Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E007603.499ON25925911171e-155
YGR135W (PRE9)3.499ON25824710431e-144
Smik_6.2313.499ON25824710421e-144
Suva_7.4233.499ON25824710351e-143
Kpol_480.103.499ON25924710341e-143
NDAI0G008903.499ON25424710321e-143
KAFR0C020203.499ON25824710301e-142
Skud_7.4463.499ON25824710211e-141
SAKL0F02530g3.499ON25224710091e-139
TPHA0A057003.499ON25624810011e-138
CAGL0I10406g3.499ON2572489991e-138
TDEL0D056703.499ON2552479861e-136
ZYRO0D09746g3.499ON2532469791e-134
KLLA0E03917g3.499ON2492479681e-133
KNAG0B007603.499ON2592599651e-132
Ecym_12303.499ON2512479621e-132
AFR318W3.499ON2512479561e-131
Kwal_47.188983.499ON2512479541e-131
KLTH0G02376g3.499ON2512479511e-130
TBLA0D029203.499ON2582499011e-123
Ecym_81518.871ON2501903962e-46
ADL354W8.871ON2501903952e-46
KLLA0B11836g7.120ON2541883911e-45
KLTH0E16324g8.871ON2501903892e-45
KNAG0J001808.871ON2501903831e-44
Kwal_56.247805.64ON2621903823e-44
Ecym_51005.64ON2611913798e-44
KAFR0L020808.871ON2501903761e-43
KLTH0F13574g7.120ON2541763762e-43
AER296W5.64ON2601903753e-43
Kwal_YGOB_Anc_7.1207.120ON2541763743e-43
AAR012C7.120ON2511763743e-43
SAKL0H02068g5.64ON2611903753e-43
SAKL0F04224g7.120ON2521763743e-43
NCAS0F010307.120ON2531763744e-43
CAGL0H07007g8.871ON2501903735e-43
NDAI0C034005.64ON2631913736e-43
KLLA0D10373g8.871ON2501903727e-43
KLLA0A05093g5.64ON2621913737e-43
TBLA0J019807.120ON2541763728e-43
CAGL0F01199g7.120ON2541793728e-43
KLTH0H00528g5.64ON2611903729e-43
NDAI0E001608.871ON2501903711e-42
NCAS0D013405.64ON2611913721e-42
TPHA0H011905.64ON2601903711e-42
Kpol_1062.25.64ON2601903702e-42
Suva_13.568.871ON2501903702e-42
Ecym_12727.120ON2511763692e-42
NDAI0H015207.120ON2521913692e-42
KAFR0B044405.64ON2601903693e-42
TPHA0I020707.120ON2561763683e-42
Suva_15.1317.120ON2541763683e-42
Skud_13.518.871ON2501903683e-42
YML092C (PRE8)8.871ON2501903683e-42
KAFR0G030307.120ON2541763683e-42
YOL038W (PRE6)7.120ON2541763683e-42
Smik_15.1297.120ON2541913674e-42
Skud_15.1197.120ON2541763665e-42
Kpol_1023.1087.120ON2541793666e-42
ZYRO0G04136g7.120ON2541763658e-42
CAGL0I02442g5.64ON2601933658e-42
Kpol_455.58.871ON2491913631e-41
KNAG0K004505.64ON2671903651e-41
TPHA0C049308.871ON2501913631e-41
TDEL0G008805.64ON2601903641e-41
TBLA0C066205.64ON2621903642e-41
Smik_13.438.871ON2501903622e-41
SAKL0D00440g8.871ON2501903613e-41
NCAS0B001508.871ON2501903595e-41
TDEL0B004008.871ON2501893589e-41
ZYRO0C11770g5.64ON2601903553e-40
TDEL0H033007.120ON2561763544e-40
ZYRO0A00616g8.871ON2501883518e-40
KNAG0L010207.120ON2661763511e-39
TBLA0C063408.871ON2561963492e-39
Suva_7.5495.64ON2601913483e-39
YGR253C (PUP2)5.64ON2601903483e-39
Smik_16.545.64ON2601903483e-39
Skud_7.5865.64ON2601903483e-39
ZYRO0C00792g7.20ON2901913172e-34
TBLA0E006907.20ON2781913121e-33
Kpol_538.407.20ON2741783111e-33
Suva_8.4197.20ON2921723112e-33
Smik_15.5467.20ON2881723093e-33
KLTH0D00902g7.20ON2771823051e-32
KAFR0C050007.20ON2811723042e-32
Skud_15.5307.20ON2881913042e-32
YOR362C (PRE10)7.20ON2881723032e-32
KLLA0A03487g7.20ON2751812997e-32
NCAS0I002507.20ON2921723008e-32
CAGL0H06105g7.20ON2901723008e-32
Ecym_50197.20ON2851722945e-31
ADR401C7.20ON2791722936e-31
TDEL0H043107.20ON2741722892e-30
NDAI0A087707.20ON2921912902e-30
AGL089W4.110ON2461822863e-30
KNAG0E002307.20ON2791802884e-30
SAKL0D14476g7.20ON2811722868e-30
Ecym_72334.110ON2461822803e-29
TPHA0N002407.20ON2771782805e-29
TBLA0C040804.110ON2531792778e-29
KNAG0E011805.1ON2331922714e-28
KLLA0A05027g4.110ON2461892707e-28
Kpol_1061.454.110ON2561772717e-28
KLTH0B09504g5.1ON2331922697e-28
Kwal_27.97208.871ON1731152631e-27
KLTH0E07788g4.110ON2461822654e-27
SAKL0H21956g4.110ON2481922646e-27
Kwal_47.174934.110ON2461822639e-27
CAGL0M14003g5.1ON2331922611e-26
TPHA0F006704.110ON2571772612e-26
YGL011C (SCL1)4.110ON2521832593e-26
Kwal_26.94835.1ON2331922574e-26
Kpol_1060.15.1ON2331922565e-26
ZYRO0C01144g5.1ON2331922566e-26
Suva_7.2704.110ON2521832577e-26
KLLA0A10153g5.1ON2331922558e-26
TDEL0F023604.110ON2531792569e-26
Ecym_56505.1ON2331922559e-26
Smik_7.2794.110ON2521772551e-25
ZYRO0G10164g4.110ON2531732542e-25
NCAS0D023105.1ON2331922522e-25
NCAS0A016404.110ON2531772532e-25
YMR314W (PRE5)5.1ON2341872513e-25
Skud_7.2764.110ON2521832523e-25
AGL336W5.1ON3061892554e-25
NDAI0I026405.1ON2331922496e-25
CAGL0A00407g4.110ON2541772516e-25
Skud_13.4885.1ON2341872496e-25
Smik_13.5315.1ON2341872489e-25
KNAG0D035404.110ON2521872491e-24
Suva_13.5075.1ON2341872452e-24
TBLA0C071905.1ON2331922443e-24
TPHA0A056705.1ON2331922427e-24
SAKL0H00946g5.1ON2331922419e-24
KAFR0I027205.1ON2351892383e-23
KAFR0F034304.110ON2521792375e-23
TDEL0G002405.1ON2381972191e-20
Kwal_26.68197.20ON196951541e-11
NDAI0D035604.110ON172801451e-10
SAKL0G04290g5.507ON2611821322e-08
ZYRO0D12034g5.507ON2611601313e-08
Smik_15.3375.507ON2611611251e-07
Skud_15.3215.507ON2611611233e-07
NDAI0C011705.507ON2631611216e-07
AGL324W7.480ON2431581206e-07
Suva_8.2085.507ON2611611208e-07
KAFR0C053005.507ON2611821199e-07
YOR157C (PUP1)5.507ON2611611191e-06
KNAG0B038005.507ON2611611181e-06
Ecym_54585.507ON2581611172e-06
Kpol_218.15.507ON2611601154e-06
TPHA0E020505.507ON2611611144e-06
TDEL0A037105.507ON2611831144e-06
KLLA0E05633g7.480ON2401591135e-06
KAFR0B006507.480ON2411741111e-05
CAGL0L04312g5.507ON2611611101e-05
KNAG0F035907.480ON2481721101e-05
NCAS0A148807.480ON2411741101e-05
KLLA0A02233g5.507ON2621611102e-05
SAKL0F15092g7.480ON2611791082e-05
TBLA0D017505.507ON2591651083e-05
CAGL0F04477g7.480ON2421551083e-05
NDAI0J006007.480ON2411771073e-05
TDEL0C034407.480ON2411771073e-05
KLTH0G03168g5.507ON2631681074e-05
NCAS0H024805.507ON2641841065e-05
Kwal_47.187485.507ON2631611056e-05
AAR119W5.507ON2591791021e-04
Kpol_1028.927.480ON2421701021e-04
Ecym_71717.480ON2421591012e-04
KLTH0E01826g7.480ON2421791003e-04
TBLA0F026807.480ON2411551003e-04
Suva_2.777.480ON241155993e-04
Kwal_55.198827.480ON242170985e-04
ZYRO0G17842g7.480ON244154985e-04
KLLA0F12936g5.216ON215165976e-04
TPHA0E004207.480ON241173960.001
Smik_10.2785.216ON216164950.001
Kpol_2002.1095.216ON215164950.001
Kpol_534.575.216ON215164950.001
YBL041W (PRE7)7.480ON241155950.001
ZYRO0B10142g5.216ON215164940.001
Smik_2.737.480ON241155940.001
Skud_2.617.480ON241155940.002
Skud_10.2225.216ON215164920.002
YJL001W (PRE3)5.216ON215164920.003
Suva_12.805.216ON215164910.004
KLTH0B03102g5.216ON215164900.004
Kwal_33.151935.216ON193154890.005
Ecym_82765.216ON215161890.005
TPHA0E029905.216ON216165870.009
AAL172C5.216ON215161840.026
TDEL0E041305.216ON219161840.027
KNAG0H024505.216ON216162840.028
TPHA0N007405.216ON216165810.052
TDEL0C055403.417ON287165820.053
Suva_16.4293.417ON287165820.062
Skud_16.3883.417ON287165820.062
Smik_16.3433.417ON287165810.064
KNAG0A075203.417ON287165810.064
AEL326C3.417ON285165810.066
KLTH0D03058g3.417ON287165810.074
TBLA0C062005.216ON216163800.082
NCAS0A114403.417ON287165800.093
YPR103W (PRE2)3.417ON287165800.098
CAGL0D03058g5.216ON215161790.11
SAKL0G12584g5.216ON21573770.17
TPHA0M017503.417ON286165780.17
NDAI0C024205.216ON216162750.32
Kpol_1018.1443.417ON288167760.34
Kwal_26.72733.417ON287164760.35
NCAS0A014805.216ON21671750.36
TBLA0F017603.417ON287165750.39
SAKL0B09262g3.417ON287165750.42
KAFR0C063505.216ON21671730.61
CAGL0G01804g3.417ON286165730.67
NDAI0A048603.417ON287169730.69
Ecym_26143.417ON285165721.1
ZYRO0C17688g3.417ON287165721.1
KLLA0F08228g3.417ON285162711.3
KLTH0C07348g3.269ON316127701.7
Kwal_23.29492.191ON161767711.8
KAFR0D042103.417ON287167692.6
TDEL0B071102.618ON88889666.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00760
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     434   e-155
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   406   e-144
