYKQLQKQLA-------------LHPAVLSLAPVGEENGDLHRWEAHFQGPENT 47

Query: 59  PYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           PYA   F L+I  P TYP EPP   F P  + H N+ + TG +CLD+L+ + W+P +NL+
Sbjct: 48  PYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLL 107

Query: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167
             ++AI  LL +P  DSPL+VD++  L   D++AY+G++NY L   P P
Sbjct: 108 QVVEAISTLLAEPGVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTRPQP 155

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  118 bits (295), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/163 (39%), Positives = 93/163 (57%), Gaps = 15/163 (9%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS-TSDLTHWQAQIKGPQGTPY 60
           SR+L EYK+I+  L  + +             I  L P      L+ W+AQ  GP+ TPY
Sbjct: 10  SRMLAEYKQIREQLQSHES-------------ILMLCPAGDGGSLSKWEAQFCGPENTPY 56

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
           A+  F L IE P  YP EPP   F P  + H N+ + TG +CLD+L+ + W+P +NL+  
Sbjct: 57  ADFTFTLSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQV 116

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163
           ++AI  LL +P  DSPL+VD+A +  V D+ AY GL+ Y L +
Sbjct: 117 VEAIRTLLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCS 158

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 98.6 bits (244), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 15/166 (9%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR++KEY  +Q  L             EF+ I ++L P+   DL+ W  + +GP  +P+
Sbjct: 1   MSRIVKEYMGLQKRLQTP----------EFSWI-SFLAPVDDDDLSEWVCRFQGPSESPF 49

Query: 61  ANHEFQLQIECP-PTYPIEP-PIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
              E  L I      YPI   P + F+P ++ H NV + TG ICLD+L K  WTP + L+
Sbjct: 50  EGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLL-KDAWTPIYTLL 108

Query: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
             + AI  LL DP  DSPL++DIA I    D  AY  ++ Y L  +
Sbjct: 109 DVVGAIRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEEA 153

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 82.8 bits (203), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I +  D+S Y  
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEA 137

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 83.2 bits (204), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 70/133 (52%), Gaps = 11/133 (8%)

Query: 30  FNQIITYLHPIST-------SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPII 82
           FN   +   PIS+        DL HWQA I GP  +PYA   F L I  P  YP +PP I
Sbjct: 22  FNLFSSQRDPISSFSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKI 81

Query: 83  HFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
            F    + H N+N   G ICLDIL+ Q W+PA  L   + +I  LL D  PD PL  +IA
Sbjct: 82  SFT-TKIYHPNIN-ANGNICLDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIA 138

Query: 143 NILRVNDQSAYNG 155
           +I +  D+S Y  
Sbjct: 139 HIYKT-DRSKYEA 150

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP ++F    + H N+N  +G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA I +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEA 137

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP ++F    + H N+N  +G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA I +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEA 137

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP ++F    + H N+N  +G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA I +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEA 137

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 63/110 (57%), Gaps = 4/110 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I +  D+S Y
Sbjct: 87  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKY 134

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.0 bits (201), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP ++F    + H N+N  +G ICL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFT-TKIYHPNIN-SSGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + ++  LL D  PD PL  +IA I +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKT-DKAKYEA 137

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 83.6 bits (205), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 85/154 (55%), Gaps = 16/154 (10%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ+            DD + N  +++   +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRLMKEIQSV----------KDDPDANISLSF---VSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + I+ P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L T+
Sbjct: 48  HGGKFVVDIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDIL-KNSWSPVLTLKTS 105

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A    ++D+S+++
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAKHY-LSDRSSFD 138

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 83.6 bits (205), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 81/154 (52%), Gaps = 16/154 (10%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ             DD E N  +++   +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIIKEIQAA----------KDDPEANITLSF---VSESDIHHLKGSFYGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
               F + I+ P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGNFIVDIQVPLEYPFKPPKMQFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A    + D+S+++
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAQHF-IRDKSSFD 138

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 68/122 (55%), Gaps = 3/122 (2%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P+  +DLT+W   I GPQGTPY+  +F++ +  P  YP  PP I F    M H NV+ ++
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFVS-PMWHPNVD-KS 89

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLN 158
           G ICLDIL K+ W+  +N+ T + ++  LL +P   SPLN   A +   N       LL 
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAELWDTNMVEYRKKLLA 148

Query: 159 YY 160
            Y
Sbjct: 149 CY 150

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 68/115 (59%), Gaps = 4/115 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P+  +DLT+W   I GPQGTPY++ +F++ +  P  YP  PP + F    M H NV+ ++
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVS-PMWHPNVD-KS 89

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153
           G ICLDIL K+ W+  +N+ T + ++  LL +P   SPLN  +A  L   D   Y
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGY 142

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 82.0 bits (201), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 74/142 (52%), Gaps = 15/142 (10%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K++Q             DD E N  + +   +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIMKELQAV----------KDDPEANISLEF---VSESDIHHLKGSFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGKFIVDIEVPMEYPFKPPKMKFDS-KVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIA 142
           + ++  LL+ P P+ P + ++A
Sbjct: 106 LISLQALLQSPEPNDPQDAEVA 127

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 88  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 87  DILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 130

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 18/155 (11%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ      + H            IT L  +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAH------------IT-LEFVSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGKFVVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 18/155 (11%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ      + H            IT L  +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAH------------IT-LEFVSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGKFVVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 18/155 (11%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ      + H            IT L  +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAH------------IT-LEFVSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGKFVVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 81/155 (52%), Gaps = 18/155 (11%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ      + H            IT L  +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAH------------IT-LEFVSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
              +F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + 
Sbjct: 48  EGGKFVVDIEVPMEYPFKPPKMQFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSA 105

Query: 121 MKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
           + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 80.1 bits (196), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 81.3 bits (199), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 75/137 (54%), Gaps = 5/137 (3%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +    GP GTPY   +F + IE P  YP +PP++ F    + H N++ 
Sbjct: 24  LEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPMEYPFKPPMMKFD-TKVYHPNISS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN-- 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A    + D+ ++N  
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHY-LKDRESFNKT 140

Query: 155 GLLNYYLSASPSPSTTK 171
             L   L ASP  +  K
Sbjct: 141 AALWTKLYASPDGAIGK 157

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 15/143 (10%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           MSR  +  K+IQ+            DD + N  + +   +S SD+ H +    GP GTPY
Sbjct: 1   MSRAKRLMKEIQSV----------KDDPDANISLAF---VSESDIHHLKGTFLGPPGTPY 47

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
               F + I+ P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L T+
Sbjct: 48  HGGTFIVDIQVPLEYPFKPPKMQFDT-KVYHPNISSVTGAICLDIL-KNSWSPVLTLKTS 105

Query: 121 MKAIWILLKDPVPDSPLNVDIAN 143
           + ++  LL+ P P+ P + ++A 
Sbjct: 106 LISLQALLQSPEPNDPQDAEVAK 128

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 118 DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 175

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 176 DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEA 225

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 29  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFT-TKIYHPNIN-ANGNICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I +  D++ Y  
Sbjct: 87  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRAKYEA 136

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA+I + +
Sbjct: 88  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKTD 131

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 64/106 (60%), Gaps = 3/106 (2%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P   +DLT+W   I GPQGTPY++ +F++ +  P +YP  PP + F    M H NV+  +
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS-PMWHPNVDM-S 89

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANI 144
           G ICLDIL K+ W+  +N+ T + ++  LL +P   SPLN   A +
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA++ +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT-DRAKYEA 137

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 63/112 (56%), Gaps = 4/112 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNG 155
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA++ +  D++ Y  
Sbjct: 88  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT-DRAKYEA 137

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 72/123 (58%), Gaps = 5/123 (4%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLS-MPHCNVNFQ 97
           P+  +DLT+W   I GP+ TPY+  +F++ ++ P  YP  PP+I F  LS M H NV+ +
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF--LSPMWHPNVD-K 88

Query: 98  TGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLL 157
           +G ICLDIL K+ W+  +N+ T + ++  LL +P   SPLN   A +   + +     +L
Sbjct: 89  SGNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEYRKKVL 147

Query: 158 NYY 160
             Y
Sbjct: 148 ACY 150

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 68/119 (57%), Gaps = 5/119 (4%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  +  SD+ H +    GP GTPY N  F + IE P  YP +PP + F    + H N++ 
Sbjct: 24  LEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPFKPPQMKFD-TKVYHPNISS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 79.3 bits (194), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 65/118 (55%), Gaps = 3/118 (2%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +    GP GTPY    F + IE P  YP +PP + F    + H N++ 
Sbjct: 24  LDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPMEYPFKPPKMKFD-TKVYHPNISS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A    + D+  +N
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHY-LKDKEGFN 138

