Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E007703.497ON1150115053380.0
Suva_7.4223.497ON1127111521870.0
YGR134W (CAF130)3.497ON1122116321410.0
Skud_7.4453.497ON1123116021240.0
Smik_6.2303.497ON1124116920960.0
KAFR0C020003.497ON1066109020540.0
ZYRO0D09790g3.497ON118087719870.0
TDEL0D056503.497ON1077111819590.0
NDAI0G009003.497ON127990419230.0
Kpol_480.123.497ON111485617820.0
SAKL0F02596g3.497ON1132108217720.0
KNAG0B007703.497ON1038113017610.0
Ecym_12323.497ON1204119517110.0
AFR316W3.497ON1191117516920.0
KLTH0G02442g3.497ON1113111716630.0
Kwal_47.188863.497ON1105113316410.0
TBLA0C045103.497ON1307122416460.0
CAGL0I10428g3.497ON116387014251e-177
TPHA0A056803.497ON107485113401e-166
KLLA0E03961g3.497ON113211419541e-110
Ecym_60366.373ON2100209729.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00770
         (1150 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...  2060   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   847   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   829   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   822   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   811   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   795   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   769   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   759   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   745   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   691   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   687   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   682   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   663   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   656   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   645   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   636   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   638   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   553   e-177
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   520   e-166
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   372   e-110
Ecym_6036 Chr6 (65515..71817) [6303 bp, 2100 aa] {ON} similar to...    32   9.0  

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score = 2060 bits (5338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1014/1150 (88%), Positives = 1014/1150 (88%)

Query: 1    MESANAQVVGCINNRLLLPPIPYAMAQLVTYTPLRELFAERNYQPXXXXXXXXXXXXXXX 60
            MESANAQVVGCINNRLLLPPIPYAMAQLVTYTPLRELFAERNYQP               
Sbjct: 1    MESANAQVVGCINNRLLLPPIPYAMAQLVTYTPLRELFAERNYQPSLSQLLNLLSDDALL 60

Query: 61   XXXTPIQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKT 120
               TPIQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKT
Sbjct: 61   NNLTPIQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKT 120

Query: 121  AHQYLRKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI 180
            AHQYLRKKWSSN            VNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI
Sbjct: 121  AHQYLRKKWSSNKLYFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI 180

Query: 181  LDNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHE 240
            LDNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHE
Sbjct: 181  LDNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHE 240

Query: 241  GHLNATKQNNNSNNIPLTMQPSIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKR 300
            GHLNATKQNNNSNNIPLTMQPSIKT         QTVYSFDLNTDKTFELDNVVSHTAKR
Sbjct: 241  GHLNATKQNNNSNNIPLTMQPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKR 300

Query: 301  HRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPN 360
            HRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPN
Sbjct: 301  HRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPN 360

Query: 361  LKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXX 420
            LKECFNANDGFNWKFHICFNMVKLINNSMVILKCD                         
Sbjct: 361  LKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDD 420

Query: 421  AWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSA 480
            AWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSA
Sbjct: 421  AWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSA 480

Query: 481  IILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNT 540
            IILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNT
Sbjct: 481  IILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNT 540

Query: 541  FMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEY 600
            FMSPHGRKLCQGALYADIRSH                     QAGDRFDEDIRYMFDYEY
Sbjct: 541  FMSPHGRKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEY 600

Query: 601  DDYNDFKDDVEEQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDA 660
            DDYNDFKDDVEEQEEMEIMGSFPRRCNCIF                          YVDA
Sbjct: 601  DDYNDFKDDVEEQEEMEIMGSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDA 660

Query: 661  IEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYH 720
            IEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYH
Sbjct: 661  IEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYH 720

Query: 721  FIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPH 780
            FIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPH
Sbjct: 721  FIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPH 780

Query: 781  AAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFI 840
            AAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFI
Sbjct: 781  AAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFI 840

Query: 841  THMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLP 900
            THMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLP
Sbjct: 841  THMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLP 900

Query: 901  FSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXXXXXIDEEAVNFSVYSTG 960
            FSRQGPLILSEIENKMLLQEFFTNAAIYFSSKS             IDEEAVNFSVYSTG
Sbjct: 901  FSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNEGTTNNDNGEGIDEEAVNFSVYSTG 960

Query: 961  LVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXX 1020
            LVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTL          
Sbjct: 961  LVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSSSTK 1020

Query: 1021 XXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKD 1080
              RESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKD
Sbjct: 1021 TGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKD 1080

Query: 1081 ENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTELDDEIRE 1140
            ENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTELDDEIRE
Sbjct: 1081 ENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTELDDEIRE 1140

Query: 1141 NSMYDYTKEK 1150
            NSMYDYTKEK
Sbjct: 1141 NSMYDYTKEK 1150

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1115 (42%), Positives = 656/1115 (58%), Gaps = 113/1115 (10%)

Query: 71   LLVECVIIGFLSTRSGK-LLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKW 129
            LL E + +   +T+SGK +LQ+   +   ++        K W  S +   + +  + + W
Sbjct: 71   LLFEALSVTLFTTKSGKSILQTMKASTSKER--------KAWEKSFENHDSNYASIIRSW 122

Query: 130  SSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQ 189
              +             N    + +D+Y  P YKLPL+FL     NL P+ IL+  YN+L+
Sbjct: 123  KEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNL-PSIILNEGYNMLK 181

Query: 190  DYIYACGPLLKCVM--KDTLENGICLDLPGIYKLDIDLQFP--YPWY------------- 232
            DY+YA    ++ ++    T +    +    + + D  ++F   Y WY             
Sbjct: 182  DYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLN 241

Query: 233  ---DLLPPMHEGHLNATKQNNNSNNIPLTMQPSIKTXXXXXXXXXQTVYSFDLNTDKTFE 289
               +LL   +E +L+     +++       +    T         + +YSF+LN D T +
Sbjct: 242  HNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTLQ 301

Query: 290  LDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLL 349
            + NV+ H+  RH +L +++N   +  TPLL  QF+ + GLVDPL+QP PN+K +IS+  L
Sbjct: 302  IPNVMEHSLLRHELLFKILNLTPV-LTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360

Query: 350  YSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXX 409
            Y +F+GLMYP++K     N+ ++WKF+ICFNM K+I+ +M+ L C               
Sbjct: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNC----------FGFEK 410

Query: 410  XXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLS 469
                        W+ +L+ W+PHG+NTQDLEL+YMI+I+AVYTIY+LY ++PIQ+NPFL 
Sbjct: 411  LNSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLF 470

Query: 470  CLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVN 529
             L++LWKNLS +ILL L+IDR EE + T+ TPL+VRATIRGAA+LR+V+A +LN  V  N
Sbjct: 471  SLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSN 530

Query: 530  EHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFD 589
            +HDFKHE LNTFMSP+GRKLC GALYAD+RSH                     Q+GDRFD
Sbjct: 531  DHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFD 590

Query: 590  EDIRYMFDYEYDDYNDFKDDVEEQEEMEIM------------GSFPRRCNCIFXXXXXXX 637
            EDIRYMFDYE +DYN+   D  ++E  E +            G + RRCNCIF       
Sbjct: 591  EDIRYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFNDDKLVA 650

Query: 638  XXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNLNPHDAIRTRNS-----HPNSKRSK 692
                                 D+I+   +     N   + AI   N      +P S RS+
Sbjct: 651  EDGANASTNN-----------DSIKNEIR--SDGNAGSNTAITNANHATSSINPYSVRSR 697

Query: 693  SSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLIT 752
            S+FEFDY G+DWRD+P+ FN+YYSPSY FI+ P ++ I  LT +   EKL+ E+S LL+ 
Sbjct: 698  STFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVR 757

Query: 753  AVASCIKLEQDKMISKELLKHNTVKHPH--------AAENEDDADFKIATPDDIYDMWSE 804
            +VASC+K EQD+MI  +L  + T    +         ++  +D + +  TPDDIY++WSE
Sbjct: 758  SVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPDDIYEIWSE 817

Query: 805  ESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSP 864
            ES FERMLY+N DVAWRLMDEMLMC GYRR+LIWF+TH+EL HSLI Y+FEL+MGLRG+P
Sbjct: 818  ESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNP 877

Query: 865  FSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTN 924
            FSGE  + D K+D+++EI+  + KN+    + + LPFSRQGP++LS+IE KMLLQEFF N
Sbjct: 878  FSGEASDQDRKDDMIYEILKKKQKNE----NTSGLPFSRQGPIVLSDIETKMLLQEFFMN 933

Query: 925  AAIYFSSKSXXXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSE 984
            AAI+ SSK+               E+A   S+YS GLVKLIC+MVQ+L+ N+KF F KSE
Sbjct: 934  AAIFLSSKNTEEE----------GEDADKVSLYSLGLVKLICYMVQTLIANDKFFFTKSE 983

Query: 985  CTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDT 1044
            CTFELQTLLM WIGI+PEA+DLFF +            R + + D    + +   D  D 
Sbjct: 984  CTFELQTLLMTWIGILPEAKDLFFQI----------KSRLAMEEDGITDNTVQHKDKTDL 1033

Query: 1045 GHPGISRFDTDDSPPNESI--FNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAP 1102
                    D+   P  +SI   N +++SL P    + D+N+A+STLR FI  YSFD +  
Sbjct: 1034 D------LDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQVV 1087

Query: 1103 VYGRKVVYSDEIVLPLPAADQPISFHEYLT--ELD 1135
              GR+VV+ D+ +LPLP AD+PI  HEY+T  ELD
Sbjct: 1088 APGRRVVFHDDKILPLPKADKPIPLHEYITLAELD 1122

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1163 (41%), Positives = 661/1163 (56%), Gaps = 134/1163 (11%)

Query: 31   YTPLRELFAERNYQPXXXXXXXXXXXXXXXXXXTPIQEHSLLVECVIIGFLSTRSGKLLQ 90
            + PL+EL  ++NY P                        +LL+E +II   +T SGK   
Sbjct: 31   FIPLQELLKDKNYVPSVENLEKILYNETMFNDQKICS--NLLLEALIITLFTTISGK--- 85

Query: 91   SALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNXXXXXXXXXXXXVNADGN 150
            SAL   +  Q + L+ + K W  S + + +++  +   W  N             N    
Sbjct: 86   SAL---RLIQTSSLKER-KSWAQSFENNSSSYASIVLSWKDNDILLLKFLRFLLANKTAP 141

Query: 151  INVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVMKDTLENG 210
            + +++Y  P YKLPL+FL      + P+ +L+  YNLL+DY+Y+    ++ ++  +    
Sbjct: 142  LQINRYNLPEYKLPLSFLIVSKITI-PSILLNETYNLLKDYLYSITGRIESLISCS---- 196

Query: 211  ICLDLPGI--------YKLDIDLQFPYPWYDLLPPMHEGHLNATKQNNNSNNIPLTM--- 259
               D P +        Y   I+ +  Y WY       E  +N T     S+NI L M   
Sbjct: 197  STFDKPALVVRKILKDYNRMIECRNFYFWYSF---NAENRVNLTF----SDNISLLMEND 249

Query: 260  -----------------QPSIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHR 302
                             QP  +          + +YSF+LN D T E+ NV+ H+  RH 
Sbjct: 250  EGNAGSGLDDSRFDHQKQPR-EAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHE 308

Query: 303  VLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLK 362
            +L +++N   +  TPLL LQF+ + GLVDPL QP PN+K +IS+  L+ +F+GLM  ++K
Sbjct: 309  LLFKILNLTTV-LTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIK 367

Query: 363  ECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAW 422
                 ND ++WKF++CFNM K+I+ +M+ L C                           W
Sbjct: 368  TSQEHNDHYDWKFYMCFNMQKIIDATMLRLNC----------FDFDILNSVNNTDNAVHW 417