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   405   e-144
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   403   e-143
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   402   e-143
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   402   e-143
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   401   e-142
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   397   e-141
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   393   e-139
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   390   e-138
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   389   e-138
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   384   e-136
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   381   e-134
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   377   e-133
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   376   e-132
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   375   e-132
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   372   e-131
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   372   e-131
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   370   e-130
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   351   e-123
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   157   2e-46
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   156   2e-46
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   155   1e-45
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   154   2e-45
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   152   1e-44
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   151   3e-44
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   150   8e-44
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   149   1e-43
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   149   2e-43
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   149   3e-43
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   148   3e-43
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   148   3e-43
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   149   3e-43
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   148   3e-43
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     148   4e-43
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   148   5e-43
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   148   6e-43
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   147   7e-43
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   148   7e-43
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   147   8e-43
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   147   8e-43
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   147   9e-43
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   147   1e-42
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      147   1e-42
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   147   1e-42
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   147   2e-42
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   147   2e-42
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   146   2e-42
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     146   2e-42
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   146   3e-42
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   146   3e-42
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   146   3e-42
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   146   3e-42
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   146   3e-42
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   146   3e-42
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   146   3e-42
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   145   4e-42
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   145   5e-42
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   145   6e-42
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   145   8e-42
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   145   8e-42
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   144   1e-41
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   145   1e-41
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   144   1e-41
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   144   1e-41
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   144   2e-41
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   144   2e-41
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   143   3e-41
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   142   5e-41
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   142   9e-41
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   141   3e-40
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   140   4e-40
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   139   8e-40
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   139   1e-39
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   139   2e-39
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   138   3e-39
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   138   3e-39
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   138   3e-39
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   138   3e-39
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   126   2e-34
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   124   1e-33
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   124   1e-33
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   124   2e-33
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   123   3e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   122   1e-32
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   121   2e-32
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   121   2e-32
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   121   2e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   119   7e-32
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   120   8e-32
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   120   8e-32
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   117   5e-31
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   117   6e-31
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   115   2e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   116   2e-30
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   114   3e-30
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   115   4e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   114   8e-30
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   112   3e-29
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   112   5e-29
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   111   8e-29
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   108   4e-28
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   108   7e-28
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   108   7e-28
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   108   7e-28
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   105   1e-27
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   106   4e-27
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   106   6e-27
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   105   9e-27
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   105   1e-26
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   105   2e-26
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   104   3e-26
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   103   4e-26