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 77.8 bits (190), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 4/119 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  DLT W   I GP+GTPY N +F+L ++    YP +PP + F    M H NV+  +
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVS-PMWHPNVDM-S 90

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLL 157
           G ICLDIL K  W+  +N+ T + ++  LL++P   SPLN  IA  L   D   Y   L
Sbjct: 91  GNICLDIL-KDQWSAVYNVQTILLSLQALLEEPNNGSPLNA-IAAELWDTDMDEYKKRL 147

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 3/105 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           D+ HWQA I GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICL
Sbjct: 30  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICL 87

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           DIL+ Q W+PA  +   + +I  LL D  PD PL  +IA++ + +
Sbjct: 88  DILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKTD 131

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 78.6 bits (192), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 2/106 (1%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +    GP GTPY   +F + IE P  YP +PP + F    + H N++ 
Sbjct: 24  LEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFD-TKVYHPNISS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 68/119 (57%), Gaps = 5/119 (4%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +    GP GTPY    F + IE P  YP +PP + F    + H NV+ 
Sbjct: 24  LEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPMEYPFKPPKMKFD-TKVYHPNVSS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA-NILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A + LR  D+ ++N
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLR--DKDSFN 138

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 77.4 bits (189), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +    GP GTPY   +F + I  P  YP +PP + F    + H NV+ 
Sbjct: 24  LKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFDT-KVYHPNVSS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
            TGAICLDIL K  WTP   L + + ++  LL+ P P+ P +  +A
Sbjct: 83  VTGAICLDIL-KNAWTPVITLKSALISLQALLQSPEPNDPQDAQVA 127

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 77.0 bits (188), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 67/118 (56%), Gaps = 3/118 (2%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ SD+ H +   +GP  TPY   +F + IE P  YP +PP + F    + H NV+ 
Sbjct: 24  LEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPMEYPFKPPKMKFD-TKVYHPNVSS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A    + D+ ++N
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHY-LKDRESFN 138

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P    DLTHW A I GP+ TPY    F+L  +   +YP  PP++ F    M H NV+  +
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFIS-PMWHPNVDM-S 97

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLL 157
           G ICLDIL+ Q W+  +N+ T + ++  LL++P   SPLN  +A  L  +D + Y   L
Sbjct: 98  GNICLDILKDQ-WSAVYNVETILLSLQALLEEPNNSSPLNA-VAAELWDDDMNEYKKRL 154

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 76.6 bits (187), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 66/119 (55%), Gaps = 5/119 (4%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  +S SD+ H +    GP  TPY    F + IE P  YP +PP + F    + H N++ 
Sbjct: 24  LEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPMEYPFKPPKMKFD-TKVYHPNISS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN-ILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A   LR  D+ ++N
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLR--DRESFN 138

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 62/106 (58%), Gaps = 2/106 (1%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ +D+   +    GP GTPY N ++ + IE P  YP +PP + FQ   + H NV+ 
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPMEYPFKPPKMKFQT-KVYHPNVSS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 76.3 bits (186), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 25  NDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHF 84
            DD E N  + +   +S +D+ H +    GP  TPY   +F + IE P  YP +PP + F
Sbjct: 15  RDDPEANIDLEF---VSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPFKPPKMKF 71

Query: 85  QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA-N 143
               + H N++  TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A +
Sbjct: 72  D-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQH 129

Query: 144 ILRVNDQSAYN 154
            LR  D+ ++N
Sbjct: 130 YLR--DRESFN 138

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 76.3 bits (186), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 69/119 (57%), Gaps = 5/119 (4%)

Query: 37  LHPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNF 96
           L  ++ +D+   +    GP GTPY N +F + IE P  YP +PP + F    + H NV+ 
Sbjct: 24  LQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPMEYPFKPPKMKFD-TKVYHPNVSS 82

Query: 97  QTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN-ILRVNDQSAYN 154
            TGAICLDIL K  W+P   L + + ++  LL+ P P+ P + ++A   LR  D+++++
Sbjct: 83  VTGAICLDIL-KNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHFLR--DKASFD 138

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++Q  I+GPQ +PY N  F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N++ A
Sbjct: 89  DVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 136

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 80/151 (52%), Gaps = 20/151 (13%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61
            R++KE +++ T   P  T   ++D+                 L +++  ++GP G+PY 
Sbjct: 6   KRIIKETERLITDPVPGITAEPHDDN-----------------LRYFEVTVEGPVGSPYE 48

Query: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
           N  FQL++  P  YP+E P + F    + H N++ + G ICLD+L K +W+PA  + T +
Sbjct: 49  NGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVL 105

Query: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
            +I  LL  P P+ PL  D+A     ++++A
Sbjct: 106 LSIQALLASPNPNDPLANDVAEDWIKDEEAA 136

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 69/140 (49%), Gaps = 18/140 (12%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RL+KE + ++   + N T                L  IS SD+   +    GP  TPY  
Sbjct: 6   RLMKELQAVRDDPAANIT----------------LEFISESDIHRLKGSFLGPPETPYQG 49

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122
             F + IE P  YP +PP + F    + H N++  TGAICLDIL K  W+P   L + + 
Sbjct: 50  GRFIIDIEVPMEYPFKPPKMKFD-TKVYHPNISSVTGAICLDIL-KNAWSPVITLKSALI 107

Query: 123 AIWILLKDPVPDSPLNVDIA 142
           ++  LL+ P P+ P + ++A
Sbjct: 108 SLQALLQSPEPNDPQDAEVA 127

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 20/151 (13%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61
            R++KE +K+ +   P  T   ++D+                 L ++Q  I+GP+ +PY 
Sbjct: 6   KRIIKETEKLVSDPVPGITAEPHDDN-----------------LRYFQVTIEGPEQSPYE 48

Query: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
           +  F+L++  P  YP+E P + F    + H N++ + G ICLD+L K +W+PA  + T +
Sbjct: 49  DGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVL 105

Query: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
            +I  LL  P P+ PL  D+A     N+Q A
Sbjct: 106 LSIQALLASPNPNDPLANDVAEDWIKNEQGA 136

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++Q  I+GPQ +PY N  FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A 
Sbjct: 89  DVL-KNNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 4/115 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P    +LT W   I GP  +PYA   F++ +  P  YP EPP + F    M H NV+  +
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFVS-PMWHPNVDL-S 93

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153
           G ICLD+L K+ W+  +N+ T + ++  LL +P   SPLN  IA  L   D+  Y
Sbjct: 94  GNICLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAELWDGDKEEY 146

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 73.2 bits (178), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 73/148 (49%), Gaps = 28/148 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTH----WQAQIKGPQGT 58
           RL++++K+I++   P                      IS S L      W A I GP  T
Sbjct: 8   RLMRDFKRIKSDSPPG---------------------ISASPLPDNVMLWNAMIIGPSDT 46

Query: 59  PYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           PY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+ + WTP +++ 
Sbjct: 47  PYEDGTFRLVLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQNR-WTPTYDVS 103

Query: 119 TTMKAIWILLKDPVPDSPLNVDIANILR 146
           + + +I  L  DP P SP NV+ A + +
Sbjct: 104 SILTSIQSLFNDPNPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 72.8 bits (177), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L +++  I+GP+ +PY    FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 27  NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 84

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
           DIL K +W+PA  + T + ++  LL  P P+ PL  D+A     N++ A N
Sbjct: 85  DIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGAKN 134

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 3/110 (2%)

Query: 43  SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAIC 102
            +L ++Q  I+GPQ +PY N  F+L++  P  YP+E P + F    + H N++ + G IC
Sbjct: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 87

Query: 103 LDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           LD+L K +W+PA  + T + ++  LL  P P+ PL  D+A     N+  A
Sbjct: 88  LDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEDGA 136

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 72.8 bits (177), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 72.8 bits (177), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 72.8 bits (177), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 72.4 bits (176), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 72.0 bits (175), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 78

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFIS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++Q  I+GPQ +PY +  FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A     N+ +A
Sbjct: 89  DVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIRNEDAA 136

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 72.0 bits (175), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   ++GP G+PY N  FQL++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A     N+  A
Sbjct: 89  DVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIQNEAGA 136

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 72.0 bits (175), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 89

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 90  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 78

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 79  NR-WTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++Q  I+GP+ +PY +  F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFL-TRIYHPNID-RLGRICL 78