Query: 423  KLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAII 482
            K +L+ W+PHG+NTQDLEL+YMI+I+AVYTIY+LY  +PIQ+NPFL  LI+LWKNLS +I
Sbjct: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477

Query: 483  LLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFM 542
            LL L+IDR EE   T+ TPL+VRATIRGAA+LR+V+AT+LN  V  N+HDFKHE LNTFM
Sbjct: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537

Query: 543  SPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDD 602
            SP+GRKLC GALYAD+RSH                     Q+GDRFDEDIRYMFDYE +D
Sbjct: 538  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 597

Query: 603  YND---------FKDDVEEQEEMEIMGS----FPRRCNCIFXXXXXXXXXXXXXXXXXXX 649
            Y++           + V    E    GS    F RRCNCIF                   
Sbjct: 598  YDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTN 657

Query: 650  XXXXXXXYVDAIEGVTKDTPHNNLNP-HDAIRTRNSH------PNSKRSKSSFEFDYGGK 702
                     + +EG      HNN N  H+A    + H      P S RS+S+FEFDY G+
Sbjct: 658  S--------ENVEGAM----HNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGE 705

Query: 703  DWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQ 762
            DWRD+PR FN+YYSPSY FI  P ++ I +LT +   EKL  E+S LL+ +VASC++ EQ
Sbjct: 706  DWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQ 765

Query: 763  DKMISKELLKHNTVKHPHAAENE--------DDADFKIATPDDIYDMWSEESKFERMLYL 814
            D+MI  +L  + +       E E        D+ D +  TPDDIY++WSEES FERML +
Sbjct: 766  DQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNV 825

Query: 815  NQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDS 874
            N DVAWRLMDEMLMC GYRR+LIWF+TH+EL HSLI Y+FEL+MGLRG PFSGE  + D 
Sbjct: 826  NHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDK 885

Query: 875  KNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSX 934
            K+D+++EI+  + KN++     + LPFSRQGP++LS+IE KMLLQEFF NAAI+ SSK+ 
Sbjct: 886  KDDMIYEILKKKQKNEDA----SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNN 941

Query: 935  XXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLM 994
                         D E +  S+YS GLV+LIC+MVQ+L+ N+KF F KSECTFELQTLLM
Sbjct: 942  EEENE--------DGEKI--SLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLM 991

Query: 995  NWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDT 1054
             WIGI+PEA+DLFF +             E D  D    +    SD        I +   
Sbjct: 992  TWIGILPEAKDLFFKI------KTRLAMEEEDSADTMQHEGRKNSD--------IEK-KL 1036

Query: 1055 DDSPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEI 1114
            +  P +E   N +L++L P +  +KD+++ ++TLR FI  YSFD +    GR+VV+ D  
Sbjct: 1037 NAKPASE--LNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYDGK 1094

Query: 1115 VLPLPAADQPISFHEYLT--ELD 1135
            +LPLP AD+PI  HEY+T  ELD
Sbjct: 1095 ILPLPKADKPIPLHEYITLAELD 1117

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1160 (40%), Positives = 662/1160 (57%), Gaps = 117/1160 (10%)

Query: 31   YTPLRELFAERNYQPXXXXXXXXXXXXXXXXXXTPIQEHSLLVECVIIGFLSTRSGKLLQ 90
            + PL+ L  ++NY P                        S+L E + I   +T+SGK + 
Sbjct: 31   FVPLQVLLKDKNYVPSLENLEKLLYNESILDDQKI--RLSILFEALSIILFTTKSGKSIL 88

Query: 91   SALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNXXXXXXXXXXXXVNADGN 150
             A+     Q  T  E   K W  S     + +  + + W  N             N   +
Sbjct: 89   QAV-----QASTLKEK--KLWAQSLRDDDSNYASVVQGWKDNDVLFLKFLRFLLANKTTS 141

Query: 151  INVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVMK-DTLEN 209
            + +DKY  P YKLPL+FL     N  P+ IL+  +N+L+DY+Y+    + C+++ +++ +
Sbjct: 142  LQIDKYNLPEYKLPLSFLIVSKINF-PSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITS 200

Query: 210  GICLDLPGI---YKLDIDLQFPYPWY----------------DLLPPMHEGHLNATKQNN 250
               L +  I   Y   ++    Y WY                DLL    E H +    ++
Sbjct: 201  RSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSDNFDLLMNSPEDHADGGVIDD 260

Query: 251  --NSNNIPLTMQPSIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLI 308
               S+N     + +  T         + +YSF+L+ D T ++ N++ H+  RH +L +++
Sbjct: 261  RCKSDN---PQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIPNIMEHSLMRHELLFKIL 317

Query: 309  NNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNAN 368
            N   +  TPLL LQF  + GLVDPL QP PN++QVIS+  L+ +F+GLMYP++K     N
Sbjct: 318  NLPSV-LTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHN 376

Query: 369  DGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNE 428
            D ++WKF+ CFNM K+I+ +M+ L C                           W+ +L++
Sbjct: 377  DHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIH----------WRTQLHK 426

Query: 429  WIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDI 488
            W+PHG+NTQDLEL+YMI+I+A+YTIY+LY  +PIQ+NPFL  L++LWKNLS +ILL L+I
Sbjct: 427  WLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEI 486

Query: 489  DRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRK 548
            DR EE   T+ TPL+VRATIRGAA+LR+V+A++LN  V  N+HDFKHE LNTFMSP+GRK
Sbjct: 487  DRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRK 546

Query: 549  LCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYND-FK 607
            LC GALYAD+RSH                     Q+GDRFDEDIRYMFDYE +DYN+ F 
Sbjct: 547  LCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNEPFS 606

Query: 608  DDVEEQ-----------EEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXX 656
            +  +EQ           +     G + RRCNCIF                          
Sbjct: 607  ESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFE---------- 656

Query: 657  YVDAIEGVTKDTPHN-NLNPHDAIRTRNS-----HPNSKRSKSSFEFDYGGKDWRDIPRG 710
             +     +  + P+N N+ P  A    N      +P S RS+S+FEFDY G+DWRD+P+ 
Sbjct: 657  -ISGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKD 715

Query: 711  FNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKEL 770
            FN+YYSPSY FI+ P ++ I  LT +   EKL  +DS +L+ +VASC+K EQD+MI  +L
Sbjct: 716  FNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDL 775

Query: 771  LKH--NTVKHPHAAENE-----DDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLM 823
              +     ++P A  +      ++ + +  TPDDIY++WSEES FERML +N DVAWRLM
Sbjct: 776  GSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLM 835

Query: 824  DEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIM 883
            DEMLMC GYRR+LIWF+TH+EL HSLI Y+FELVMGLRG PFSGE  + D K+D+++EI+
Sbjct: 836  DEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEIL 895

Query: 884  YGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXX 943
              + KN+++    + LPFSRQGP++LS+IE KMLLQEFF NAAI+ SSK+          
Sbjct: 896  KKKRKNEDV----SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEEN----- 946

Query: 944  XXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEA 1003
                 E+    S+YS GLVKLIC+MVQ+L+ N+KF F KSECTFELQTLLM WIG++PEA
Sbjct: 947  -----EDGEKISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEA 1001

Query: 1004 EDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSP--PNE 1061
            +DLFF +             E  D D    D     D+ D         + +  P   + 
Sbjct: 1002 KDLFFQI------KTRLAMEEDSDKDGQQND-----DNKD--------LEVERRPHTKSN 1042

Query: 1062 SIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAA 1121
            S  N +L++L P      ++N+A+STLR FI  Y FD +    GRKVV+ D  +LPL  A
Sbjct: 1043 SELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILPLSKA 1102

Query: 1122 DQPISFHEYLTELDDEIREN 1141
            D+PI  HEY+T  + ++ E+
Sbjct: 1103 DKPIPLHEYITLAEIDVGES 1122

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1169 (42%), Positives = 652/1169 (55%), Gaps = 144/1169 (12%)

Query: 31   YTPLRELFAERNYQPXXXXXXXXXXXXXXXXXXTPIQEHSLLVECVIIGFLSTRSGK-LL 89
            + PL+EL  ++NY P                        SLL E + I   +T SGK +L
Sbjct: 31   FVPLQELLKDKNYVPSVENLEKVLCDETMLNDQKV--RFSLLFEALAITLFTTNSGKSIL 88

Query: 90   QSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNXXXXXXXXXXXXVNADG 149
            QS          TF   + K W  S + + + +  +   W  N             N   
Sbjct: 89   QSI--------QTFTSKKRKLWAQSFENNNSNYASIVFSWKDNDILLLKFVRFLLANKTM 140

Query: 150  NINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYA----------CGPLL 199
             + +D+Y  P +KLPL+FL     N+ P+ +L+  YNLL+DY+Y+          C P  
Sbjct: 141  PLKIDRYNLPEHKLPLSFLIVSKINI-PSILLNEGYNLLKDYLYSITGRIEELLMCSPKF 199

Query: 200  ---KCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLN--------ATKQ 248
                 V+K TL++         Y   I+ +  Y WY      +  HL            +
Sbjct: 200  NQPALVVKRTLKD---------YDRMIECENCYCWY-YFNAENSAHLKFDDNIACLMGSE 249

Query: 249  NNNSNNIPLTM--------QPSIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKR 300
            NN  N +  +         QP             + +YSF+LN D T E+ NV+ H+  R
Sbjct: 250  NNTENGLGDSRVNNNNYHKQPK-DVVMSRTINDQEQIYSFELNHDGTLEIPNVMKHSLLR 308

Query: 301  HRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPN 360
            H +L +++N   + +TPLL LQF+ + GLVDPL QP PN+K +IS+  L+ +F+GLMYP 
Sbjct: 309  HELLFKILNLTPV-STPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPA 367

Query: 361  LKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXX 420
            +K     ND ++WKF+ CFNM K+I+ +M  L C                          
Sbjct: 368  IKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNC----------FDFNILNSVNNTDSSV 417

Query: 421  AWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSA 480
             W+ +L+ W+PHG+NTQDLEL+YMI+I+AVYTIY+LY  LPIQ+NPFL  LI+LWKNLS 
Sbjct: 418  HWRTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSC 477

Query: 481  IILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNT 540
            +ILL L+IDR EE   T+ TPL+VRATIRGAA+LR+V+ATILN  V  NEHDFKHE LNT
Sbjct: 478  VILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNT 537

Query: 541  FMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEY 600
            FMSP+GRKL  GALYAD+RSH                     Q+GDRFDEDIRYMFDYE 
Sbjct: 538  FMSPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYEC 597

Query: 601  DDYND-FKDDVEEQEEMEIMGS-------------FPRRCNCIFXXXXXXXXXXXXXXXX 646
             DY++ F +  +E  E  I+ +               RRCNCIF                
Sbjct: 598  ADYDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFE 657

Query: 647  XXXXXXXXXXYVDAIEGVTKDTPHNNLNPHDAIRTRNS-----HPNSKRSKSSFEFDYGG 701
                        + I+ V+          + AI T N      +P S R++S+FEFDY G
Sbjct: 658  STCNRNGERRVRNNIDVVS----------NTAITTSNHVSTSINPFSVRARSTFEFDYSG 707

Query: 702  KDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLE 761
            +DWRD+PR FN+YYSPSY FI  P ++ I  LT +   EKL  E+S LL+ +VASC+K E
Sbjct: 708  EDWRDVPRDFNMYYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNE 767

Query: 762  QDKMISKELLKHNTVKHPHA-AENE------DDADFKIATPDDIYDMWSEESKFERMLYL 814
            QD+M+  +L  + T    HA  EN       D+ + +  TPDDIY++WSEES FERML +
Sbjct: 768  QDQMVLADLKTNLTGISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNV 827

Query: 815  NQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDS 874
            N DVAWRLMDEMLMC GYRR+LIWF TH+EL HSLI Y+FEL+MGLRG  FSG+  + D 
Sbjct: 828  NHDVAWRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDK 887