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   103   5e-26
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   103   6e-26
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   103   7e-26
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   102   8e-26
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   103   9e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   102   9e-26
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   102   1e-25
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   102   2e-25
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   101   2e-25
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   102   2e-25
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   101   3e-25
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   101   3e-25
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   102   4e-25
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       100   6e-25
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   101   6e-25
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   100   6e-25
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   100   9e-25
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   100   1e-24
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...    99   2e-24
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    99   3e-24
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}              98   7e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    97   9e-24
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    96   3e-23
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...    96   5e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    89   1e-20
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    64   1e-11
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    60   1e-10
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    55   2e-08
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    55   3e-08
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    53   1e-07
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    52   3e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    51   6e-07
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    51   6e-07
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    51   8e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    50   9e-07
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    50   1e-06
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    50   1e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    50   2e-06
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    49   4e-06
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    49   4e-06
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    49   4e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    48   5e-06
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    47   1e-05
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    47   1e-05
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    47   1e-05
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    47   1e-05
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    47   2e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    46   2e-05
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    46   3e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    46   3e-05
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    46   3e-05
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    46   3e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    46   4e-05
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      45   5e-05
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    45   6e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    44   1e-04
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    44   1e-04
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    44   2e-04
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    43   3e-04
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    43   3e-04
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    43   3e-04
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    42   5e-04
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    42   5e-04
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    42   6e-04
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    42   0.001
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    41   0.001
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    41   0.001
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    41   0.001
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    41   0.001
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    41   0.001
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    41   0.001
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    41   0.002
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    40   0.002
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.003
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    40   0.004
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    39   0.004
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    39   0.005
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    39   0.005
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    38   0.009
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    37   0.026
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    37   0.027
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    37   0.028
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    36   0.052
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    36   0.053
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    36   0.062
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    36   0.062
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    36   0.064
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    36   0.064
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    36   0.066
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    36   0.074
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    35   0.082
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    35   0.093
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    35   0.098
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    35   0.11 
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    34   0.17 
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    35   0.17 
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    33   0.32 
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    34   0.34 
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    34   0.35 
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    33   0.36 
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    33   0.39 
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    33   0.42 
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    33   0.61 
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    33   0.67 
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    33   0.69 
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    32   1.1  
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    32   1.1  
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    32   1.3  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    32   1.7  
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    32   1.8  
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    31   2.6  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    30   6.7  