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N++ A
Sbjct: 79  DVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 72.0 bits (175), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 78/160 (48%), Gaps = 19/160 (11%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           + RL  E  ++  + +P  +   NN+DD                L  W   I GP+GTPY
Sbjct: 14  VKRLQSELVQLMMSPTPGLSAFPNNEDD----------------LRDWSGMIVGPEGTPY 57

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120
            + +F++ +  P +YP  PP + F    M H NV+  +G ICLDIL+ Q W+  +N+ T 
Sbjct: 58  ESLKFKISLHFPDSYPYVPPKVKFIS-PMWHPNVDM-SGNICLDILKDQ-WSAVYNVQTI 114

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYY 160
           + ++  L ++P   SPLN   A +   +       LL+ Y
Sbjct: 115 LLSLQSLFEEPNNSSPLNAVAAELWDKDMVEYKKRLLSRY 154

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YPI  P + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++Q  I+GPQ +PY N  F L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFL-TKIYHPNID-KLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
           D+L K +W+PA  + T + ++  LL  P P+ PL  D+A
Sbjct: 89  DVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 65/110 (59%), Gaps = 3/110 (2%)

Query: 43  SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAIC 102
            +L ++Q  I+GP+ +PY +  F+L++  P  YP+E P + F    + H N++ + G IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 103 LDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           LD+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N++ A
Sbjct: 78  LDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 71.2 bits (173), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 79/153 (51%), Gaps = 20/153 (13%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61
            R++KE +++ +   P  T   ++D+                 L +++  I+GPQ +PY 
Sbjct: 6   KRIIKETERLVSDPVPGITAEPHDDN-----------------LRYFEVTIEGPQQSPYE 48

Query: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
           N  F L++  P  YP+E P + F    + H N++ + G ICLD+L K +W+PA  + T +
Sbjct: 49  NGVFDLELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVL 105

Query: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSAYN 154
            +I  LL  P P+ PL  D+A     ++ SA +
Sbjct: 106 LSIQALLASPNPNDPLANDVAEDWIKDESSAID 138

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   I+GP+ +PY N  F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFL-TRIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N++ A
Sbjct: 89  DVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEEWIKNEELA 136

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 70.1 bits (170), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   I+GPQ + Y N  F+L++  P  YP+EPP + F    + H N++ + G ICL
Sbjct: 31  NLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A
Sbjct: 89  DVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 57/99 (57%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  TPY +  F+L +E    YP +PP + F    + H NV +  G ICLDIL+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EIFHPNV-YANGEICLDILQ 78

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 79  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   I+GPQ +PY +  F+L++  P  YP+EPP + F    + H N++ + G ICL
Sbjct: 31  NLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A 
Sbjct: 89  DVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 43  SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAIC 102
            +L ++Q  I+GP+ +PY +  F+L++  P  YP+E P + F    + H N++ + G IC
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRIC 77

Query: 103 LDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143
           LD+L K +W+PA  + T + +I  LL  P P+ PL  D+A 
Sbjct: 78  LDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 69.7 bits (169), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 77/151 (50%), Gaps = 20/151 (13%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYA 61
            R++KE +++ +   P  T   ++D+                 L ++   I+GP+G+PY 
Sbjct: 6   KRIIKETERLVSDPVPGITAEPHDDN-----------------LRYFSVTIEGPEGSPYE 48

Query: 62  NHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
           +  F L++  P  YP+E P + F    + H N++ + G ICLD+L K +W+PA  + T +
Sbjct: 49  HGIFDLELFLPDDYPMESPKVRFL-TKIYHPNID-RLGRICLDVL-KTNWSPALQIRTVL 105

Query: 122 KAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
            +I  LL  P P+ PL  D+A     N+  A
Sbjct: 106 LSIQALLASPNPNDPLANDVAEDWIKNETGA 136

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 70.1 bits (170), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 56/99 (56%), Gaps = 3/99 (3%)

Query: 48  WQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILE 107
           W A I GP  T Y +  F+L +E    YP +PP + F    M H NV +  G ICLDIL+
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQ 93

Query: 108 KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
            + WTP +++ + + +I  L  DP P SP NV+ A + +
Sbjct: 94  NR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   ++GP  +PY N  F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N+++A
Sbjct: 89  DVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEAA 136

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 3/109 (2%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   I+GP+ + Y N  F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSA 152
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A     N++ A
Sbjct: 89  DVL-KNNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEKGA 136

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 65.1 bits (157), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 54  GPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTP 113
           GP  +PYA   F L I  P  YP +PP I F    + H N+N   G ICLDIL+ Q W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNIN-ANGNICLDILKDQ-WSP 58

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           A  L   + +I  LL D  PD PL  +IA+I + +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTD 93

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L ++   I+GP  +PY    F+L++  P  YP+E P + F    + H N++ + G ICL
Sbjct: 31  NLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFL-TKIYHPNID-RLGRICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIAN 143
           D+L K +W+PA  + T + +I  LL  P P+ PL  D+A 
Sbjct: 89  DVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 53/97 (54%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            T DL HW+A I G  GT +A+  + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 3/122 (2%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P +  DLT W   I GP GTPY    F++ ++ P +YP   P + F    M H NV+  +
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFVS-PMWHPNVDM-S 95

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLN 158
           G ICLDIL K  W+  +N+ T + ++  LL++P   SPLN   A +   N +     L+ 
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKNMEEYKRKLMA 154

Query: 159 YY 160
            Y
Sbjct: 155 RY 156

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 65.9 bits (159), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 55/106 (51%), Gaps = 7/106 (6%)

Query: 36  YLHPISTSD----LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPH 91
           Y  P+  SD    L  W+A I G +GT +A   + + +E P  YP +PP + F P    H
Sbjct: 25  YAKPVKKSDGSMDLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 92  CNVNFQTGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            NV + +G ICL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  DLT W   I GP GTPY    F++ +E   TYP   P + F    M H NV+  +
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-S 95

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLN 158
           G ICLDIL K  W+  +N+ T + ++  LL++P   SPLN   A +   + Q     L  
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDTDMQEYKKKLYA 154

Query: 159 YY 160
            Y
Sbjct: 155 RY 156

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 38  HPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ 97
            P  T DL  W+A I G QGT +A+  + L IE P  YP +PP +   P +  H NV + 
Sbjct: 31  KPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKL-PANFYHPNV-YP 88

Query: 98  TGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +G ICL IL E Q W PA  L      I  LL  P P+SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 65.5 bits (158), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 30  MQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGFVN-KIYHPNIDIASGSICLD 88

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 89  VI-NSTWSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 55/106 (51%), Gaps = 7/106 (6%)

Query: 36  YLHPISTSD----LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPH 91
           Y  P+  +D    L  W+A I G +GT +A   + + +E P  YP +PP + F P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 92  CNVNFQTGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            NV + +G ICL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 65.1 bits (157), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 30  MQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 88

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + AN L++ D+  Y   +  Y+
Sbjct: 89  VI-NSTWSPLYDLLNIVE--WMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREYI 144

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 55/106 (51%), Gaps = 7/106 (6%)

Query: 36  YLHPISTSD----LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPH 91
           Y  P+  +D    L  W+A I G +GT +A   + + +E P  YP +PP + F P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 92  CNVNFQTGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            NV + +G ICL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 28  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 86

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 87  VI-NSTWSPLYDLINILE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 142

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 62/122 (50%), Gaps = 3/122 (2%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P    DLT W   I GP GTPY    F++ +E   TYP   P + F    M H NV+  +
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-S 95

Query: 99  GAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLN 158
           G ICLDIL K  W+  +N+ T + ++  LL++P   SPLN   A +   + +     L+ 
Sbjct: 96  GNICLDIL-KDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIA 154

Query: 159 YY 160
            Y
Sbjct: 155 RY 156

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 62.4 bits (150), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           DL  W+A I G  GT +A   + + IE P  YP +PP + F P    H NV + +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMF-PKGFYHPNV-YPSGTICL 59

Query: 104 DIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            IL E+Q W PA  L   +  +  LL  P P+SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 87

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 88  VI-NSTWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 63.9 bits (154), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 87

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 88  VI-NSTWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 63.5 bits (153), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 66/120 (55%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 87

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 88  VINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 62.8 bits (151), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 40  ISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTG 99
           +   ++  +  +  GP+ TPY +  ++L +E P  YP + P I F    + H N++  +G
Sbjct: 24  LVNDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDVASG 82

Query: 100 AICLDILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGL 156
           +ICLD++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   
Sbjct: 83  SICLDVINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKVLYEQK 138