Query: 875  KNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSX 934
            K+D+++EI+  + KN +  +    LPFSRQGP+ILS+IE KMLLQEFF NAAI+ SS + 
Sbjct: 888  KDDMIYEILKKKQKNDDASS----LPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNS 943

Query: 935  XXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLM 994
                         D E +  S+YS GLV+LIC+MVQ+L+ N+KF F KSECTFELQTLLM
Sbjct: 944  EEENE--------DGEKI--SLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLM 993

Query: 995  NWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTG---HPGISR 1051
             WIGI+PEA+DLFF +                         L+  +D DTG   H G   
Sbjct: 994  TWIGILPEAKDLFFEIKT----------------------RLAMEEDNDTGTMQHEGRRS 1031

Query: 1052 FDTD---DSPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKV 1108
             D +   ++ P  S  N +L+SL P    D  EN+A++TLR+FI  YSFD +    GRKV
Sbjct: 1032 LDIEKKLNTKP-ASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQVNPPGRKV 1090

Query: 1109 VYSDEIVLPLPAADQPISFHEYLT--ELD 1135
            V+ D  +LPL  AD+PI  HEY+T  ELD
Sbjct: 1091 VFYDGKILPLTKADKPIPLHEYITLAELD 1119

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1090 (43%), Positives = 628/1090 (57%), Gaps = 116/1090 (10%)

Query: 68   EHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRK 127
            E S+L+E ++I   +T+SG  + S L N     + F   +Y  WL S+      ++YL+ 
Sbjct: 49   EPSVLLEGLVISLFTTKSGHSILSVLNNPDANSELF--QRYNSWLESSS-GDLNYKYLKH 105

Query: 128  K-WSSNXXXXXXXXXXXXV-NADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKY 185
            + W SN            + N     +++ Y    YKL L  L +  +N++   +  + Y
Sbjct: 106  ELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNY 165

Query: 186  NLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEG---- 241
            NLL D+I    P +  ++   +E     ++   Y    +L   + WY L    +      
Sbjct: 166  NLLLDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVR 225

Query: 242  HLN-------ATKQNNNSNNIPLTMQPSIKTXXXXXXXXXQ--TVYSFDLNTDKTFELDN 292
            +LN              SN      Q S +T         +   ++SFDLN  +T +L N
Sbjct: 226  YLNDVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQTAKDDIIFSFDLN--ETGDLPN 283

Query: 293  VVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSM 352
            ++ H+  RH+++  ++N N + + P L  QF  + GLVDPL+QP PNN+ +IS+ L+Y +
Sbjct: 284  LIKHSEMRHQIIYDILNLNQIDS-PFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQL 342

Query: 353  FIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXX 412
            F+GLMY          D     F ICFNM K+I+ S+V+L C+                 
Sbjct: 343  FMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILNDFPND-- 400

Query: 413  XXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLI 472
                     +K  LN+W+PHGINTQDLELIYMINI+A+YTIY+LYS+LPIQ+NPFL  L+
Sbjct: 401  ---------YKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNPFLQTLV 451

Query: 473  TLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHD 532
            +LWK LS ++L+GL+IDR EE+ +T+ TP++VRATIRGAA+LRAV+ATILN+HV   EHD
Sbjct: 452  SLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHD 511

Query: 533  FKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXX-XQAGDRFDED 591
            FKHE  NTFMSPHGRKLC GAL AD+RSH                      QAGDRFDED
Sbjct: 512  FKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDED 571

Query: 592  IRYMFDYEYDDYNDFKDDVE---EQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXX 648
            ++Y+F+YEY DYN+  ++ E   E EE+E      RRCNCIF                  
Sbjct: 572  VKYIFEYEYQDYNELGEEDEQTNELEELEKRSVKKRRCNCIFEDDKMLEDYEYYE----- 626

Query: 649  XXXXXXXXYVDAIEGVTKDTPHNNLN-PHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDI 707
                           V  ++   ++N   D  RT   +P S R  S FEFDY GKDWRD+
Sbjct: 627  ---------------VGNESRREDMNLESDKSRT---NPYSVRVNSIFEFDYSGKDWRDV 668

Query: 708  PRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMIS 767
            PRGFNLYYSPSY FIK+P + T+   T KAT EKL+ EDS LL+ +VASC+KLEQ+KMI 
Sbjct: 669  PRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVASCVKLEQEKMI- 727

Query: 768  KELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEML 827
              L  ++  K+      E+D D ++ TPDD+Y++W EES FERM+YLN++VAWRLMDEML
Sbjct: 728  --LENYSNTKN---CSTEEDLDREV-TPDDVYEIWCEESAFERMIYLNKEVAWRLMDEML 781

Query: 828  MCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQV 887
            MCNGYRRVL+WFITHME+NHSL+ YIFELVMGLRG          D    LL + M    
Sbjct: 782  MCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDK 841

Query: 888  KNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXXXXXI 947
            K  E V      PFSRQG +ILSEIE KMLLQEFFTNAAI+FS+                
Sbjct: 842  KGSEKV------PFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMS--------- 886

Query: 948  DEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLF 1007
              ++ N S+Y+ GLVKLICFMV++LM N+KFDF+KSECTFELQTLLMNWIGIIPEA++LF
Sbjct: 887  SNDSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELF 946

Query: 1008 FTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGI-SRFDTDDSPPNE---SI 1063
            FTL                                + G P +  + D+D +  NE   S 
Sbjct: 947  FTLK------------------------------ANVGEPSMEGKSDSDGTDSNEGELSW 976

Query: 1064 FNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQ 1123
            +N +L++LLP   N   EN A+ TLR F+++YSF  + PV GRKV+Y D+ +LP+P   Q
Sbjct: 977  YNSKLLALLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQ 1036

Query: 1124 PISFHEYLTE 1133
            PI   E + E
Sbjct: 1037 PILLRELIDE 1046

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/877 (46%), Positives = 545/877 (62%), Gaps = 64/877 (7%)

Query: 275  QTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPLS 334
            + V+SFDLN D + EL N++SH A RH +L +++  N+  ++PLL LQF  +AGLVDPL+
Sbjct: 340  EQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLNN-SSSPLLQLQFKIVAGLVDPLT 398

Query: 335  QPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKC 394
            QP PN+K VISL LLY MF+G + P +++     +G +W+FH+CFNM K+I+ S+V L  
Sbjct: 399  QPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNF 458

Query: 395  DXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIY 454
            D                          W+ +L++W+PHG NTQDLELI M++I+AVYTIY
Sbjct: 459  DDFERLNSINNSDDNVD----------WRSQLDKWLPHGFNTQDLELICMVDIIAVYTIY 508

Query: 455  QLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASL 514
            +LY  LPIQ+NPFLS LI+LWKNL+ +ILLGL+IDR EE  +TF TPL+VRATIRGAA+L
Sbjct: 509  KLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAAL 568

Query: 515  RAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXX 574
            RA+VAT+LN HV+  +HD KHE LNTFMSPHGRKLCQGALYA++RSH             
Sbjct: 569  RAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAAALLALGSELED 628

Query: 575  XXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFK------------DDVEEQEEMEIMGSF 622
                    Q GDRFDED+RYMF+YE++DYND              DD  +  +      F
Sbjct: 629  VTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGF 688

Query: 623  PRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNLNPHDAIRTR 682
             RRCNCIF                               +   +  P  N     ++ T 
Sbjct: 689  GRRCNCIFDDDEMLEDEDYENEYE-------------GHKAPKQILPQQNPTTSVSMST- 734

Query: 683  NSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKL 742
               P++ RS  SFEFDY GKDWRDIPR  NLYYSP+YHF++     TI +LT+KAT + L
Sbjct: 735  TGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSL 794

Query: 743  TTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDAD-FKIATPDDIYDM 801
            +  +S LL+ +VA+C+K EQD+++   + +   + H + +      D  K  +PDDIY+M
Sbjct: 795  SKIESLLLLGSVATCVKNEQDEIVLGNITE---LHHQNGSRGSQVIDKLKDISPDDIYEM 851

Query: 802  WSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLR 861
            W ++S FE+M+Y N +VAWRLMDEMLMC+G+RRVLIWFITHMELNHSLI YIFELVMGLR
Sbjct: 852  WCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR 911

Query: 862  GSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEF 921
             S    E +E D+ ++ + E+       KE     T LPFSRQG + LS IE KMLLQEF
Sbjct: 912  KS--FDENNENDNGDESISEM------TKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEF 963

Query: 922  FTNAAIYFSSKSXXXXXXXXXXXXXI--DEEAVNFSVYSTGLVKLICFMVQSLMENNKFD 979
            FTNAAI+ + KS                D E  N S+Y+ GL+KLIC MV++ ++  KFD
Sbjct: 964  FTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFD 1023

Query: 980  FAKSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFS 1039
            F +SEC FELQTLLMNWI IIPEA+DLFF L              SD  D+    N    
Sbjct: 1024 FRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEV------HSDPMDDEELSN---- 1073

Query: 1040 DDGDTGHPGISRFDTDDSPPNESI---FNKRLVSLLPKRINDKDENAAVSTLRHFIERYS 1096
            +  D+     S  + D+   NE++   +N++L+SLL   ++ K+ENAAV  LR+FI++YS
Sbjct: 1074 NPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYS 1133

Query: 1097 FDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTE 1133
            FD   P+ GRKVVY    +LPLP ++ P+S  +YL +
Sbjct: 1134 FDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYLVD 1170

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 75/176 (42%), Gaps = 9/176 (5%)

Query: 65  PIQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTF---LENQYKKWLTSTDISKTA 121
           P  ++SLL+E VI+  L+TR+G L   AL        +    + NQ +KWL   +     
Sbjct: 81  PQLKYSLLLEMVIVALLTTRAG-LSVLALLKPSGSNPSIPKCISNQ-RKWLAQVERKGKL 138

Query: 122 HQYLRKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFIL 181
           H  L  +W S+             N D  +  +   +  +K+PL+FL           IL
Sbjct: 139 HSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYR-AAELIL 197

Query: 182 DNKYNLLQDYIYACGPLLKCVMKDTLE--NGICLDLPGI-YKLDIDLQFPYPWYDL 234
           D  YNLL DY  A  PL +  ++  +   NG+ L    I Y    D    + WY L
Sbjct: 198 DPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTL 253

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1118 (40%), Positives = 607/1118 (54%), Gaps = 87/1118 (7%)

Query: 33   PLRELFAERNYQPXXXXXXXXXXXXXXXXXXTPIQEHSLLVECVIIGFLSTRSGKLLQSA 92
            PL EL  E N QP                        SL+ E +II   +TR+G  L   
Sbjct: 11   PLHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISLL-P 69

Query: 93   LFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNXXXXXXXXXXXXVNADGNIN 152
            LF++                 S    +   + L  +W ++             N    I 
Sbjct: 70   LFSE-----------------SAKRKRVGPRVL--EWHNDEELMLRFFSYILENRSSRIE 110

Query: 153  VDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVMKDTLENGIC 212
               + +  +KLPL FL +    L  + +LD  YNLL DY++   P++K  +      G  
Sbjct: 111  PRLFEKARWKLPLFFLIESKF-LAASMVLDQNYNLLLDYVHTITPMIKRWVHRAFTQGTF 169

Query: 213  L-DLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNATKQ--NNNSNNIPLTMQPSIK----- 264
              D    Y    +L+    WY            A +Q    NS  +  T    ++     
Sbjct: 170  FKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLRENSEQVLDTYHEMVRPSNER 229

Query: 265  -----TXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLL 319
                           + VYSFD+N D + E+ N++SH + RH +L  L+    L  +PLL
Sbjct: 230  AINDTASYHHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRL-PLCDSPLL 288

Query: 320  TLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICF 379
              QF  MAGLVDPL+QPPPN+K +ISL LLY M +GLM P +      +DG +WKFH+CF
Sbjct: 289  QWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTL-GSDGCDWKFHLCF 347