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  434 bits (1117), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 221/259 (85%), Positives = 221/259 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KDNMKLDDAIELA                  ELATIKKGTTTDEVYQKIY          
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 241 XTGITKKSXXXXXXXXXMK 259
            TGITKKS         MK
Sbjct: 241 KTGITKKSEDEDDEDEEMK 259

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  406 bits (1043), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 202/247 (81%), Positives = 211/247 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI VAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD+MK+DDAIELA                  E ATI+KG    EVYQKI+          
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 241 XTGITKK 247
            TGITKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  405 bits (1042), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 201/247 (81%), Positives = 212/247 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI+VAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD+MK+DDAI+LA                  E ATI+KG    EVYQKI+          
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 241 XTGITKK 247
            TGITKK
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  403 bits (1035), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/247 (80%), Positives = 211/247 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI VAVAGLTADAEILINTARV+AQ+YLK+YNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD+MK+DDAI+LA                  E ATI+KG    EVYQKI+          
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 241 XTGITKK 247
            TGITKK
Sbjct: 241 KTGITKK 247

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  402 bits (1034), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/247 (81%), Positives = 212/247 (85%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKITVAVAGLTADAEILINTARV+AQ YLKTYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++K+D+AIELA                  E ATIKKG   D++YQKI+          
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENDKIYQKIFKPEEIKQLLL 239

Query: 241 XTGITKK 247
            TGITKK
Sbjct: 240 KTGITKK 246

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  402 bits (1032), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/247 (80%), Positives = 209/247 (84%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKITVAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD+M+LD+AIELA                  E ATIKKG    EVYQKIY          
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 241 XTGITKK 247
            TG+TKK
Sbjct: 241 KTGVTKK 247