Query: 157 LNYYLSASPSPS 168
           +  Y+    +P 
Sbjct: 139 IKEYIDKYATPE 150

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  + +GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 17  MQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVN-KILHPNIDVASGSICLD 75

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L   ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+
Sbjct: 76  VINST-WSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 131

Query: 162 SASPS 166
               S
Sbjct: 132 DKYAS 136

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 63.5 bits (153), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 8/112 (7%)

Query: 54  GPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTP 113
           GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD++    W+P
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLDVI-NSTWSP 113

Query: 114 AWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162
            ++L+  ++  W+   LLK+P    PLN + A  L + D+  Y   +  Y++
Sbjct: 114 LYDLLNIVE--WMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYIA 162

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 51/97 (52%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            + +L  W+A I G  GT + N  + L IE P  YP +PP + F P    H NV + +G 
Sbjct: 34  GSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           ICL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 92  ICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 53/100 (53%), Gaps = 3/100 (3%)

Query: 38  HPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ 97
           HP  + +L  W+A I G +GT +A   + + IE P  YP +PP +   P +  H NV + 
Sbjct: 31  HPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKL-PANFYHPNV-YP 88

Query: 98  TGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +G ICL IL E Q W PA  L      I  LL  P P+SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 53/99 (53%), Gaps = 3/99 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P  T +L  W+A I G +GT + +  F + +E P  YP +PP + F P    H N+ + +
Sbjct: 32  PDGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYHPNI-YPS 89

Query: 99  GAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           G +CL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 68/120 (56%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY N  ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 30  MQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 88

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L+++D++ Y   +  Y+
Sbjct: 89  VI-NSTWSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYI 144

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 62.8 bits (151), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 67/121 (55%), Gaps = 8/121 (6%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           ++  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICL
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYY 160
           D++    W+P ++L+  ++  W+   LLK+P    PLN + A  L+++D+  Y   +  Y
Sbjct: 89  DVINST-WSPLYDLLNIIE--WMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEY 144

Query: 161 L 161
           +
Sbjct: 145 I 145

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 38  HPISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ 97
            P  + +L  W+A I G +GT + +  F + IE P  YP +PP + F P    H N+ + 
Sbjct: 31  KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YP 88

Query: 98  TGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +G +CL IL E Q W PA  L      +  LL  P P+SP
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 36  YLHPISTSD----LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPH 91
           Y  P+  +D    L  W+A I G   T +A   + + +E P  YP +PP + F P    H
Sbjct: 25  YAKPVKKADGSMDLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKF-PAGFYH 83

Query: 92  CNVNFQTGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            NV + +G ICL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 84  PNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 51/97 (52%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            + +L  W+A I G +GT +    + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GSMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  L   +  +  LL  P PDSP
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S +DL  W   I+GP  TPY    F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YHN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  NVD   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 7/103 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GPQGTPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 29  MQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICLD 87

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANI 144
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A +
Sbjct: 88  VINST-WSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 8/118 (6%)

Query: 54  GPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTP 113
           GP  TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD++    W+P
Sbjct: 38  GPDETPYEKGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLDVI-NSTWSP 95

Query: 114 AWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPS 168
            ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y+    +P 
Sbjct: 96  LYDLINIVE--WMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYIDKYATPE 150

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 61.6 bits (148), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 64/122 (52%), Gaps = 8/122 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 52  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICLD 110

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L + D+  Y   +  Y+
Sbjct: 111 VINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

Query: 162 SA 163
             
Sbjct: 167 DK 168

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 67/121 (55%), Gaps = 8/121 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 30  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICLD 88

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ D+  Y   ++ Y+
Sbjct: 89  VINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLKDKDMYEQKIHEYI 144

Query: 162 S 162
           +
Sbjct: 145 N 145

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            + +L  W+A I G +GT + +  + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GSMNLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  +   +  +  LL  P PDSP
Sbjct: 92  VCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 7/103 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+GTPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 29  MQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICLD 87

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANI 144
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A +
Sbjct: 88  VINST-WSPLYDLLNIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  +L  W   I+GP  TPYA   F  Q+E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDIL------------EKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ IL             ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 51/97 (52%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            T +L  W+A I G +GT +A   + + IE P  YP +PP +   P    H NV + +G 
Sbjct: 34  GTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKL-PAGFYHPNV-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           ICL IL E+Q W PA  L      I  LL  P P+SP
Sbjct: 92  ICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 59.3 bits (142), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 49/94 (52%), Gaps = 3/94 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L  W+A I G +GT +    F + IE P  YP +PP + F P    H N+ + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCL 59

Query: 104 DIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            IL E Q W PA  L      +  LL  P P+SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 59.7 bits (143), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 15/128 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P + SDL  W   + GP  TPYA   F  Q++ P  YP+ PP + F P S+ H NV +  
Sbjct: 28  PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFTP-SILHPNV-YPN 85

Query: 99  GAICLDILE------------KQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ IL             ++ W+P  ++   + ++  +L +P  +S  N+D A IL 
Sbjct: 86  GEVCISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANID-ACILW 144

Query: 147 VNDQSAYN 154
            + +  +N
Sbjct: 145 RDHRDDFN 152

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 8/121 (6%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           ++  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDIASGSICL 88

Query: 104 DILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYY 160
           D++    W+P ++L   ++  W+   LLK+P    PLN + A  L++ D+  Y   +  Y
Sbjct: 89  DVI-NSTWSPLYDLKNIVE--WMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEY 144

Query: 161 L 161
           +
Sbjct: 145 I 145

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 60.5 bits (145), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 59/104 (56%), Gaps = 7/104 (6%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           ++  +  +  GP+GTPY    ++L +E P  YP + P I F    + H N++  +G+ICL
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICL 86

Query: 104 DILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANI 144
           D++    W+P ++L+  ++  W+   LLK+P    PLN + A +
Sbjct: 87  DVI-NSTWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAATL 127

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 59.3 bits (142), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 53/106 (50%), Gaps = 7/106 (6%)

Query: 36  YLHPISTSD----LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPH 91
           Y  P   +D    L  W+A I G +GT + +  + + IE P  YP +PP + F P    H
Sbjct: 25  YAKPCKKADGSMNLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYH 83

Query: 92  CNVNFQTGAICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            N+ + +G +CL IL E Q W PA  L      +  LL  P P+SP
Sbjct: 84  PNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 128

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 58.9 bits (141), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 64/131 (48%), Gaps = 25/131 (19%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +  +D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLSDSDDIT-------------MTKWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + + IEC P+YP EPP + F   +++P C VN  TG +   + EK H    W   
Sbjct: 53  HENRIYSVLIECGPSYPDEPPKVKFVSKINLP-C-VNSTTGEV---VKEKFHTLKEWKRS 107

Query: 119 TTMKAIWILLK 129
            TM+ + + L+
Sbjct: 108 YTMETVLLELR 118

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            T +L  W+A I G +GT + +  + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GTMNLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 70/158 (44%), Gaps = 30/158 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLLKEY+++     P                     P S S+L  W   I+GP  TPY  
Sbjct: 8   RLLKEYQQLIRDPPPG----------------ILAAPKSESNLFLWDCLIQGPPDTPYEG 51

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDI------------LEKQH 110
             F  +++ P  YP+ PP + F P S+ H N+ +  G +C+ I            L ++ 
Sbjct: 52  GIFNARLDFPKDYPLSPPKLTFTP-SILHPNI-YHNGEVCISILHSPGDDPNMYELAEER 109

Query: 111 WTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           W+P  ++   + ++  +L +P  +S  NVD   + R N
Sbjct: 110 WSPVQSVEKILLSVMSMLSEPNIESGANVDACILWRDN 147

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            + +L  W+A I G +GT + +  + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GSMNLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  +   +  +  LL  P P+SP
Sbjct: 92  VCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 8/120 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICLD 75

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYL 161
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A  L++ ++  Y   +  Y+
Sbjct: 76  VI-NSTWSPLYDLINIVE--WMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKIQEYI 131

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLD 104
           +  +  +  GP+ TPY    ++L +E P  YP + P I F    + H N++  +G+ICLD
Sbjct: 17  MQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVN-KIFHPNIDAASGSICLD 75

Query: 105 ILEKQHWTPAWNLMTTMKAIWI---LLKDPVPDSPLNVDIANI 144
           ++    W+P ++L+  ++  W+   LLK+P    PLN + A +
Sbjct: 76  VI-NSAWSPLYDLLNILE--WMIPGLLKEPNGSDPLNNEAATL 115