Query: 380  NMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDL 439
            NM K+I  S+  L                            +W+  L+ W+PHG+NTQ+L
Sbjct: 348  NMQKIIQASLKRLNLQDFDTLNSINNSDEDV----------SWRDNLHSWLPHGLNTQNL 397

Query: 440  ELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFS 499
            ELIYMI+I+AVYTIY+LY DLP+Q+NPFLS +I+LWKNL+ +ILLGL+IDR EE  +TF 
Sbjct: 398  ELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFE 457

Query: 500  TPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIR 559
            TP+LVRATIRGAA+LRAVVATILN HVD  +HDF HEPLNTFMSPHGRKLCQGALYAD+R
Sbjct: 458  TPVLVRATIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLR 517

Query: 560  SHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFKDDVEEQEEMEIM 619
            SH                     QAGDRFDED+RYMF+YE D+YN+   + E+  ++ + 
Sbjct: 518  SHAAALLALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNYNEGDSESEKDGKLAVE 577

Query: 620  GS--FPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNLNPHD 677
                  RRCNCIF                            +A   ++  +         
Sbjct: 578  QPKILQRRCNCIFDDDEMAEDEDFDGENDEAFFSKHLILQQNAQTSLSMSS--------- 628

Query: 678  AIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKA 737
                 +  P + RS  +FEFDY GKDWRDIPRG N YYSP + FI+SP + ++  LT KA
Sbjct: 629  -----SGKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKA 683

Query: 738  TNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKIATPDD 797
            ++EKL  ++S  L+ +VASC+K EQD++    L+      H  +  +E+  +     PDD
Sbjct: 684  SSEKLVEKESLTLLRSVASCVKNEQDEITLGNLID----PHQDSQADEESRNADKIEPDD 739

Query: 798  IYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELV 857
            IY+MW E S FE+++Y N  +AW+LMDEML+C GYRRVLIWFITHMELNHSLI YIFELV
Sbjct: 740  IYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIHYIFELV 799

Query: 858  MGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKML 917
            MGLRG+      DE D   DL        +++ + V     + FSRQG L LS IE KML
Sbjct: 800  MGLRGN-----SDENDRDVDLAGP----PLQDVDKVKGELSVGFSRQGALQLSTIETKML 850

Query: 918  LQEFFTNAAIYFSSKSXXXXXXXXXXX----XXIDEEAVNFSVYSTGLVKLICFMVQSLM 973
            LQEFFTNAAI+ S KS                 ++  + N S+Y+ GL+KLICFMV++ +
Sbjct: 851  LQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVRTFI 910

Query: 974  ENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHA 1033
               KFDF++SEC FELQ LLMNWIGIIPEA+ LFF L             +  +  N   
Sbjct: 911  NKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSVQ--EQKNAEV 968

Query: 1034 DNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIE 1093
             N +  D      P        ++   E  FN++L++LLP  + +K+ENAA+ TLR FI+
Sbjct: 969  KNDTQEDVPKEQSP----VRVSNTAGFE--FNRKLMTLLPPLVKNKEENAAMQTLRSFIK 1022

Query: 1094 RYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYL 1131
              SF    PV GRK+VY D+ +LPLP +D P++ HEY+
Sbjct: 1023 TSSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/904 (46%), Positives = 544/904 (60%), Gaps = 84/904 (9%)

Query: 275  QTVYSFDLNTDKTFEL-DNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPL 333
            + VYSFDLN D +  + +N++ +T KRH++LN+L+N+N   ++PLL LQF  M GLVDPL
Sbjct: 395  EKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDPL 454

Query: 334  SQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILK 393
            SQPPPN+K +ISL LLY +FI ++YPN  E F  N GFNWK H+CF MVK+INN M  L 
Sbjct: 455  SQPPPNDKHIISLDLLYQLFIAILYPNF-EIFQNNLGFNWKTHVCFQMVKIINNCMEKLN 513

Query: 394  CDXXXXXXXXXXXXXXXXXXXXXXXXXA---------------WKLKLNEWIPHGINTQD 438
            C+                                         W+  L +W+PHG+NTQD
Sbjct: 514  CNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQD 573

Query: 439  LELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTF 498
            LEL+YM+ I+A YT+ +L  ++PIQ+NPFL  LI LWK L+ I++LGLDIDRSEEA +T+
Sbjct: 574  LELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETY 633

Query: 499  STPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADI 558
             TPLLV+ATIRGA++LR+VVATILNN+++ N+HDFKHE LNTFMSPHGRKLC GALY DI
Sbjct: 634  KTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDI 693

Query: 559  RSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYN-------------- 604
            +                       + GDRFDEDI YMF+YEYDDYN              
Sbjct: 694  KLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTL 753

Query: 605  ---DFKDDVEEQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAI 661
               D   D+    E++ +  + RRCNCIF                               
Sbjct: 754  KSNDDNSDIYVLNEVK-LDRYQRRCNCIFEDDKILQDDDDGNGDEQQ-----------GE 801

Query: 662  EGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHF 721
            +   + TP N  +  D +  RN    + RSK++FEFDY GKDWRDIPRGFN+YYS SY F
Sbjct: 802  QEEQEGTPKNVASFQDPLGKRNLDY-AVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSF 860

Query: 722  IKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLK-----HNTV 776
            I    ++T+  LTSKA+ +KL  +DS  L+  +AS IK EQ+ MI K+LLK     H+ +
Sbjct: 861  IDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNI 920

Query: 777  KHPHA-AENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRV 835
             +P   ++ E +    +ATPDDI+D W ++  F  ML+ N++++WRLMDEMLMCNGYRRV
Sbjct: 921  INPLVNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRV 980

Query: 836  LIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTS 895
            LIW+ITHM+LNHSLIQYIFEL+MGLRGSPF+   +  + KN+LLHE+M G    K+IV +
Sbjct: 981  LIWYITHMKLNHSLIQYIFELLMGLRGSPFA---NNNECKNELLHELMLG----KKIVDN 1033

Query: 896  LTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYF----SSKSXXXXXXXXXXXXXIDEEA 951
             TY PFSRQGPLILS+IE KMLLQEFF+NAAIYF    ++               I+ + 
Sbjct: 1034 HTY-PFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDE 1092

Query: 952  V------NFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAED 1005
            +        S+YS GL+KLIC MV SL+EN KFDF KS+C FELQTLLMNWIGI+ EA++
Sbjct: 1093 IENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKE 1152

Query: 1006 LFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFN 1065
            LFF L               DD   +     S   +G      I + +          FN
Sbjct: 1153 LFFKLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMND---------FN 1203

Query: 1066 KRLVSLL-PKRINDKDENAAVST--LRHFIERYSFDEE-APVYGRKVVYSDEIVLPLPAA 1121
            KRL+ LL P    D D N+   T   R  ++ YSF  +   V GRKVVY+D+ +LPLP  
Sbjct: 1204 KRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPKV 1263

Query: 1122 DQPI 1125
               +
Sbjct: 1264 GHSL 1267

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 83/176 (47%), Gaps = 22/176 (12%)

Query: 66  IQEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYL 125
           +++ S+++E ++I + +T+SG+ + + LF+ K +  T                   ++ L
Sbjct: 111 VKKFSIMLETLVIAYFTTKSGQSILNYLFDTKRKPPT-----------------VQNKIL 153

Query: 126 RKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFL--FDDNTNL-MPTFILD 182
           RK W  N             N +  IN+DK+ EP  KL + FL  F   +N+  P+ ILD
Sbjct: 154 RKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILD 213

Query: 183 NKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFP--YPWYDLLP 236
           + YN+L DY+ A    L  ++K T+ N        I + +   QF   + WY  LP
Sbjct: 214 SNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWYTSLP 269

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/856 (43%), Positives = 522/856 (60%), Gaps = 60/856 (7%)

Query: 292  NVVSHTAKRHRVLNQLINNNDLK----TTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLH 347
            ++++ TAKRH  L++LI ++ L+     +PLL +Q+  +  L+DPL+QP PN+  VIS+ 
Sbjct: 300  DLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISID 359

Query: 348  LLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXX 407
            LL +MF+GLM P +    N +DG +W+FHICFNM ++I  S+ +L C+            
Sbjct: 360  LLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESK 419

Query: 408  XXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPF 467
                          W+ +L+ W+P G+NTQ+LEL+YM  I+AVYTIY+LYSD P+  NPF
Sbjct: 420  D-------------WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPF 466

Query: 468  LSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVD 527
            LS LI+LWK+L+ ++L GL IDR EE+ ++F TP++VRATIRGAA+LR++VAT+LN  ++
Sbjct: 467  LSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQME 526

Query: 528  VNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDR 587
            +  HDF HE LNTFMSPHGRKLC GALYAD++++                     QAGD+
Sbjct: 527  LKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQ 586

Query: 588  FDEDIRYMFDYEYDDYNDFKDDVEEQEEMEIMGSFP---RRCNCIFXXXXXXXXXXXXXX 644
            FDED++YMF+YEY+DYN+  +D   + E      +    RRCNCIF              
Sbjct: 587  FDEDVKYMFEYEYEDYNEIYEDSSNENEENEEIDYAFNKRRCNCIFSDDNLIEEEEDDEE 646

Query: 645  XXXXXXXXXXXXYVDA-IEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKD 703
                         +D  I   +K+     +     +  + S P++ RSKS+FEFDY GKD
Sbjct: 647  ESDVEKTSD----IDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKD 702

Query: 704  WRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQD 763
            WRDIPR +NLYYSP Y+FI  P + T+  LT KAT+EKLT E++ LL+ +VAS +K EQD
Sbjct: 703  WRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQD 762

Query: 764  KMISKELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLM 823
            +MI   LL+ +  K   A E+ED    K ATPDDIY++W EES FER+L+ N D+AW+LM
Sbjct: 763  RMIFGNLLEQD--KSSTADEHEDTK--KEATPDDIYEIWCEESAFERILHFNPDLAWKLM 818

Query: 824  DEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIM 883
            DEMLMC+GYRRVLIWFITHMEL+HSLI YIF+L+MG RG       ++TD+  ++    +
Sbjct: 819  DEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGI------NKTDTSKNVKSTFI 872

Query: 884  YGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXX 943
               + +    ++   L FSR G L LSE+E +M+LQE FTNAAIYFS K+          
Sbjct: 873  TENISD----SNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTP 928

Query: 944  XXXIDEEAV------NFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWI 997
                +EE         +S+YS GL+KLIC MV  L+EN+KF+  +S+C FELQTLLM WI
Sbjct: 929  DYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWI 988

Query: 998  GIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDS 1057
             I+PEA++L F +              S   + +H +N   +     G    S     D 
Sbjct: 989  SILPEAKELSFKI-------------NSSLSEFSHVENSELA--SIEGASTKSHKQLVDK 1033

Query: 1058 PPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLP 1117
                  +N+ L+ L+P     K+EN   +T R +I+ YSFD E     RK+++  + +LP
Sbjct: 1034 NSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILP 1093

Query: 1118 LPAADQPISFHEYLTE 1133
            L  +++P SFH+YLTE
Sbjct: 1094 LQDSEKPFSFHDYLTE 1109

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1082 (37%), Positives = 572/1082 (52%), Gaps = 102/1082 (9%)

Query: 106  NQYKKWLTSTDISKTAHQYLRKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPL 165
            + YK+W  S   S   ++ L K+WS++             N +  +   K+    YKL L
Sbjct: 81   SSYKQWQHSQVRSTDGYKKLVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSL 140

Query: 166  NFLFDDNTN--------------------LMPTFILDNKYNLLQDYIYACGPLLK---CV 202
             FL D                        ++ + +L N   LL+  +Y    L +   C 
Sbjct: 141  IFLLDKQNEFLILDPDYNLLLDYLLHAKPMIESILLGNIPGLLKALVYQYNKLPEFNGCH 200