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  401 bits (1030), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/247 (80%), Positives = 210/247 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS EKLYKLNDKITVAVAGLTADAEILINTAR++AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD + LDDA+ELA                  E ATIKKG T D++YQKI+          
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 241 XTGITKK 247
            TGI+KK
Sbjct: 241 KTGISKK 247

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  397 bits (1021), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 198/247 (80%), Positives = 210/247 (85%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLNDKI VAVAGLTADAEILINTARV+AQ+YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           K++MK+D AI+LA                  E ATI+KG    EVYQKI+          
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 241 XTGITKK 247
            TGI+KK
Sbjct: 241 KTGISKK 247

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  393 bits (1009), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/247 (80%), Positives = 208/247 (84%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EKLYKLND ITVAVAGLTADAEILINTARVYAQ+YL+TYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD + LD AIELA                  E ATIKKG +  ++YQKIY          
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKG-SNGQLYQKIYKPQEIQTLLS 239

Query: 241 XTGITKK 247
            TGITKK
Sbjct: 240 KTGITKK 246

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  390 bits (1001), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/248 (78%), Positives = 211/248 (85%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLND ITVAVAGLTADAEILINTARV+AQ+YL+TYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++KL+ AIELA                  E ATIKKG   ++VYQKIY          
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENNKVYQKIYKPEEIKQLLS 239

Query: 241 XTGITKKS 248
             GITKKS
Sbjct: 240 KAGITKKS 247

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/248 (77%), Positives = 208/248 (83%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM  +G+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLYKLND+ TVAVAGLTADAEILINTAR++AQ+YLKTYNEEIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD M LDDA+ELA                  E AT+KK   T+E  QKI+          
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 241 XTGITKKS 248
            TGI+KKS
Sbjct: 241 KTGISKKS 248

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  384 bits (986), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 194/247 (78%), Positives = 208/247 (84%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKITVAVAGLTADAEILINTARVYAQ+YL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++KL+ AIELA                  E ATI+K     ++YQKI+          
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKA-PDGKLYQKIFKPEEIQSLLV 239

Query: 241 XTGITKK 247
             GITKK
Sbjct: 240 KHGITKK 246

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  381 bits (979), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 190/246 (77%), Positives = 207/246 (84%), Gaps = 1/246 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLT+DAEILINTAR++AQ+YLKTYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++K+D AIELA                  E ATIK G    ++YQK++          
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-ENGKLYQKVFKPEEIQTLLV 239

Query: 241 XTGITK 246
             GITK
Sbjct: 240 KNGITK 245

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  377 bits (968), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 201/247 (81%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM + G+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EKLYKLND ITVAVAGLTADAEILINTARV AQSYLKTYNEEIPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++ LD AIELA                  E ATI K     ++YQKIY          
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKD-AEGKIYQKIYKPTEIATLLE 239

Query: 241 XTGITKK 247
            T I KK
Sbjct: 240 KTEIVKK 246

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  376 bits (965), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/259 (71%), Positives = 205/259 (79%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DG+V+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARV+ Q+YLKTY E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD + L++A ELA                  E +TIK+G    +V QKIY          
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 241 XTGITKKSXXXXXXXXXMK 259
            +GITKK          MK
Sbjct: 241 KSGITKKDAEDGDADVEMK 259

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  375 bits (962), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 187/247 (75%), Positives = 203/247 (82%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EKLY+LND ITVAVAGLTADAEILINTAR++AQ+YLK YNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD +  ++AIELA                  E ATIK+  +  ++ QKIY          
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQ-DSNGKLVQKIYKPSEIKELLQ 239

Query: 241 XTGITKK 247
            +GI K+
Sbjct: 240 KSGIMKQ 246

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  372 bits (956), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/247 (74%), Positives = 201/247 (81%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EKLY+LND ITVAVAGLTADAEIL+NTAR++AQ+YLK YNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++  DDAI+LA                  E ATI++     +V QKIY          
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQR-NADGKVVQKIYKLGEIKDLLE 239

Query: 241 XTGITKK 247
            TGI K+
Sbjct: 240 KTGINKQ 246

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  372 bits (954), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 184/247 (74%), Positives = 201/247 (81%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DG+VLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +S+EKLYKLND ITVAVAGLTADAEILINTAR++AQ+YLKTYNEEIPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++ + +A ELA                  E ATI K     ++ QKI+          
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITK-LENGKIAQKIFKPREIETLLN 239