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S +++  W   I+GP  TPYA+  F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S +++  W   I+GP  TPYA+  F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S +++  W   I+GP  TPYA+  F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P+S  +L  W   I+GP  +PY    F  +++ P  YP+ PP + F P S+ H NV +  
Sbjct: 28  PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDYPLSPPKLTFTP-SILHPNV-YPN 85

Query: 99  GAICLDIL------------EKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ IL              + W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S +++  W   I+GP  TPYA+  F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 30/158 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLLKEY+++     P      +++++ F                 W   I GP  TPY N
Sbjct: 10  RLLKEYQQLIRESPPGIVAGPSDENNMF----------------EWDCLISGPPETPYEN 53

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDI------------LEKQH 110
             F   +  P  YP+ PP + F P S+ H N+ +  G +C+ I            L ++ 
Sbjct: 54  GVFNATLLFPKDYPLSPPKLTFTP-SLLHPNI-YPNGEVCISILHSPGDDPNMYELAEER 111

Query: 111 WTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           W+P  ++   + ++  +L +P  +S  N+D + + R N
Sbjct: 112 WSPVQSVEKILLSVMSMLSEPNIESGANIDASILYRDN 149

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 30/158 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLLKE +K+ T  SP                     PI  S+L  W   I GP  + Y  
Sbjct: 8   RLLKELEKL-TKDSPEGI---------------LASPIDDSNLFQWDCLIMGPPDSCYEG 51

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL------------EKQH 110
             F  +++ P  YP+ PP + FQP S+ H N+ +  G +C+ IL            E + 
Sbjct: 52  GVFNARLDFPKDYPLNPPKLTFQP-SILHPNI-YPNGEVCISILHSPGSDPNMYEHECER 109

Query: 111 WTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           W+P  ++   + ++  +L +P  +S  N+D   + R N
Sbjct: 110 WSPVQSVEMILLSVMSILSEPNIESGANIDACILWRDN 147

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P   SDL  W   ++GP  +PY    F+ Q+  P  YP+ PP + F P S+ H NV +  
Sbjct: 28  PQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVP-SVLHPNV-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 57.4 bits (137), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 30/158 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RL KEY+++     P       N++D F                 W   I+GP  TPY +
Sbjct: 8   RLFKEYQQLIRDSPPGIVAGPANENDLF----------------LWDCLIQGPPDTPYEH 51

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDI------------LEKQH 110
             F  Q+  P  YP+ PP + F P ++ H N+ +  G +C+ I            L ++ 
Sbjct: 52  GVFNAQLRFPRDYPLSPPTLTFTP-AILHPNI-YPNGEVCISILHSPGDDPNMYELAEER 109

Query: 111 WTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           W+P  ++   + ++  +L +P  +S  N+D   + R N
Sbjct: 110 WSPVQSVEKILLSVMSMLSEPNVESGANIDACILWRDN 147

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           +L  W+A I G +GT +    + L IE P  YP +PP +   P    H NV + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKL-PAGFYHPNV-YPSGTICL 94

Query: 104 DIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
            IL E Q W PA  L      I  LL  P P+SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 57/119 (47%), Gaps = 14/119 (11%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  + P S  +   D D+ +             +T+W   I GP  + ++N
Sbjct: 9   RLLEELEKGEKGMGPESCSYGLADSDDIS-------------MTNWNGTILGPPHSNHSN 55

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTM 121
             + L IEC P+YP EPP + F      +C V+  TG +  D    ++W  ++ + T +
Sbjct: 56  RIYSLSIECGPSYPDEPPTLKFISKINLNC-VDSATGVVKPDFNPIKNWKRSYTMETIL 113

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 30/160 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLLKE +++     P        +D+ F                 W   ++GP  +PY  
Sbjct: 8   RLLKELQQLMKDSPPGIVAGPKTEDNIF----------------QWDCLVQGPPDSPYEG 51

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDI------------LEKQH 110
             F  Q++ P  YP+ PP + F P S+ H N+ +  G +C+ I            L ++ 
Sbjct: 52  GVFNAQLDFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEER 109

Query: 111 WTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQ 150
           W+P  ++   + ++  +L +P  +S  N+D   + R N +
Sbjct: 110 WSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRK 149

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTP 113
           P    Y +  F   +    +YPIEPP++ F + +  P+ ++N   G ICL+IL ++ W+P
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKKIYHPNIDLN---GKICLNIL-REDWSP 130

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQS 151
             +L + +  +  L  +P P  PLN+    +L+ N Q 
Sbjct: 131 VLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQE 168

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  +L  W   I GP  +PY    F   +E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPKDYPLSPPRLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGEDPNMYELAEERWSPVQSVEKILLSVTSMLSEPNVESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 54.3 bits (129), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  +L  W   I GP  +PY    F   +E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (55%), Gaps = 5/90 (5%)

Query: 60  YANHEFQLQIECPPTYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           Y    F+  +    +YPI+PP ++  Q +  P+ ++N   G ICL+IL ++ W+PA ++ 
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCLQKIYHPNIDLN---GKICLNIL-REDWSPALDIQ 113

Query: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + +  +  L  +P P  PLN D A+ L  N
Sbjct: 114 SVIVGLLFLFLEPNPRDPLNKDAASTLIRN 143

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 41  STSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA 100
            + +L  W+A I G + T +    + + IE P  YP +PP + F P    H N+ + +G 
Sbjct: 34  GSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGT 91

Query: 101 ICLDIL-EKQHWTPAWNLMTTMKAIWILLKDPVPDSP 136
           +CL IL E Q W PA  L   +  +  LL  P P+SP
Sbjct: 92  VCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 53.5 bits (127), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 14/120 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P S  +L  W   I GP  +PY    F   +E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPKDYPLSPPKLLFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 52.8 bits (125), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 56/123 (45%), Gaps = 22/123 (17%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +    P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDIT-------------MTKWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + L IEC P YP  PP + F   +++P C VN  TG I  D    + W  A+ + 
Sbjct: 53  HENRIYSLSIECGPNYPDSPPKVTFISKINLP-C-VNQTTGEIQTDFHTLRDWKRAYTME 110

Query: 119 TTM 121
           T +
Sbjct: 111 TLL 113

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 52  IKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHW 111
           I  P    Y N  F+  +E    YP+EPP +  +   + H N++ Q G +CL+IL ++ W
Sbjct: 74  IISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRN-RIYHPNIDVQ-GKVCLNIL-REDW 130

Query: 112 TPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153
           +PA +L + +  +  L  +P    PLN D A +    D +A+
Sbjct: 131 SPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFS-KDSNAF 171

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 14/122 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P++  ++  W   I GP  +PY    F  +++ P  YP+ PP + F P S+ H NV +  
Sbjct: 28  PVNEENMFLWDCLIAGPPDSPYEGGIFNARLQFPTDYPLSPPKLTFTP-SILHPNV-YPN 85

Query: 99  GAICLDIL------------EKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ IL              + W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLSVMSMLSEPNVESGANIDACILWR 145

Query: 147 VN 148
            N
Sbjct: 146 DN 147

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 57/130 (43%), Gaps = 23/130 (17%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   D D+               +T+W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDIT-------------MTNWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119
           HE   + + IEC P YP EPP I F       C V+  TG +   +    H    W    
Sbjct: 53  HENRIYSVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVF---HTLRDWKRAY 108

Query: 120 TMKAIWILLK 129
           TM+ + + L+
Sbjct: 109 TMETLLLDLR 118

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPA 114
           P    Y +      ++    YPIEPP +      + H N++F+ G +CL+IL ++ W+PA
Sbjct: 69  PDEGYYTHGSINFSLDFNEVYPIEPPKVACLK-RIFHPNIDFK-GNVCLNIL-REDWSPA 125

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANIL 145
            +L + +  +  L  +P P+ PLN D A +L
Sbjct: 126 LDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P + ++L  W   ++GP  T Y    F  ++E P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VNDQ 150
            N +
Sbjct: 146 DNRE 149

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 56/111 (50%), Gaps = 6/111 (5%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTP 113
           P+  PY    F+  ++    YPIEPP  I    +  P+ ++N   G ICL+IL ++ W+P
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPSAICLNKIFHPNIDLN---GKICLNIL-REDWSP 132

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
           A +L + +  +  L  D     PLN   A +L  ND++ +  L+   +  S
Sbjct: 133 ALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELVQRAMLGS 182

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 23/124 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   D D+ +             +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDIS-------------MTTWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEK-QHWTPAWNL 117
           HE   + L IEC P YP  PP I F   +++P C V+ +TG +        + W  A+N+
Sbjct: 53  HENRIYSLSIECGPNYPDHPPTIKFISKINLP-C-VDSKTGQVTPSTFHTLRDWKRAYNM 110