Query: 203  MKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNATKQNNNSNNI-PLTMQP 261
               T            +K  I L   +     + P  EG       + +S  I P+T   
Sbjct: 201  TWYTFRTHYHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDD 260

Query: 262  SIKTXX----------XXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNN 311
               +                   + VYSF+LN D T E+ NV +HT +RH  L +++  N
Sbjct: 261  YTSSAAIDDFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLN 320

Query: 312  DLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNL-KECFNANDG 370
            D   TPLL   F     L DP++QPPPN+K ++SL LL  MF+GLMYP +  +     + 
Sbjct: 321  D-DPTPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNK 379

Query: 371  FNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWI 430
              W  HICFN+ K+IN ++  L CD                          W+  L +W+
Sbjct: 380  DTWTLHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVD----------WRKNLYKWL 429

Query: 431  PHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDR 490
            P G+NTQDLELIYM++I+A YTIY+LYS+ PIQMNPFL  +I+LWKNL+ ++LLGL+IDR
Sbjct: 430  PQGLNTQDLELIYMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDR 489

Query: 491  SEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLC 550
             EE ++TF+TP++VRATIRGA++LR+V+ATI+N H     HDFKHEP+N FMSPHGRKLC
Sbjct: 490  LEEEQETFNTPVMVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLC 549

Query: 551  QGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFK--- 607
             GALYAD+RSH                     Q GDRFDED++YMFDYE+DDYN+     
Sbjct: 550  NGALYADLRSHAATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTEL 609

Query: 608  ------DDVEEQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAI 661
                  +D+E +E ++ +  + +RC+C+F                               
Sbjct: 610  MADDELEDIESRERIKEVRGYYKRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHL----- 664

Query: 662  EGVTKDTPHNNLNP-HDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYH 720
                +D+  + L P  + + +  S P + RS+ + EFD+ G+DWRDIPRG N YY+ +Y 
Sbjct: 665  ----QDSHEDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYI 720

Query: 721  FIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPH 780
            F+     + +  L  +AT +KL    ++ ++ ++A+C+KLEQ++ I +  L +       
Sbjct: 721  FVTKLHADVVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSS 780

Query: 781  AA-----ENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRV 835
             A     ENE  +DF       IY+ W E+S FE+M+Y N D+ WR+MDEMLMC+GYRRV
Sbjct: 781  NATTIKTENELTSDF-------IYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRV 833

Query: 836  LIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKN-DLLHEIMYGQVKNKEIVT 894
            LIWFITH+E+NHS+I YIFELVMGLRG+  + E DE  SKN D L  +  G        T
Sbjct: 834  LIWFITHLEINHSVIHYIFELVMGLRGN-ITYEDDEEKSKNLDALDGLAQGS------ST 886

Query: 895  SLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXXXXXIDEEAVNF 954
            S   LPFSRQGP+ILS IE  MLLQEFFTNAAI+FSSK                E+   F
Sbjct: 887  SELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEF 946

Query: 955  SV--YSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLXX 1012
            SV  +  GL+KL+CFMV +LM+  KFDF  SE  FELQTLLMNWIGI+PEA DLFF L  
Sbjct: 947  SVPPHVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKS 1006

Query: 1013 XXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLL 1072
                       +      +  D+             I   DT +     S  NK+L+ L+
Sbjct: 1007 QIVATSQDTQEQGTPVKESEKDD-------------IDAPDTLEMNDTMSEHNKKLMMLI 1053

Query: 1073 PKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLT 1132
            P      +E  A++ LR FI +YS   +  V+GRK++Y D+ ++ +   D+ + + E+L 
Sbjct: 1054 PP--GTTNERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLA 1111

Query: 1133 EL 1134
            E 
Sbjct: 1112 EF 1113

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1130 (37%), Positives = 592/1130 (52%), Gaps = 157/1130 (13%)

Query: 67   QEHSLLVECVIIGFLSTRSGKLLQS------ALFNDKHQQDTFLENQYKKWLTSTDISKT 120
            Q  SLL ECV+  F + R   + Q        +F+        ++     W T   +SK 
Sbjct: 7    QFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAW-TEEALSKY 65

Query: 121  AHQYLRKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI 180
             H + +  W                +A     + +Y EP +KL ++ LF    +     +
Sbjct: 66   IHLFFQHVWR---------------DAGDRFAIMQYNEPAFKLQVSDLFPSEFS-KARLV 109

Query: 181  LDNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDL------ 234
            L+  Y++L D++    P LK +++  ++  +   +   Y    +    + W++L      
Sbjct: 110  LNTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFA 169

Query: 235  ----------LPPMHEGHLNATKQNNNSNNIPL-----TMQPSIKTXXXXXXXXXQTVYS 279
                       P +   ++N+       +  PL      +               + VY 
Sbjct: 170  NRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYE 229

Query: 280  FDLNTD-------KTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDP 332
            FDL+ +       +T  +D ++  + +RH +L +++N  ++ + P L  QF  M  LVDP
Sbjct: 230  FDLDEETHNGSGNRTVAVD-LMQQSNQRHEILTRMLNLKEIDS-PHLYEQFKCMISLVDP 287

Query: 333  LSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVIL 392
            L+QPPP++  V+SL LLY +F+  + P      N +   N  F +CFNM K+I  ++  L
Sbjct: 288  LTQPPPSDTYVVSLDLLYKLFLAFL-PK-----NQDTEQNDTFLLCFNMQKIITRTLWRL 341

Query: 393  KCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYT 452
            KC                           ++  L EW+P+G+NTQDLEL+YM++IMAVYT
Sbjct: 342  KC-----WDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYT 396

Query: 453  IYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAA 512
            IY  YS LPIQ+NPFLS LI+LWKNLSA++LL L++DR EEA  TF TPLLVRATIRGA+
Sbjct: 397  IYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGAS 456

Query: 513  SLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXX 572
            +LRAVVA +LN HV  NEHDFKHEPLNTFMSPHGRKLCQG+LYAD+RSH           
Sbjct: 457  ALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDL 516

Query: 573  XXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYN--DFKDDVEEQEEMEIM----------- 619
                      Q GDRFDEDIRYMF+YEY+DYN  DF+D+ E+                  
Sbjct: 517  EDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATASAAAITAA 576

Query: 620  -----GSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNLN 674
                  S  RRCNCIF                                  T D    +  
Sbjct: 577  NEGTGASQKRRCNCIF----------------------------------TDDKIIQSDE 602

Query: 675  PHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLT 734
               ++    + P S R+KSSFEFDY G DWRD+PRG NLY+ PSY F+  P +     ++
Sbjct: 603  SKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVS 662

Query: 735  SKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKIAT 794
            SKA   KL   +S  L+  VAS IK+EQ+ +I   +       +P   E     D  + T
Sbjct: 663  SKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTV-------YPQT-EGIAVGDDGLLT 714

Query: 795  PDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIF 854
            PD+IYD W ++  F+R+L++NQ++AW+LMDE+LMC+GYRRVL+WF+THMELNHS+I YIF
Sbjct: 715  PDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIF 774

Query: 855  ELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIEN 914
            ELVMGLRG   S +    + +   LH +M     N         L FSRQG L LSEIE 
Sbjct: 775  ELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT------LMFSRQGNLALSEIEV 828

Query: 915  KMLLQEFFTNAAIYFSSKSXXXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLME 974
            KMLLQEFFTNAAI+ S+                  E  + S+YS GLVKLICFMV++L+ 
Sbjct: 829  KMLLQEFFTNAAIFLSASESEEPE----------SETSDVSLYSIGLVKLICFMVKTLIV 878

Query: 975  NNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHAD 1034
            N+KF+F+KSECTFELQTLLMNW+GI+P+A++LFF L            +   D       
Sbjct: 879  NHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLL-----------KKNISDTKTATTT 927

Query: 1035 NLSFSDDGDTG--HPGISRFDTDDSPPNESI--FNKRLVSLLPKRIND--KDENAAVSTL 1088
              + S  G  G   P ++  D D++   E++  FNK+LV LLP+      K  + A+  L
Sbjct: 928  TTTTSALGAPGDIFPTLTDADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDAL 987

Query: 1089 RHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTELDDEI 1138
            R+F+ ++S   E PV GR++V     +LP    ++ ++  EYL   D  +
Sbjct: 988  RNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYLGSYDGAV 1037

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1195 (35%), Positives = 597/1195 (49%), Gaps = 183/1195 (15%)

Query: 70   SLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLR--- 126
            +L+ E V++    TRSG  +   L++    +    E  YK+ L      ++ H Y +   
Sbjct: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTE--YKQSLKV----RSNHSYWKSCY 99

Query: 127  KKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYN 186
            K W S              N +  ++  +Y     KLPL FL  +   L P +++D++YN
Sbjct: 100  KDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEP--LRP-YLIDDEYN 156

Query: 187  LLQDYIYACGPLLKCVMKDTLENGICLDLPGI---YKLDIDLQFPYPWY----------- 232
            LL DY+    P+ + +    L  GI   LP +   Y    +    Y WY           
Sbjct: 157  LLLDYMIQSRPMWEML----LTQGIPKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQVQ 212

Query: 233  ----------------------DLLPPM------HEGHLNATKQNNNSNNIPLTMQPSIK 264
                                  +LLP +      H    + TKQ     +          
Sbjct: 213  SSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTLLDLSNDDDDHYDQD 272

Query: 265  TXXXXXXXXXQTVYS------FDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPL 318
                      Q + S      FDLN D T E  NV  H  KRH +L +++   D +  PL
Sbjct: 273  VDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAE-GPL 331

Query: 319  LTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHIC 378
            L  QF  +A LVDP++QPPP    +IS+ L++ MF+G    NL E    + G +W+FH+C
Sbjct: 332  LKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGST-SNLIENMLISRGRDWRFHVC 390

Query: 379  FNMVKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQD 438
            +NM K++  +M  L C                           W + L++W P G+NTQD
Sbjct: 391  YNMQKIVLATMKRLNC----------HDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQD 440

Query: 439  LELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTF 498
            LEL+YM++++++Y +Y+LYS LP+QMNPFL   + LWKNL+ ++L GL+IDR EE R+TF
Sbjct: 441  LELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETF 500

Query: 499  STPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADI 558
            +TP++VRA IRG A+LR+VVAT++N+H    EHDFKHEP+N FMSPHGRKLC GALYAD+
Sbjct: 501  NTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADV 560

Query: 559  RSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFK----------- 607
            RSH                     Q GDRFD+D++YMFDYEYDDYN              
Sbjct: 561  RSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEED 620

Query: 608  ----DDVEEQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEG 663
                ++++++E ++ M  + +RC+C+F                            D  EG
Sbjct: 621  LERLEEIQQRERIKDMRGYYKRCHCVFDDDELLS---------------------DEEEG 659

Query: 664  VTK----DTP---HNNLN-PHDAIRTRNSHPNSK----RSKSSFEFDYGGKDWRDIPRGF 711
             T     D P   HN+LN P   + T  + PNS+    RS+   +FD+ GKDWRDIPRG 
Sbjct: 660  ETASSNIDRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGL 719

Query: 712  NLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELL 771
            N YY+  Y F+     + +  L  +AT +K+    ++ ++ ++A+CIKLEQ+K +  +++
Sbjct: 720  NFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVM 779

Query: 772  KHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNG 831
               T K   +  N D  +    T D IY+ W EES F +M+Y N D+ WR+MDEMLMC+G
Sbjct: 780  NGRTDKGSSSNSNSDRVN--ELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSG 837

Query: 832  YRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKE 891
            YRRVLIWFITH+E++HSLI YIFELVMG+RG+    E  E D KN  L +I+        
Sbjct: 838  YRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNL-DILDSLSLGSS 896

Query: 892  IVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFS----------------SKSXX 935
             VT    +PFSRQGP+ILS IE  MLL EFF NA IYFS                S++  
Sbjct: 897  SVT--IKIPFSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEG 954