Query: 241 XTGITKK 247
            TGI KK
Sbjct: 240 ETGINKK 246

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  370 bits (951), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/247 (73%), Positives = 203/247 (82%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DG+VLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +S+EKLYKLND ITVAVAGLTADAEILINTAR++AQ+YLK+YNEEIPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTDEVYQKIYXXXXXXXXXX 240
           KD++ +++A ELA                  E +TI K     ++ QKI+          
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239

Query: 241 XTGITKK 247
            TG+TKK
Sbjct: 240 KTGVTKK 246

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  351 bits (901), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 195/249 (78%), Gaps = 1/249 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DG+VL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR +AQ+YL TYNEEIPVEILV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDNMKLDDAIELAXXXXXXXXXXXXXXXXXXELATIKKGTTTD-EVYQKIYXXXXXXXXX 239
           KD+M L+DA+EL                   EL+ IK     D ++ QKIY         
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 240 XXTGITKKS 248
              GI KK+
Sbjct: 241 IKFGINKKN 249

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 121/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  STL   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYA-QSYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+ K+   I    +G+  D  +LIN +R  A  SY+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + + 
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 121/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K  +TL  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYA-QSYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A  SY K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 1/188 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ AGL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNM 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y  N 
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 185 KLDDAIEL 192
              D  E 
Sbjct: 184 PPADEKEC 191

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  154 bits (389), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 120/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K TS+L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R  A + Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  152 bits (383), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A + Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  151 bits (382), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  ARV A ++   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  150 bits (379), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 122/191 (63%), Gaps = 7/191 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIE 65

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR+ + ++   Y+EEI VE L + + D+     +
Sbjct: 66  KIVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDNMKLDDA 189
           ++  ++ L +A
Sbjct: 186 EWYSSLTLKEA 196

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  149 bits (376), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 121/190 (63%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A + Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  ARV AQS+  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNY 179

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 122/190 (64%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR+ + ++   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WYSSLTLKEA 196

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  ARV AQS+  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + ++++ + ++ AGL AD+ ILI  ARV AQS+  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNY 179

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 121/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  ARV A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ AGL AD+ ILI  ARV AQS+  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  148 bits (374), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 72/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A + Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + + 
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  148 bits (373), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIE 65

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----Q 120
           K+ ++   +  A++GLTADA  +I  ARV A ++   Y+E++ VE L + + D+     +
Sbjct: 66  KIVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDNMKLDDA 189
           ++  ++ L +A
Sbjct: 186 EWHSSLTLREA 196

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +G+V+A E+K +S+L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR  A + Y + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + + 
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  148 bits (373), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 78/191 (40%), Positives = 122/191 (63%), Gaps = 7/191 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIG++ ++G+VL  E++VTS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIE 65

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  ++  ARV A ++   Y+E+I VE L + + D+     +
Sbjct: 66  KIVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDNMKLDDA 189
           ++  ++ L +A
Sbjct: 186 EWHSSLTLKEA 196

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  147 bits (372), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  147 bits (372), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 112/179 (62%), Gaps = 6/179 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTST-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+  STL  QDT    
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYT 123
            K+  ++  + ++ AGL AD+ IL+N ARV AQS+  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNY 180

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  147 bits (372), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + ++   +  A++GLTADA  +I  ARV + ++   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A S Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  147 bits (372), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/191 (41%), Positives = 120/191 (62%), Gaps = 7/191 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIE 65

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----Q 120
           K+ ++   I  A++GLTADA  +I  ARV A ++   Y+E+I VE L + + D+     +
Sbjct: 66  KIVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DYKDNMKLDDA 189
           ++  ++ L +A
Sbjct: 186 EWHSSLTLKEA 196

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/190 (42%), Positives = 119/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  147 bits (370), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + ++++ I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  147 bits (370), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQ-SYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  SY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ AGL AD+ ILI  ARV AQS+  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 116/191 (60%), Gaps = 4/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  AR+ AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 182 DNMKLDDAIEL 192
               +D+ + L
Sbjct: 184 PPENVDECVRL 194

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  146 bits (369), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  +  A++GLTADA  +I  ARV A S+   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 112/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  AR+ AQS+  T  + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNY 179

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQ-SYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  SY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQ-SYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A  SY + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K+++ I ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 117/191 (61%), Gaps = 4/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DNMKLDDAIEL 192
               ++D ++L
Sbjct: 184 PPATVEDCVKL 194

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  145 bits (366), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  145 bits (366), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 113/179 (63%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K+++ + ++ +GL AD+ ILI  AR+ AQS+  T  + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  N
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRN 182