Query: 118 MTTM 121
            T +
Sbjct: 111 ETIL 114

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 bp,
           139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 62/131 (47%), Gaps = 25/131 (19%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  + P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGMGPESCSYGLADGDDIT-------------MTRWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + L IEC P YP  PP++ F   +++P C V+ +TG +   +  + H    W   
Sbjct: 53  HENRIYSLSIECGPNYPDAPPVLFFISKINLP-C-VSPKTGQV---MPSEFHLLRDWKRS 107

Query: 119 TTMKAIWILLK 129
            TM+ I + L+
Sbjct: 108 CTMEKILLELR 118

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 60/131 (45%), Gaps = 25/131 (19%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +    P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDIT-------------MTKWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + L+I C   YP EPP++ F   +++P C V+  TG +     EK H    W   
Sbjct: 53  HENRIYSLEIVCGDRYPDEPPLVKFISKVNLP-C-VDQTTGVVS---AEKFHTLRDWKRS 107

Query: 119 TTMKAIWILLK 129
            TM+ + + L+
Sbjct: 108 YTMQTVLLDLR 118

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 14/124 (11%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQT 98
           P + ++L  W   ++GP  T Y    F  +++ P  YP+ PP + F P S+ H N+ +  
Sbjct: 28  PANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI-YPN 85

Query: 99  GAICLDI------------LEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILR 146
           G +C+ I            L ++ W+P  ++   + ++  +L +P  +S  N+D   + R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWR 145

Query: 147 VNDQ 150
            N +
Sbjct: 146 DNRK 149

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 65/140 (46%), Gaps = 26/140 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADADDIT-------------MTRWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + + IEC P YP EPP I F   +++P C V+  TG +     EK +    W  +
Sbjct: 53  HENRIYSVSIECGPKYPDEPPTITFISKINLP-C-VDQSTGEVN---KEKFNTLKDWKRL 107

Query: 119 TTMKAIWILLKDPVPDSPLN 138
             M+ I + L+  +  SP N
Sbjct: 108 YNMETILLDLRKEMA-SPAN 126

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 56/123 (45%), Gaps = 22/123 (17%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +    P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDIT-------------MTKWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + L I+C P YP  PP + F   +++P C VN  TG +  D    + W  A+ + 
Sbjct: 53  HENRIYSLSIDCGPNYPDSPPKVTFISKINLP-C-VNPTTGEVQTDFHTLRDWKRAYTME 110

Query: 119 TTM 121
           T +
Sbjct: 111 TLL 113

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 25/131 (19%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   D D+               +T+W   I GP   P++N
Sbjct: 11  RLLEELEKGEKGLGPESCSYGLADGDDIT-------------MTNWNGTILGP---PHSN 54

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + + IEC   YP EPP+I F   +++P C V+  TG +  D     H    W   
Sbjct: 55  HENRIYSVAIECGANYPDEPPLIKFVSKINLP-C-VDQTTGEVKHDQF---HTLRDWKRS 109

Query: 119 TTMKAIWILLK 129
            TM+ + + L+
Sbjct: 110 YTMETLLLDLR 120

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 64/132 (48%), Gaps = 27/132 (20%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +    P S  +   D D+               +T+W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDIT-------------MTNWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQ-HWTPAWNL 117
           HE   + L+I C P YP EPP + F   +++P C ++ +TG    +I EK+ H    W  
Sbjct: 53  HENRIYSLEIVCGPNYPDEPPKVKFVSKVNLP-C-IDDKTG----EIKEKEFHTLRDWKR 106

Query: 118 MTTMKAIWILLK 129
             TM+ + + L+
Sbjct: 107 SYTMQTVLLELR 118

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 65  FQLQIECPPTYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKA 123
           F+ Q      YPIEPP ++    +  P+ N   +TG ICL+IL ++ W+PA +L + +  
Sbjct: 91  FRFQFTINENYPIEPPKVVCLTKIYHPNIN---RTGEICLNIL-REDWSPALDLQSVIIG 146

Query: 124 IWILLKDPVPDSPLNVDIANIL 145
           +  L  +P P  PLN   A+ L
Sbjct: 147 LLFLFIEPNPKDPLNKQAADTL 168

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPA 114
           P    Y + +F+  ++    YPIEPPI+      + H N++   G ICL+IL ++ W+PA
Sbjct: 77  PDEGYYKSGKFKFDLKFNENYPIEPPIVLCMN-KIFHPNIDLD-GKICLNIL-REDWSPA 133

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANIL 145
            +L + +  +  L  +     PLN + ANIL
Sbjct: 134 LDLNSIIIGLLYLFLECNAKDPLNKEAANIL 164

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPA 114
           P    Y + +F+  ++    YPIEPPI+      + H N++   G ICL+IL ++ W+PA
Sbjct: 76  PDEGYYKSGKFKFDLKFNENYPIEPPIVLCMN-KIFHPNIDLD-GKICLNIL-REDWSPA 132

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANIL 145
            +L + +  +  L  +     PLN + ANIL
Sbjct: 133 LDLNSIIIGLLYLFLECNAKDPLNKEAANIL 163

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIH-----FQPLSMPHCNVNFQTGAICLDILEKQHWTPA 114
           Y   +F+       TYPI+PP +      F P   PH       G ICL+IL ++ W+PA
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLNIL-REDWSPA 127

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSPST 169
            +L   +  +  L ++P  + PLN + A +L   D+  +  L+   +S +   ST
Sbjct: 128 LDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLN-KDKLEFGNLVRLAMSGAMVGST 181

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 39  PISTSDLTHWQAQIKGPQGTPYANH-EFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ 97
           P ST  +   + ++       Y NH      ++    YPIEPP +      + H N++ +
Sbjct: 52  PDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLK-KIFHPNIDLK 110

Query: 98  TGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQ 150
            G +CL+IL ++ W+PA +L + +  +  L  +P P+ PLN D A +   N++
Sbjct: 111 -GNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLFCQNEK 161

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 69/159 (43%), Gaps = 28/159 (17%)

Query: 2   SRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKG-PQGTPY 60
           S LL++Y+++        + H   DDD              S++  W   +    + + Y
Sbjct: 10  SLLLRQYRELTDAKKAIPSFHIELDDD--------------SNIFLWNVGVMVLNEDSIY 55

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQ 109
               F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + +
Sbjct: 56  HGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSE 113

Query: 110 HWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
            W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 114 TWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 5/73 (6%)

Query: 74  TYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPV 132
            YPIEPP ++  + +  P+ ++    G +CL+IL ++ W+PA +L + +  +  L  +P 
Sbjct: 89  VYPIEPPKVVCLKKIFHPNIDL---KGNVCLNIL-REDWSPALDLQSIITGLLFLFLEPN 144

Query: 133 PDSPLNVDIANIL 145
           P+ PLN D A +L
Sbjct: 145 PNDPLNKDAAKLL 157

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDS 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFRKN 152

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 48.9 bits (115), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 53/105 (50%), Gaps = 4/105 (3%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119
           YA   +   +    TYP+EPP++      + H N++   G +CL++L ++ WTPA ++ +
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMH-RIYHPNIDID-GNVCLNLL-REDWTPALDIQS 128

Query: 120 TMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
            +  I  L  +P    PLN D A  L + D   +   +N+ L  +
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAAKTL-IEDPLRFENKVNHSLRGN 172

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 13/102 (12%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQ 150
           + W+P   + + + +I  LL+DP   SP NVD A   R N +
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNQE 154

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q++ P  +P  PP   F P ++ H NV ++ G +C+ IL           ++
Sbjct: 54  YHGGYFKAQMKFPDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDE 111

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIA 142
           + W+P   + + + +I  LL+DP   SP NVD A
Sbjct: 112 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 145

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 7/96 (7%)

Query: 60  YANH-EFQLQIECPPTYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNL 117
           Y NH      ++    YPIEPP +   + +  P+ ++N   G +CL+IL ++ W+PA +L
Sbjct: 73  YYNHGSISFSLDFNEVYPIEPPKVTCLKKIFHPNIDLN---GNVCLNIL-REDWSPALDL 128

Query: 118 MTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAY 153
            + +  +  L  +P P+ PLN D A +    DQ  +
Sbjct: 129 QSIIIGLLFLFLEPNPNDPLNKDAAKLF-CQDQKKF 163