Query: 936  XXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMN 995
                        D++ +  S +  GL+KL+CFMV  LME  KFDF  SE  FELQTLLMN
Sbjct: 955  SDDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMN 1014

Query: 996  WIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTH----ADNLSFSDDGDTGHPGISR 1051
            WIGIIPEA +LFF L                D   T       + S   +G+     I  
Sbjct: 1015 WIGIIPEARNLFFKLKSSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVN 1074

Query: 1052 FDTDDS----------PP----------------------NESIFNKRLVSLLPKRINDK 1079
             D +D           PP                      N S +NK L+ LLP  ++  
Sbjct: 1075 IDREDHLENCLSDADFPPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVD-- 1132

Query: 1080 DENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134
            +EN AV+ LR FI ++S   +  V+GR+V+Y D  ++ L  AD+ +   E+L E 
Sbjct: 1133 NENTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEF 1187

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1175 (35%), Positives = 588/1175 (50%), Gaps = 159/1175 (13%)

Query: 71   LLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQY--LRKK 128
            ++VE V++    TR G  +   L++    +     ++Y++   S  +    HQ+    K+
Sbjct: 47   MIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKL--SEYRQ---SLKVRSNVHQWKTCYKE 101

Query: 129  WSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLL 188
            W S              N D  ++  +Y   + KLPL FL       +  ++LD  YNLL
Sbjct: 102  WGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAG---LHAYVLDEGYNLL 158

Query: 189  QDYIYACGPLLKCVMKDTLENGICLDLPGI---YKLDIDLQFPYPWY------------- 232
             DYI       + + ++ L  GI   LP +   Y    +    Y WY             
Sbjct: 159  LDYIINS----RLMWEELLIQGIPRLLPELIEDYNRVFEFNGYYTWYGGAPSGAGAANST 214

Query: 233  -------------------DLLP------------PMHEGHLNATKQNNNSNNIPLTMQP 261
                               +LLP            PM+  H      N   +      + 
Sbjct: 215  RELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINEFSNEEEDLYDFDSEL 274

Query: 262  SIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTL 321
               +         + VY+F+LN D + E  NV  HT +RH  L +++   + +  PLL  
Sbjct: 275  EGDSWPQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYRILGLPN-RECPLLRA 333

Query: 322  QFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNM 381
            QF  +  LVDP++QPPP  K +IS+ L+Y MF+G +   L+      D   W+FH+C N+
Sbjct: 334  QFMTLCALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRGQD---WRFHVCHNL 390

Query: 382  VKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLEL 441
             K+I  +M  L C                           W + + +W P G+NTQDLEL
Sbjct: 391  QKIILATMKRLNCHDSEVLNSINNSDETVH----------WNVNIGKWTPRGLNTQDLEL 440

Query: 442  IYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTP 501
            +YM++++ +YTIYQLYSDLP+QMNPFL     LWKNL+ ++LLGL+IDR EE R+TFSTP
Sbjct: 441  LYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETFSTP 500

Query: 502  LLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSH 561
            ++VRATIRG+A+LR+VVAT++N+H  + EHDFKHEP+N FMSPHGRKLCQGALYAD+RSH
Sbjct: 501  IIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADVRSH 560

Query: 562  XXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFK-------------- 607
                                 Q GDRFD+D++YMFDYEYDDYN                 
Sbjct: 561  AAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLER 620

Query: 608  -DDVEEQEEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTK 666
             ++++++E ++ M  + +RC+C+F                                 +T+
Sbjct: 621  LEEIQQRERIKDMRGYYKRCHCVFDDDELLSDEEGTDTGEHTDNH------------ITE 668

Query: 667  DTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPM 726
                  LN    + T      + RS+   EFD+ GKDWRDIPRG N YY   Y F+    
Sbjct: 669  TVQSAPLNLVTGVSTSGPQKVAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLH 728

Query: 727  METISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENED 786
             + +  L  +AT++KL +  S+ ++ +VA+CIKLEQ+K +  + +  +  K P +A   +
Sbjct: 729  ADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSE 788

Query: 787  DADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELN 846
             ++    T D IY+ W E++ FE+M+Y N D+ WR+MDEMLMC+GYRRVLIWFITH+EL+
Sbjct: 789  GSNG--LTSDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELS 846

Query: 847  HSLIQYIFELVMGLRGSPFSGEGDETDSKN---DLLHEIMYGQVKNKEIVTSLTYLPFSR 903
            HS+I YIFELVMG+RG+    + +E    N   DLL     G   +  I  S   +PFSR
Sbjct: 847  HSVIHYIFELVMGMRGNVAYKDLEEEYIINRNLDLLDSFSLG---SSCIPAS---IPFSR 900

Query: 904  QGPLILSEIENKMLLQEFFTNAAIYFSS---------------KSXXXXXXXXXXXXXID 948
            QGP++LS IE  MLLQEFF NAAIYFS+                              I 
Sbjct: 901  QGPIVLSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIA 960

Query: 949  EEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFF 1008
            +E +  S +  GL+KL+CFMV  L+E  K DF  SE  FELQTLLMNWIG++PEA  LFF
Sbjct: 961  DERLTASSHVLGLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFF 1020

Query: 1009 TLXXXXXXXXXXXXR---------ESDDHDNTHA----------------DNLSFSDDG- 1042
             L                       S+D+D++                  D L   D G 
Sbjct: 1021 KLKSTLLNSSALNGSALSHLEGELASNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGA 1080

Query: 1043 -DTGHPGISRFDTDD--SPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDE 1099
               G P  +     +  S  N S  N+ L+ LLP   +  DENAAV+ LR FI ++    
Sbjct: 1081 LTNGQPTSAANSAPNGMSESNISYCNQMLIKLLPP--HSADENAAVTALRSFIAKHPLTT 1138

Query: 1100 EAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134
            +  ++GR+V+Y D  ++ L  AD+ +   E+L E 
Sbjct: 1139 KTAIFGRRVIYQDNAIMGLYMADKELQQREFLAEF 1173

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1117 (35%), Positives = 585/1117 (52%), Gaps = 129/1117 (11%)

Query: 74   ECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTST--DISKTAHQYLRKKWSS 131
            E +++G  +TR G       +     +   L  +YKKW  S    +S  A++ + K+W+S
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLL--RYKKWQQSKPQRVSDAAYKRMVKRWTS 108

Query: 132  NXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDY 191
            +             N +  ++   +  P +KL + FL D  T ++   ++D++YNLL D+
Sbjct: 109  STEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVL---VIDDEYNLLLDF 165

Query: 192  IYACGPLLKCVM----------KDTLENGICLDLPGIY--------KLDIDLQFPYPWY- 232
               C  L++ ++          K    +G    L G Y        + D      Y +  
Sbjct: 166  ALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKYLS 225

Query: 233  ----------DLLP---PMHEGHLNATKQNNNSNNIPLTMQPSIKTXX------XXXXXX 273
                      DL+P   P+ E   ++   +    +   T  P   +              
Sbjct: 226  VLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQKRLSA 285

Query: 274  XQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPL 333
             + VYSFDL  D T E  NV + T +RH+ L Q++N     T PLL+ QF  +  LVDP+
Sbjct: 286  QERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCALVDPV 345

Query: 334  SQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILK 393
            +QP PN+  ++S+ LL  MF+GL+Y  + E        +W+FH+CFN+ K++  ++  L 
Sbjct: 346  TQPTPNDSHIVSIDLLSDMFLGLLYSEINELH-----IDWRFHVCFNLQKIVQATLPRLN 400

Query: 394  CDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTI 453
            C                           W+  L++W+P G+NTQDLELIYMI+I+A+Y I
Sbjct: 401  CHDFQRLNSVNNSDDSID----------WRRNLHKWLPQGLNTQDLELIYMIDILAIYII 450

Query: 454  YQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAAS 513
            ++LY DLP QMNPFL+ +I+LWKNL+ ++LLGL+IDR EE ++TFSTP+LVRA IRG+++
Sbjct: 451  HKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSA 510

Query: 514  LRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXX 573
            LR+VVATILN HV+   HDF+HEP+N FMSPHGRKLC GALY D+RSH            
Sbjct: 511  LRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELE 570

Query: 574  XXXXXXXXXQAGDRFDEDIRYMFDYEYDDYN---------DFKDDVEEQEEMEIMGSFPR 624
                     Q GDRFDED++YMFDYEYD+YN         D  +DVE +E ++ M ++ +
Sbjct: 571  DVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMRAYYK 630

Query: 625  RCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNLNPHDAIRTRNS 684
            RC+C F                                 VT+D P +N    +   +  S
Sbjct: 631  RCHCQFDDDELLPEDEEDGRPDASPYR------------VTRDAPPDN----NVKLSNTS 674

Query: 685  HPNSKRS-KSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLT 743
             P + RS K S EFD+ G+DWR IPRG N Y++ +Y F K        +L   A  +KL 
Sbjct: 675  KPMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLP 734

Query: 744  TEDSTLLITAVASCIKLEQD-KMISKELLKHNTVKHPHAAENEDDADFKIATPDDIYDMW 802
             E+ T L+  +A+C+  EQ+  ++   LL   T +  + +    D D    T D +Y+ W
Sbjct: 735  LEEGTQLLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVADGDL---TTDFVYEKW 791

Query: 803  SEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRG 862
             E S FE++L+ N+ + WR+MDEMLMC+GYRRVLIWFITH+E+++S+I+YI+ LV+G RG
Sbjct: 792  CENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG 851

Query: 863  SPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFF 922
               + +GD             Y +V            PFSRQG ++LS+IE KMLLQEFF
Sbjct: 852  EKAASDGD-------------YAKV------------PFSRQGAIVLSDIEIKMLLQEFF 886

Query: 923  TNAAIYFSSK-SXXXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFA 981
            TNAAI+FS +                DE+    S +  GL+KL+C+MV+SLM+   FDF 
Sbjct: 887  TNAAIFFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFK 946

Query: 982  KSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDD 1041
              +  FELQTLLM+WI I+PEA DLFF L             ES+          S  + 
Sbjct: 947  DPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESE-------SIASACEP 999

Query: 1042 GDTGHPGISRFDTDDSPPNE----SIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSF 1097
                 P + +    +  P      SI+NK+L+SLLP       EN+A++ LR FI ++S 
Sbjct: 1000 DSQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLPPAAG--TENSAITALRSFISKHSL 1057

Query: 1098 DEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134
              +  ++GR+V+  D+ ++P+  +D+ +   ++L E 
Sbjct: 1058 TTKTALFGRRVISQDDTIMPMYMSDREMDNRQFLAEF 1094

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1133 (34%), Positives = 584/1133 (51%), Gaps = 164/1133 (14%)

Query: 74   ECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTST--DISKTAHQYLRKKWSS 131
            E ++IG  +T+ G  +    +     +   L  +YKKW  S    +    ++ L KKW+ 
Sbjct: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLL--RYKKWQQSKFQSLPDAVYKKLVKKWTG 105

Query: 132  NXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDY 191
            +             N   +++   +    YKL + FL D +T L+   I+D++YNLL D+
Sbjct: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTELL---IIDDEYNLLLDF 162

Query: 192  IYAC----------GPLLKCVMKDTLENGICLDLPGIYKLDI----------DLQFPY-- 229
            +               L   + K  L +     L G Y              D+ + Y  
Sbjct: 163  LLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAEAQDICYKYLS 222

Query: 230  -----------------PWYDLLPPMHEGHLNA----------TKQNNNSNNIPLTMQPS 262
                             P +D +      HL+           +  N++S++ P      
Sbjct: 223  VLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWP------ 276

Query: 263  IKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQ 322
                        + +YSFDL  D T E  NV   T +RH+ L Q++      ++P L  Q
Sbjct: 277  -----QKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQ 331