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  145 bits (365), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 70/176 (39%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + K++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  145 bits (365), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 77/193 (39%), Positives = 123/193 (63%), Gaps = 7/193 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++  +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  +  A++GLTADA  ++  ARV A ++   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDAIEL 192
           +  ++ L +A +L
Sbjct: 187 WHSSLTLKEAEQL 199

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 74/191 (38%), Positives = 119/191 (62%), Gaps = 4/191 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A + Y + Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 NMKLDDAIELA 193
            ++L+DAI +A
Sbjct: 182 ELELEDAIHIA 192

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  145 bits (365), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 116/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ + DA
Sbjct: 187 WHSSLNMRDA 196

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  144 bits (363), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 120/191 (62%), Gaps = 4/191 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGY 122
            K+  L   I    +G+  D  +L++ +R  A + Y + Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 NMKLDDAIELA 193
            ++L+DAI +A
Sbjct: 182 ELELEDAIHIA 192

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  144 bits (364), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 79/190 (41%), Positives = 118/190 (62%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + ++   I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  144 bits (362), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/190 (38%), Positives = 118/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R  A + Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 117/190 (61%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A +G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A + Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + + 
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  142 bits (359), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 72/190 (37%), Positives = 119/190 (62%), Gaps = 2/190 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI A +G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A + Y + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D 
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MKLDDAIELA 193
           ++L+DAI +A
Sbjct: 183 LELEDAIHIA 192

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  142 bits (358), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 117/189 (61%), Gaps = 2/189 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A +G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R  A + Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +   
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 MKLDDAIEL 192
           ++L+DAI +
Sbjct: 183 LELEDAIHI 191

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  141 bits (355), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  140 bits (354), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ +GL AD+ ILI  ARV AQS+  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  139 bits (351), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 69/188 (36%), Positives = 115/188 (61%), Gaps = 2/188 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +L++ +R  A + Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + + 
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 MKLDDAIE 191
           ++L+DAI 
Sbjct: 183 LELEDAIH 190

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  139 bits (351), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR  AQS+  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDD-RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  139 bits (349), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 114/196 (58%), Gaps = 8/196 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A +G+VLA E+K  S+L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    AG+  D  +L++ AR  A + Y + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDNMKLDDAIELA 193
             + D ++L+DA+ +A
Sbjct: 183 KRWHDELELEDAVHIA 198

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 117/191 (61%), Gaps = 7/191 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIE 65

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----Q 120
           K+ +++  I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +
Sbjct: 66  KIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGE 125

Query: 121 GYTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
           G +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  
Sbjct: 126 GASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLN 185

Query: 179 DYKDNMKLDDA 189
           ++  ++ L +A
Sbjct: 186 EWHSSLTLKEA 196

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLTLKEA 196

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 77/190 (40%), Positives = 117/190 (61%), Gaps = 7/190 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK----QG 121
           + +++  I  A++GLTADA  +I  AR  A ++   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDNMKLDDA 189
           +  ++ L +A
Sbjct: 187 WHSSLSLKEA 196

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  126 bits (317), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 109/191 (57%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ V+S LL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  +    +GL  D   L+N  R  AQS+ KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 NMKLDDAIELA 193
            +   DA++ A
Sbjct: 186 GLSAKDAVKEA 196

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  124 bits (312), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 106/191 (55%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  DDG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A ++ K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK---D 182
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 NMKLDDAIELA 193
            + + DAI+ A
Sbjct: 186 GLSVKDAIKEA 196

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  124 bits (311), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 103/178 (57%), Gaps = 2/178 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  ++S+ + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+  +  N
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLFDKN 183

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  DDG+V A E+ +TS LL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  123 bits (309), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 101/182 (55%), Gaps = 2/182 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+   DG+VLA E+ VTS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  +  A +GL  D   L+N  R  A S+ KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMK 185
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+    +  +
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 186 LD 187
           LD
Sbjct: 186 LD 187

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS L+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + S+ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  121 bits (304), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 105/191 (54%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 NMKLDDAIELA 193
            +   +A++ A
Sbjct: 186 GLTAKEAVKQA 196

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  121 bits (303), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  119 bits (299), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 100/181 (55%), Gaps = 2/181 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+VLA E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMK 185
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+     N  
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELEKLSNKNPN 185