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P  ++ + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 49.3 bits (116), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 13/95 (13%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTP 113
           F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
              + + + +I  LL+DP   SP NVD A   R N
Sbjct: 118 VQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 13/95 (13%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTP 113
           F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
              + + + +I  LL+DP  +SP NVD A   R N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119
           Y +  F   +    +YPI+PPI+     ++ H N+++  G ICL++L ++ WTP  +L T
Sbjct: 155 YKHGHFGFSVSFKDSYPIDPPIVKCL-TTIYHPNIDYN-GNICLNVL-REDWTPVLDLQT 211

Query: 120 TMKAIWILLKDPVPDSPLNVDIANIL 145
            +  +  L  +P P  PLN   A+ +
Sbjct: 212 IVIGLLFLFLEPNPKDPLNKHAAHTM 237

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMRFPEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q++ P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKAQMKFPEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDS 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 13/95 (13%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTP 113
           F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
              + + + +I  LL+DP  +SP NVD A   R N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 13/95 (13%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTP 113
           F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
              + + + +I  LL+DP  +SP NVD A   R N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 13/95 (13%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTP 113
           F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + + W+P
Sbjct: 60  FKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSP 117

Query: 114 AWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
              + + + +I  LL+DP  +SP NVD A   R N
Sbjct: 118 VQTVESVLISIVSLLEDPNINSPANVDAAVDYRKN 152

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 56/105 (53%), Gaps = 6/105 (5%)

Query: 60  YANHEFQLQIECPPTYPIEPP-IIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           Y    F  ++E    YPIEPP +I    L  P+ +++   G +CL+IL ++ W+PA ++ 
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICTSKLYHPNIDID---GKVCLNIL-REDWSPALDVQ 133

Query: 119 TTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSA 163
           + +  +  LL +P    PLN D A +L   D + +  L+N  ++ 
Sbjct: 134 SIIIGLLFLLLEPNAKDPLNKDAAMMLST-DTARFASLVNRSMAG 177

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    F+ Q+  P  +P  PP   F P ++ H NV ++ G +C+ IL           + 
Sbjct: 55  YHGGYFKSQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDA 112

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P   + + + +I  LL+DP   SP NVD A   R N
Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKN 152

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 13/100 (13%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EK 108
           Y    FQ Q++ P  +P  PP   F P  + H NV ++ G +C+ IL           + 
Sbjct: 62  YHGGYFQSQMKFPKDFPFSPPQFKFIP-PIYHPNV-YRDGKLCISILHQSGDAMTSEPDN 119

Query: 109 QHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           + W+P  ++ + + +I  LL+DP   SP NVD A   R N
Sbjct: 120 ETWSPVQSVESVLISIVSLLEDPNVSSPANVDAAVEYRKN 159

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 3/97 (3%)

Query: 52  IKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHW 111
           I  P    Y    F  ++     YPIEPP +      + H N++ Q G ICL+IL ++ W
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVRCMN-QIFHPNIDLQ-GKICLNIL-REDW 123

Query: 112 TPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVN 148
           +PA +L + +  I  L  +     PLN   A++L  N
Sbjct: 124 SPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDEN 160

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 3  RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
          RLL+E +K +  + P S  +   D D+ +             +THW   I GP  + + N
Sbjct: 9  RLLEELEKGEKGMGPESCSYGLADGDDIS-------------MTHWNGTILGPPHSSHEN 55

Query: 63 HEFQLQIECPPTYPIEPPIIHF 84
            + + IEC   YP  PP + F
Sbjct: 56 RIYSVVIECGAEYPDRPPKVRF 77

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
           (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 45.1 bits (105), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 45  LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICL 103
           +T+W   I GP  + +AN  + L IEC P YP EPP I F   +++P  +VN  TG +  
Sbjct: 1   MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFISRVNLPCVDVN--TGEVKP 58

Query: 104 DILEKQHWTPAWNLMTTMKAIWILLK 129
                 H    W    TM+ I + L+
Sbjct: 59  TEF---HTLRDWKRSYTMETILLELR 81

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 65/146 (44%), Gaps = 32/146 (21%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   D D+               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDIT-------------MTKWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQ---HWTPAW 115
           HE   + + I C P YP  PP I F   +++P C V+ +TG +      KQ   H    W
Sbjct: 53  HENRIYSVAIHCGPHYPDAPPTIKFVSKINLP-C-VDEKTGEV------KQASFHTLRDW 104

Query: 116 NLMTTMKAIWILLKDPVPDSPLNVDI 141
               TM+ + + L+  +  SP N  +
Sbjct: 105 KRSYTMETLLLDLRKEMA-SPANKKL 129

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 45  LTHWQAQIKGPQGTPYANHE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGA 100
           +T W   I GP   P++NHE   + L IEC P YP  PP + F   +++P C VN  TG 
Sbjct: 1   MTKWNGTILGP---PHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLP-C-VNPTTGE 55

Query: 101 ICLDILEKQHWTPAWNLMTTM 121
           +  D    + W  A+ + T +
Sbjct: 56  VQTDFHTLRGWKRAYTMETLL 76

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 138

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 39/85 (45%), Gaps = 19/85 (22%)

Query: 3  RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
          RLL+E +K +  + P S  +     D+               +THW   I GP   P++N
Sbjct: 9  RLLEELEKGEKGMGPESCSYGLAHSDDIT-------------MTHWNGTILGP---PHSN 52

Query: 63 HE---FQLQIECPPTYPIEPPIIHF 84
          HE   + + IEC   YP +PP I F
Sbjct: 53 HENRIYSVAIECGEAYPDQPPKIRF 77

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 60  YANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMT 119
           Y    F+       TYPIEPP +      + H N++ Q G +CL+IL ++ W+P  ++ +
Sbjct: 73  YKCGHFKFCATFKDTYPIEPPKVTLLS-KIFHPNIDLQ-GNVCLNIL-REDWSPVLDVQS 129

Query: 120 TMKAIWILLKDPVPDSPLNVDIANILRVN 148
            +  + +L  +P    PLN   A++L  N
Sbjct: 130 ILIGLLMLFLEPNATDPLNKVAADVLAAN 158

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 3/91 (3%)

Query: 55  PQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPA 114
           P+   Y    F+  +    TYPIEPP +     ++ H N+++ +G ICL++L ++ W+P 
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLN-TIYHPNIDY-SGNICLNVL-REDWSPV 139

Query: 115 WNLMTTMKAIWILLKDPVPDSPLNVDIANIL 145
            +L T +  +  L  +P    PLN   A+ +
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 13/106 (12%)

Query: 56  QGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL--------- 106
           + + Y    F+ +++ P  +P  PP   F P  + H NV ++ G +C+ IL         
Sbjct: 52  EDSIYNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTS 109

Query: 107 --EKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQ 150
             + + W+P  ++ + + +I  LL+DP   SP NVD +   R N Q
Sbjct: 110 EPDNETWSPVQSVESVLISIISLLEDPNISSPANVDASVEYRKNFQ 155

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 35  TYLHPISTSD--LTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIH-FQPLSMPH 91
           T LH +  +D  +   Q  +K  +G  Y    F  ++     YP+EPP +     +  P+
Sbjct: 40  TQLHIVRGTDDSIPLLQLAVKPDEGY-YKGGNFTFELLFNEQYPMEPPKVKCLNRIYHPN 98

Query: 92  CNVNFQTGAICLDILEKQHWTPAWNLMTTMKAIWILLKDPVPDSPLNVDIANILRVNDQS 151
            + +   G +CL+IL +Q WTPA +L + +  +  L  +     PLN   A     N Q+
Sbjct: 99  IDTD---GRVCLNIL-RQDWTPALDLQSVIIGLLFLFLEISGVDPLNKQAAETFNRNRQN 154

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 10/82 (12%)

Query: 45  LTHWQAQIKGPQGTPYANHE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGA 100
           +T+W   I GP   P++NHE   + + +EC   YP EPP I F   +++P C VN  TG 
Sbjct: 1   MTYWNGTILGP---PHSNHENRIYSVALECGNAYPDEPPKIKFISKINLP-C-VNQTTGE 55

Query: 101 ICLDILEK-QHWTPAWNLMTTM 121
           +  D     + W  ++N+ T +
Sbjct: 56  VKRDQFSTLRDWKRSYNMETLL 77

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
          {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 42.7 bits (99), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 19/85 (22%)

Query: 3  RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
          RLL+E +K +    P S  +   D D+               +T+W   I GP   P++N
Sbjct: 28 RLLEELEKGEKGKGPESCSYGLADGDDIT-------------MTNWNGTILGP---PHSN 71