Query: 323  FTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMV 382
            F  +  LVDP++QP PN+  +IS+ LL  MFIGL++  +K+       FNW+FHICFN+ 
Sbjct: 332  FFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQL-----PFNWRFHICFNLQ 386

Query: 383  KLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELI 442
            K++ +++  L C                           W+  L++W+P G+NTQDLEL+
Sbjct: 387  KILQSTLPRLNCHDFQQLNSVNNSDDSID----------WRRNLHKWLPQGLNTQDLELV 436

Query: 443  YMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPL 502
            YMI+I+A+Y I++LY D P+QMNPFL+ +I+LWKNL+ ++LLGL+IDR EE ++TFSTP+
Sbjct: 437  YMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPV 496

Query: 503  LVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHX 562
            LVRA IRG+++LR+VVAT+LN HV+   HDF+HEP+N FMSPHGRKLC GALY D+RSH 
Sbjct: 497  LVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHA 556

Query: 563  XXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDF---------KDDVEEQ 613
                                Q GDRFDED++YMFDYEYD+YN+           +DVE +
Sbjct: 557  AAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELEDVESR 616

Query: 614  EEMEIMGSFPRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNL 673
            E ++ M ++ +RC+C F                                 ++K+ P    
Sbjct: 617  ERIKEMRAYYKRCHCQFDDDELLPEEEEESGIPISHTR------------ISKELP---- 660

Query: 674  NPHDAIRTRN-SHPNSKRSKS-SFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETIS 731
             P   ++  N + P + R+K  + EFD+ G+DWRDIPRG N Y++ +Y F KS       
Sbjct: 661  -PDTNVKLSNTAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAH 719

Query: 732  TLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENED----- 786
            TL + A   +L+ E++  L+  V++C+  EQ+         H  ++   AA++       
Sbjct: 720  TLMNSAAERQLSKEEAVHLLRLVSTCVAKEQE---------HTVLRSAFAADDSQALSCQ 770

Query: 787  -----DADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFIT 841
                 D D    T D IY+ W ++S F++ML+ N+ + WR+MDEMLMC+GYRRVLIWFIT
Sbjct: 771  STLVADGDL---TTDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFIT 827

Query: 842  HMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPF 901
            H+E+  S+I+YI+ LVMG RG   + E            E  +G+            LPF
Sbjct: 828  HLEVTSSMIEYIYSLVMGNRGEKLANE------------ETPFGK------------LPF 863

Query: 902  SRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXXXXXXXXIDEEAVNFSVYSTGL 961
            SRQG ++LSEIE KMLLQEFFTNAAI+FS +               + E +  S Y  GL
Sbjct: 864  SRQGDIVLSEIEIKMLLQEFFTNAAIFFSKQ----LRESLGDEEEEETENLGISPYIVGL 919

Query: 962  VKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXX 1021
            ++L+CFMV+SL++   FDF   +  FEL+TLLM+WI I+PEA DLFF L           
Sbjct: 920  MRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQSRKP 979

Query: 1022 XRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKDE 1081
             +   D   T A  ++ S D  T        D++++  + SI+NK+L+SLLP  +    E
Sbjct: 980  AKRDPDAMAT-ASVVNLSPDFRTTDENDGSSDSEET-NSVSIYNKKLISLLPPVVG--TE 1035

Query: 1082 NAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134
            N AV+ LR FI ++S      V+GR+V+  D+ ++ +  +D+ I    +L E 
Sbjct: 1036 NTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEF 1088

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1224 (35%), Positives = 602/1224 (49%), Gaps = 223/1224 (18%)

Query: 91   SALFNDKHQQDTFLENQYKKWLTSTD--------ISKTAHQ-YLRKKWSSNXXXXXXXXX 141
            +A  + KH +D  L+    +  T+T         + K AH   L +KW ++         
Sbjct: 86   TAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTK 145

Query: 142  XXXVNADGNINVDKYTEPIYKLPLNFLF--------DDNTNLMP-------TFILDNKYN 186
                N++  +N + + +P+ KLPL FL         D+N            T ++D  YN
Sbjct: 146  FILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYN 205

Query: 187  LLQDYIYAC------------GPLL------------------KCV------MKDTLENG 210
            LL DY++               PLL                  KC+       KDT   G
Sbjct: 206  LLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFG 265

Query: 211  I---CLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNATKQNNNSNNIPLTMQPSIKTXX 267
                C+D+   +    D+   +  + L   +     N +  +   +N+    + +     
Sbjct: 266  TITNCIDIINNFLEIFDM---HKNFTLNAEISNSLFNISSSSTTKSNMHNENEGADLNLL 322

Query: 268  XXXXXXXQTVYSFDL---NTDKTFELDNVVSHTAKRHRVLNQLIN---NNDLKTTPLLTL 321
                   +   SF+L   N +      ++++H +KRH +L +++N   N+    +PLL L
Sbjct: 323  MDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHL 382

Query: 322  QFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNM 381
            QF  +  LVDPL+QP PN+K +IS+ LL+ +F+G + P L    +A DG NWKF +CFNM
Sbjct: 383  QFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNM 442

Query: 382  VKLINNSMVILKCDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLEL 441
             K+IN+ M  L C                           W+ +L++W+P G NTQDLEL
Sbjct: 443  EKIINSVMKKLNC----------VDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLEL 492

Query: 442  IYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTP 501
            +YM+NI+A YTIY+L  DLPIQ+NPFLS +++ WKNLS  ILLGL+IDR EE  +TF TP
Sbjct: 493  LYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTP 552

Query: 502  LLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSH 561
            L+VRAT+R + +LR+++ATILN HV+   HDFKHE LNTFMSP+GRKLC GALY D RSH
Sbjct: 553  LIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSH 612

Query: 562  XXXXXXXXXXXXXXXXXXXXXQAGDRFDEDIRYMFDYEYDDYN----------------- 604
                                 Q GDRFDED++YMF  E++DYN                 
Sbjct: 613  ASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTLPNVLGGEDDETSTDT 670

Query: 605  -------------DFKDDVEEQEEMEIMGSFP---------RRCNCIFXXXXXXXXXXXX 642
                         +F  D EE +E EI              RRCNCIF            
Sbjct: 671  LKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTSISD 730

Query: 643  XXXXXXXXXXXXXXYV--------------------------DAIEGVTKDTPHN----- 671
                           +                            IE +TKD   +     
Sbjct: 731  KNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMES 790

Query: 672  ----NLNPHDAIRTRN-----SHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFI 722
                  N   A+RT N     S  N+K +++ F+FDY GKDWRD PRG NLYY+ +Y FI
Sbjct: 791  LRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNYEFI 850

Query: 723  KSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDKMI---------SKELLKH 773
            + P ++ +  LT KATN KL  +DS LL+  VAS +K EQD++I          KE+++ 
Sbjct: 851  EKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQ 910

Query: 774  N-----TVKHPHAAENEDDADFK----IATPDDIYDMWSEESKFERMLYLNQDVAWRLMD 824
            N       K PH     ++ + K      TPDDIY++W EES FERM+ LN +V +RLMD
Sbjct: 911  NEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMD 970

Query: 825  EMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMY 884
            EMLMC GYRRVLIWFITH+EL+HS+I YIFELVMG RG+  S E   T+ K    H    
Sbjct: 971  EMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGT--SEENGATEDK----HTNTK 1024

Query: 885  GQVKNKEIVTSLTY---------------LPFSRQGPLILSEIENKMLLQEFFTNAAIYF 929
            G V   E                      LPFSRQG + LSEIE KML+QEF TNAAI+F
Sbjct: 1025 GNVNELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHF 1084

Query: 930  SSKSXXXXXXXXXXXXXI-------DEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAK 982
            + ++                     DE+    S+YS GL++LICFM+Q+ ++NNK     
Sbjct: 1085 NERNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEV 1144

Query: 983  SECTFELQTLLMNWIGIIPEAEDLFFTLXXXXX------XXXXXXXRESDDHDNTHADNL 1036
             +  FELQTLLMNWI IIPEA+ LFF +                      D DN   +N 
Sbjct: 1145 DDSIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQ 1204

Query: 1037 SFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRIN-DKDENAAVSTLRHFIERY 1095
            +  D+ D       + D      + S FNK+L+ L PK  + +K+EN A+ TL+++++++
Sbjct: 1205 TSKDNND-------KMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKF 1257

Query: 1096 SFDEEAPVYGRKVVYSDEIVLPLP 1119
             F +E P+ GRKV+Y D  +L +P
Sbjct: 1258 RFHQEVPIIGRKVIYEDGKILKIP 1281

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  553 bits (1425), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 336/870 (38%), Positives = 466/870 (53%), Gaps = 89/870 (10%)

Query: 275  QTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKT-TPLLTLQFTFMAGLVDPL 333
            + + SFD+N +   E+ N++  +  RH +L + +  +   T  P L +QF  +AGLVDPL
Sbjct: 357  EVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVDPL 416

Query: 334  SQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILK 393
            +QP PN+  +IS+ LL+ ++ GL++P L +   A + ++WK+   FN++K++  S+  L 
Sbjct: 417  TQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARN-YDWKYLCGFNLIKIVWKSLKKLH 475

Query: 394  CDXXXXXXXXXXXXXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTI 453
            C                           W+  L  WIP  +NTQDLEL+YMI+I++VY I
Sbjct: 476  CSSYDTLNNIGNFEEGND----------WRQTLEYWIPKNLNTQDLELLYMIDILSVYAI 525

Query: 454  YQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAAS 513
            Y+LY D PIQ NPFL  L ++WK ++ II LGL +DR EE   +  TPL++RAT+RGA++
Sbjct: 526  YKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRATVRGASA 585

Query: 514  LRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXX 573
             RA + TILN  ++ NEHDFKHEP+NTFMSPHGRKLC G+LYAD+R              
Sbjct: 586  FRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRVSTKIFVENGVELD 645

Query: 574  XXXXXXXXXQAGDRFDEDIRYMFDYEYDDYNDFKD--DVEEQEEMEIMGSFP----RRCN 627
                     Q GDRFDED+ YMFDYEY+DYN   D  D++E+ + E  G  P    RRCN
Sbjct: 646  DITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDEKADNESDGVRPAPIFRRCN 705

Query: 628  CIFXXXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPHNNL----NPHDAIR-TR 682
            C+F                           +D    +T     NN     + +D I+   
Sbjct: 706  CVFEDDKIMDEST-----------------IDHQSLITDMELENNAISTKDENDKIKIIS 748

Query: 683  NSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKL 742
               P + R +S F+F+YGGKDWRDIPRG NLYY+  + F++       ++  SKA N  L
Sbjct: 749  QPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKAVNSVL 808

Query: 743  TTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKIATPDDIYDMW 802
               +S  LI  VASCI+ EQD+M+    + H   + P A     D +    T D+IYD  
Sbjct: 809  DISESNRLIQLVASCIREEQDRMV----IYHGMSQLPLA---NGDVNKSKLTVDEIYDQI 861

Query: 803  SEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRG 862
            S  + F +MLY + ++A  LMDE+LM  GYRRVLIWF+TH+ +   LI YIFELVMG R 
Sbjct: 862  SSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHYIFELVMGYRV 921

Query: 863  SPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFF 922
                G+ +  ++K                  +S     FSR G + LS IE +MLLQEFF
Sbjct: 922  GFSDGDANGDNNKK-----------------SSTGKCGFSRLGTVALSSIEKQMLLQEFF 964

Query: 923  TNAAIYFSSKS-XXXXXXXXXXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFA 981
             NA +  S+KS               DE+    S Y+ G+V LIC MV++L+   + D +
Sbjct: 965  LNATVSLSAKSFESNGTEIDNYDDNADEDNEYISSYAVGIVTLICNMVKTLVRAGQMDVS 1024

Query: 982  KSECTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLS-FSD 1040
            KSE T ELQTLL+NWI +IPEA++LFF L             E D  D+    N S    
Sbjct: 1025 KSEYTVELQTLLVNWISLIPEAKELFFFL--------KQEAHEFDIQDSLEPINESELQT 1076

Query: 1041 DGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPKRINDKDENA--AVSTLRHFIERYSFD 1098
             G+   P  +     DS P +   N  L S      + K+ NA  A+ST    +E  S  
Sbjct: 1077 SGNINEPAAT-----DSIPLDDTINTSLTS------STKNSNATDALSTFLETVEETSV- 1124

Query: 1099 EEAPVYGRKVVYSDEIVLPLPAADQPISFH 1128
             + P  GRKV+Y    +LPLP  ++PI FH
Sbjct: 1125 -QPPQIGRKVIYKGTKILPLPEQERPIPFH 1153

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 1/92 (1%)

Query: 121 AHQYLRKKWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFD-DNTNLMPTF 179
           A+++L+  W                N + +I++  Y +  YK PL FL    N N+   F
Sbjct: 160 AYEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRF 219

Query: 180 ILDNKYNLLQDYIYACGPLLKCVMKDTLENGI 211
           +L  ++N+L++Y+YA    +K  +   +++ I
Sbjct: 220 LLSEEFNILEEYLYAAQSNIKSKIAIAIQSTI 251

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  520 bits (1340), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 309/851 (36%), Positives = 455/851 (53%), Gaps = 94/851 (11%)

Query: 297  TAKRHRVLNQLINNNDLK-----TTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYS 351
            T +R  +L +++  + LK     +  L++L F  +  LVDPL+QP PN++ VISL LLY 
Sbjct: 285  TERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYK 344

Query: 352  MFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXXXXXXX 411
            +F+ +M P+++        ++W++ I  N+ K++  + + L C                 
Sbjct: 345  IFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNC-------------YDME 391

Query: 412  XXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCL 471
                      WK +L+ W+PHG+N Q+LEL+YMI I  VY I++LY D P+  NPFL  L
Sbjct: 392  KLNKVDETKHWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTL 451

Query: 472  ITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEH 531
            ++ WK L+ ++L GL +DR EE  ++F+TP++VRATIRGA++LR+VVA+ILNN +D  +H
Sbjct: 452  LSTWKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKH 511

Query: 532  DFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGDRFDED 591
            DF+HEPLNTFMSPHGRKLC GALYAD++S+                     Q GD FDED
Sbjct: 512  DFQHEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDED 571

Query: 592  IRYMFDYEYDDYNDFKDDV------EEQEEMEIMGSF-PRRCNCIFXXXXXXXXXXXXXX 644
            ++YMF+YEYDDYN+ ++D           E  I  +F  RRC C+F              
Sbjct: 572  VKYMFEYEYDDYNEPEEDESDEDGERNNSEENIKFNFNRRRCRCVFSDDDVLEHGDFNDA 631

Query: 645  XXXXXXXXXXXXYVDAIEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKDW 704
                         VD           N + P+D I          + K+  EFD+ GKDW
Sbjct: 632  NSEYSNSEENSNDVD-----------NFVLPNDGI---------DKPKNGVEFDFDGKDW 671

Query: 705  RDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDK 764
            R +PR  N++YS  Y FI++P+   I +L S+A+   L+ + S LL+  +AS IK+ QD 
Sbjct: 672  RAVPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDS 731

Query: 765  MISKELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLMD 824
             I        + + P+  ++    +    +  D+  + +    FE +L  N+++   LMD
Sbjct: 732  RI------LGSKRSPNGTDSSKSQNG--LSTGDLIKLITAGDTFENILKFNRELGCFLMD 783

Query: 825  EMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIMY 884
            E+LM  GYRRVL+WF+TH+ L+H++I YIFEL+M  R                       
Sbjct: 784  ELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHR----------------------- 820

Query: 885  GQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSXXXXXXX---X 941
            GQV + E   S     FSRQG L LS++E +MLLQEFFTNA ++FSSKS           
Sbjct: 821  GQVSDTEREQSELSYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTGDNN 880

Query: 942  XXXXXIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIP 1001
                 +D E   +S+Y+ GL+++ C M+ SL +N  FD + SE  FELQTLLM WI IIP
Sbjct: 881  EINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIP 940

Query: 1002 EAEDLFFTLXXXXXXXXXXXXRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNE 1061
            EA+ LFF L            +  +  DN    ++             ++  T D    +
Sbjct: 941  EAKLLFFKL--------KESVKSFNGIDNPELKSI-------EESSTTTKKTTIDENSEQ 985

Query: 1062 SIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAA 1121
              FNK+L+   PK  +  D +  + T + F+  YSFD E P  GRKV+Y  + +L L   
Sbjct: 986  YRFNKKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQLTDI 1045

Query: 1122 DQPISFHEYLT 1132
            ++PIS H++L+
Sbjct: 1046 EKPISLHKFLS 1056

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  372 bits (954), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 295/1141 (25%), Positives = 504/1141 (44%), Gaps = 123/1141 (10%)

Query: 68   EHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRK 127
            + S+L+E ++I   +T  G+ + + L ND  + +    +  +  +   D    A   L  
Sbjct: 19   DESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDV--DGVECLIRMNDPYWVA---LFG 73

Query: 128  KWSSNXXXXXXXXXXXXVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFI--LDNKY 185
             W+++             N   +I++++Y++  +K+ + FL    TN  P F   L +  
Sbjct: 74   TWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLL---TNQDPKFTAPLWDTS 130

Query: 186  NLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNA 245
            N+L DY++   PL++ V+K  L+    L     Y    +    Y W+   PP    H  +
Sbjct: 131  NILLDYLHNAKPLIESVLK-KLDGSQFLQCLMKYNRLYEFNGSYQWFT--PPQSTSHAES 187

Query: 246  TKQNNNSNNIPLTMQPSIKTXXXXXXXXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLN 305
                   N+  L+   +            +T     LN+     L++   ++   +  L+
Sbjct: 188  PTTILERNSTFLSTLGNFGNDMVRALSQLKTG-DIRLNS-----LESYGKNSGHNNPPLS 241

Query: 306  QLINNNDLKTT-------------------PLLTLQFTFMAGLVDPLSQPPPNNKQVISL 346
            +  ++N L                      PLL  QF  +    DP++QPPPN+  +ISL
Sbjct: 242  KQDDHNPLNLNGKSDRFNLFFKLGLHKEPHPLLAEQFNSLCLFADPMTQPPPNDSHIISL 301

Query: 347  HLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDXXXXXXXXXXX 406
             LL+ +++G +   + +    N    WK H+  N+  +   ++ IL+             
Sbjct: 302  DLLHDLYLGSLTAYIVKLI-PNYQKVWKIHLSANLETI---TLAILQM-----LQIWDYR 352

Query: 407  XXXXXXXXXXXXXXAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNP 466
                          A+   +  WIP+ ++  ++E++YMI  ++ Y++++++SD P ++NP
Sbjct: 353  SLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNP 412

Query: 467  FLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHV 526
            FL  ++  W+ LS+ ++LGL IDR EE +  + TP++V A IRGA++LR+++ATILN HV
Sbjct: 413  FLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHV 472

Query: 527  DVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHXXXXXXXXXXXXXXXXXXXXXQAGD 586
            D   HDFKH+P   FMSPHGRKLC GALY     +                     Q GD
Sbjct: 473  DEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGD 532

Query: 587  RFDEDIRYMFDYEYDDYNDF---------------KDDVEEQEEMEIMGSFPRRCNCIFX 631
            R DED+RYMFDYEY DYND                K+++E++    ++    +RC C F 
Sbjct: 533  RIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGLYKRCLCKFS 592

Query: 632  XXXXXXXXXXXXXXXXXXXXXXXXXYVDAIEGVTKDTPH-----NNLNPHDAIRTRNSHP 686
                                       +  +    +TP      +N     ++ T     
Sbjct: 593  DEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFTSLMTHRDSQ 652

Query: 687  NSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTED 746
            N   S  +  +D  G DWRDIPRG NLYY   Y F+      ++  L  +  +  +T   
Sbjct: 653  NDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQ 712

Query: 747  STLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKI---ATPDDIYDMWS 803
            +  ++ ++A+C+KLEQ++++ K +                + D K+   +T + I  +++
Sbjct: 713  ACTVLRSIATCVKLEQEQILLKLI-----------TATSAEVDLKVLPFSTDEVITAIFN 761

Query: 804  EESKFERMLYL---NQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGL 860
            ++    +       N  + W++ DE++M +G+RR+LI+ +TH     S I Y++EL+ GL
Sbjct: 762  DDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGL 821

Query: 861  RGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQE 920
            RG+P +   D   +KN  L  + +      E V ++    FSRQG + LS IE KMLLQE
Sbjct: 822  RGNP-ARSYDLESTKNKQLGILSWTPTGEFERVAAIE---FSRQGVIELSAIEKKMLLQE 877

Query: 921  FFTNAAI----YFSSKSXXXXXXXXXXXXXIDE------EAVNFSVYSTGLVKLICFMVQ 970
            FF   +      ++                +D+       A +     +G VK++CF+++
Sbjct: 878  FFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVKMVCFILE 937

Query: 971  SLMENNKFDFAKSE-CTFELQTLLMNWIGIIPEAEDLFFTLXXXXXXXXXXXXRES-DDH 1028
             ++ + +F+F   E   +EL+  LM W     EA  ++  L             E  DD 
Sbjct: 938  EVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLGTEGLDDR 997

Query: 1029 DNTHADN---------LSFSDDGDTGHPGISRFDTDDSPPNE-----SIFNKRLVSLLPK 1074
             NT  D+         L  SD  D       R+DT+     E     SI ++R   +LP 
Sbjct: 998  PNTDPDDQLLPVDFDKLKLSDIDD-------RWDTETDTSIENGDKTSIMSERFSRMLP- 1049

Query: 1075 RINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTEL 1134
             +   D        RH +++Y   E  P++GR  +   + +LPL          E+L   
Sbjct: 1050 -VQSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFLAVF 1108

Query: 1135 D 1135
            D
Sbjct: 1109 D 1109

>Ecym_6036 Chr6 (65515..71817) [6303 bp, 2100 aa] {ON} similar to
            Ashbya gossypii ABR112C
          Length = 2100

 Score = 32.3 bits (72), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 87/209 (41%), Gaps = 25/209 (11%)

Query: 160  IYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIY 219
            +YK  L  +F    N +P F+++N Y L+ +   +C  L   ++    +  +   LP  Y
Sbjct: 1803 VYKGTLR-IFLAIANDVPEFLVENHYQLINNVPVSCIQLKNIILAAFPKKML---LPDPY 1858

Query: 220  KLDIDLQF-------PYPWYDLLPPMHEGHLNATKQNNNSNNIP-LTMQPSIKTXXXXXX 271
            K D+DL         P  +YD   P+ +   N  K  +N   IP  ++  ++ +      
Sbjct: 1859 KSDLDLDHIELCEIPPNVFYD---PVQDLK-NLKKPVDNYLRIPSASLLRTVSSGIFRTE 1914

Query: 272  XXXQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVD 331
               +    +D+NT     +  +V H      +  Q  + N +  T   +  +TF++G++ 
Sbjct: 1915 YEREAGIGYDVNTIDVKLIHAIVLHVGMEAALEKQKTSFNAVFNTK--SSYYTFLSGMIS 1972

Query: 332  PLSQPPPNNKQVISLHLLYSMFIGLMYPN 360
                   +    +  HL+ +M   L YPN
Sbjct: 1973 -------DGSDEVKFHLIQAMVNQLRYPN 1994

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,260,755
Number of extensions: 5419153
Number of successful extensions: 17408
Number of sequences better than 10.0: 36
Number of HSP's gapped: 17628
Number of HSP's successfully gapped: 77
Length of query: 1150
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1029
Effective length of database: 39,606,813
Effective search space: 40755410577
Effective search space used: 40755410577
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)