Query: 63 HE---FQLQIECPPTYPIEPPIIHF 84
          HE   + + I C P YP  PP I F
Sbjct: 72 HENRIYSVAITCGPNYPDVPPTIKF 96

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 6/87 (6%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           ++  W   I GP  TPY   ++   +  PP YP +PP I    +S P+     Q   +CL
Sbjct: 33  NILEWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIR---ISTPNGRFK-QHTRLCL 88

Query: 104 DILEKQ--HWTPAWNLMTTMKAIWILL 128
            + +     W P+W++ T +  +   +
Sbjct: 89  SMSDYHPDTWNPSWSVATILNGLLSFM 115

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 8/88 (9%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-IC 102
           ++  W   I GP  TPY N ++   +  P  YP  PP I      M   N  F+    +C
Sbjct: 33  NILEWHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIR-----MITPNGRFKENTRLC 87

Query: 103 LDILEK--QHWTPAWNLMTTMKAIWILL 128
           L + +   + W PAW+++T +  +   +
Sbjct: 88  LSMSDYHPEAWNPAWSVVTILNGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 8/89 (8%)

Query: 43  SDLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-I 101
           S++  W   I GP GTPY N ++   +  P  YP +PP I      M   +  FQ    +
Sbjct: 32  SNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIR-----MVTPSGRFQENTRL 86

Query: 102 CLDILEKQ--HWTPAWNLMTTMKAIWILL 128
           CL + +     W P W++ T +  +   +
Sbjct: 87  CLSMSDYHPTTWNPGWSVSTILNGLLSFM 115

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 65  FQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMKAI 124
           F+  +    TYPIEPP +      + H N++ Q G +CL+IL ++ W+P  +L + +  +
Sbjct: 78  FRFSLFFKDTYPIEPPAVKCVN-KIYHPNIDTQ-GNVCLNIL-REDWSPVLDLQSVVIGL 134

Query: 125 WILLKDPVPDSPLN 138
             L  +P    PLN
Sbjct: 135 LFLFLEPNDKDPLN 148

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 9/81 (11%)

Query: 45  LTHWQAQIKGPQGTPYANHE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGA 100
           +T W   I GP   P++NHE   + L IEC P YP  PP + F   +++P C V+  TG 
Sbjct: 1   MTKWNGTILGP---PHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLP-C-VSQTTGE 55

Query: 101 ICLDILEKQHWTPAWNLMTTM 121
           +  +    + W  A+ + T +
Sbjct: 56  VQTNFHTLRDWKRAYTMETLL 76

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 14/104 (13%)

Query: 72  PPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDIL-----------EKQHWTPAWNLMTT 120
           P  +P  PP   F P  + H NV F  G++C+ IL           + + W+P   + T 
Sbjct: 68  PRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETV 125

Query: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164
           + +I  LL DP   SP NVD A +   N +  YN  +   + AS
Sbjct: 126 LISIISLLDDPNVSSPANVDAA-VEYKNARQEYNKRVILEVEAS 168

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 62/137 (45%), Gaps = 25/137 (18%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RLL+E +K +  L P S  +   + ++               +T W   I GP   P++N
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLANGEDIT-------------MTTWNGTILGP---PHSN 52

Query: 63  HE---FQLQIECPPTYPIEPPIIHF-QPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLM 118
           HE   + + I+C   YP +PP + F   +++P C V+  TG +  ++    H    W   
Sbjct: 53  HENRIYSVVIKCGDEYPDKPPTVKFISKINLP-C-VDQATGEVETNMF---HTLRDWKRS 107

Query: 119 TTMKAIWILLKDPVPDS 135
            TM+ + + L+  +  S
Sbjct: 108 YTMETLLLDLRKEMASS 124

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 49/125 (39%), Gaps = 25/125 (20%)

Query: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62
           RL KEYK +  T  P  T   N                  S++  W   I GPQ TPY  
Sbjct: 9   RLTKEYKMMVETPPPYITARPNE-----------------SNILEWHYIIIGPQDTPYDG 51

Query: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-ICLDILEK--QHWTPAWNLMT 119
            ++   +  P  YP +PP I      M   N  F+    +CL + +     W P W++ T
Sbjct: 52  GQYHGTLTFPSDYPYKPPAIR-----MITPNGRFKENTRLCLSMSDYHPDTWNPGWSVAT 106

Query: 120 TMKAI 124
            +  +
Sbjct: 107 ILNGL 111

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 49/127 (38%), Gaps = 25/127 (19%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           + RL KEYK I     P      N D+                 +  W   I GP  TPY
Sbjct: 7   LKRLTKEYKLIVENPPPYIVARPNEDN-----------------ILEWHYVITGPSDTPY 49

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-ICLDILEK--QHWTPAWNL 117
           ++ ++   +  P  YP +PP I      M   N  F+    +CL + +     W P W++
Sbjct: 50  SSGQYHGTLTFPSDYPYKPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPGWSV 104

Query: 118 MTTMKAI 124
            T +  +
Sbjct: 105 STILTGL 111

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 49/131 (37%), Gaps = 25/131 (19%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
           + RL KEYK I     P  T   N D+                 +  W   I GP  TPY
Sbjct: 7   LKRLTKEYKLIVENPPPYVTARPNEDN-----------------ILEWHYVITGPPETPY 49

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-ICLDILEK--QHWTPAWNL 117
              ++   +  P  YP +PP I      M   N  F+    +CL + +     W P W++
Sbjct: 50  EGGQYHGTLTFPSDYPYKPPAIR-----MVTPNGRFKENTRLCLSMSDYHPDLWNPGWSV 104

Query: 118 MTTMKAIWILL 128
            T +  +   +
Sbjct: 105 STILTGLLSFM 115

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 45/125 (36%), Gaps = 10/125 (8%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICL 103
           ++  W   I GP  TPY + ++   +  P  YP +PP I      M   N  F+      
Sbjct: 33  NILEWHYIITGPPDTPYTDGQYHGTLVFPADYPFKPPAIR-----MITPNGRFKENTRLC 87

Query: 104 DILEKQH---WTPAWNLMTT-MKAIWILLKDPVPDSPLNV-DIANILRVNDQSAYNGLLN 158
             +   H   W PAW++ T  M  +  +  D V    +   D            YN L N
Sbjct: 88  MTMSDYHPDTWNPAWSVATILMGLLSFMTGDEVTTGSITTSDAYKKKMAKKSKEYNALFN 147

Query: 159 YYLSA 163
               A
Sbjct: 148 ARFKA 152

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 36/84 (42%), Gaps = 8/84 (9%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-IC 102
           ++  W   I GP  TPY   ++   +  P  YP +PP I      M   N  F+    +C
Sbjct: 33  NILEWHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIR-----MITPNGRFKENTRLC 87

Query: 103 LDILEKQ--HWTPAWNLMTTMKAI 124
           L + +     W P W++ T +  +
Sbjct: 88  LSMSDYHPDLWNPGWSVATILNGL 111

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 8/88 (9%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ-TGAIC 102
           ++  W   I GP  TPY   ++   +  P  YP +PP I      M   N  F+    +C
Sbjct: 33  NILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIR-----MITPNGRFKPNTRLC 87

Query: 103 LDILEK--QHWTPAWNLMTTMKAIWILL 128
           L + +     W P W++ T +  +   +
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 8/88 (9%)

Query: 44  DLTHWQAQIKGPQGTPYANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQ-TGAIC 102
           ++  W   I GP  TPY   ++   +  P  YP +PP I      M   N  F+    +C
Sbjct: 33  NILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIR-----MVTPNGRFKPNTRLC 87

Query: 103 LDILEKQ--HWTPAWNLMTTMKAIWILL 128
           L + +     W P W++ T +  +   +
Sbjct: 88  LSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 49/127 (38%), Gaps = 25/127 (19%)

Query: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60
             RL KEYK +  T  P      N D+                 +  W   I GP  +PY
Sbjct: 7   FKRLTKEYKTLTETPPPYILARPNEDN-----------------ILEWHYIITGPPDSPY 49

Query: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGA-ICLDILEKQ--HWTPAWNL 117
           +  ++   +  P  YP +PP I      M   N  F+    +CL + +     W P+W++
Sbjct: 50  SEGQYHGTLTFPTDYPYKPPAIR-----MITPNGRFKENTRLCLSMSDYHPDLWNPSWSV 104

Query: 118 MTTMKAI 124
            T +  +
Sbjct: 105 STILTGL 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,772,989
Number of extensions: 965818
Number of successful extensions: 4468
Number of sequences better than 10.0: 284
Number of HSP's gapped: 4194
Number of HSP's successfully gapped: 284
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)