Query: 186 L 186
           L
Sbjct: 186 L 186

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  120 bits (300), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  DDG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D    +N  R  A ++ K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  120 bits (300), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  +DG+V A E+ +TS LL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I V  +GL  D   L+N AR  +Q++ K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ + S LL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  117 bits (293), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLL-VPHKNKK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A  + K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  115 bits (289), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + S+ K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 101/191 (52%), Gaps = 5/191 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 NMKLDDAIELA 193
            +   DA++ A
Sbjct: 186 GLTTRDAVKYA 196

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 93/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I      VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            T T  L+ +   I +   G  ADA  +    R  A  +   Y  ++PV +L +R +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  115 bits (288), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/180 (34%), Positives = 97/180 (53%), Gaps = 8/180 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++ +DG+VLA E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYKLNDKIT-------VAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDI 118
               N KI         A +GL  D   L+N AR  +Q + + Y  +IP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  114 bits (286), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  A S+ K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 96/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A  +   Y  +IPV +L +RL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  112 bits (280), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 97/178 (54%), Gaps = 2/178 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  I    +GL  D   L+N  R  + ++ K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+  + ++
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELEKLFNEH 183

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  111 bits (277), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 95/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  +   V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA+     A+     Y   Y  ++P ++L +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G       T L+  +K N
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKN 189

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  108 bits (271), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R +       YN E+ +E +   LSD  Q
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHCNYSKLVYNRELSMEKIGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERVM 176

Query: 181 KDNMKLDDAIEL 192
            D + ++DA EL
Sbjct: 177 DDFLPVEDATEL 188

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  108 bits (270), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 5/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +    V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            T +  ++ +   I     G   DA  +    +  A  +   Y  +IP  +L +R++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YKDNMKLDD 188
           +K   KL D
Sbjct: 180 FK---KLKD 185

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  108 bits (271), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  ++  V+  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            +++++  I +   G   DA       +  A  +   Y  ++PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  108 bits (269), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDNMKLDDAIEL 192
           +D ++LDDA +L
Sbjct: 177 QDYLELDDADDL 188

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  105 bits (263), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 75/115 (65%), Gaps = 1/115 (0%)

Query: 80  LTADAEILINTARVYAQS-YLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYA 138
           +  D  +LI+ +R  A + Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           GYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D ++L+DAI +A
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIA 115

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  106 bits (265), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  +D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  106 bits (264), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 102/192 (53%), Gaps = 2/192 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
           +T +  ++K++  + +   G   DA      A+  A  +   Y  ++P ++L +R++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDNMKLDDAIE 191
           +K N    D ++
Sbjct: 180 FKKNNNGKDHVQ 191

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  105 bits (263), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 96/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I   D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            T +  L++++  + +   G   DA      A+  A  Y   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  105 bits (261), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + D  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDNMKLDDAIEL 192
            D + + DA EL
Sbjct: 177 DDYLAITDATEL 188

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  105 bits (261), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  +D  V+  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA       +  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  104 bits (259), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 99/183 (54%), Gaps = 3/183 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNM 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K + 
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KLD 187
           K+D
Sbjct: 190 KID 192

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDNMKLDDAIEL 192
            + ++++D  EL
Sbjct: 177 NEYLEIEDEDEL 188

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  103 bits (256), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDNMKLDDAIEL 192
            + + L+D  EL
Sbjct: 177 DNFVDLEDPEEL 188

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  103 bits (256), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN ++ VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDNMKLDDAIEL 192
           +  ++++D  EL
Sbjct: 177 EQFLEVEDPNEL 188

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  103 bits (257), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 100/183 (54%), Gaps = 3/183 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNM 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K + 
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KLD 187
           K+D
Sbjct: 190 KID 192

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  102 bits (255), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K +D + V++AGL  DA +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERVL 176

Query: 181 KDNMKLDDAIEL 192
            D  +++DA EL
Sbjct: 177 DDFREIEDADEL 188

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  103 bits (256), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 95/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K+N
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  102 bits (255), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         YN  + +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDNMKLDDAIEL 192
           ++ +K++ A EL
Sbjct: 177 EEYLKIETADEL 188

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  102 bits (255), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  102 bits (254), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 93/173 (53%), Gaps = 2/173 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++K++  I + + G   DA      A+     +   +  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLE 183

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  101 bits (252), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDNMKLDDAIEL 192
              ++++DA EL
Sbjct: 177 DKFVEIEDAEEL 188

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  102 bits (253), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A++ A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  101 bits (251), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 94/187 (50%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDNMKLD 187
              +K+D
Sbjct: 177 DTFIKID 183

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  101 bits (252), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 99/183 (54%), Gaps = 3/183 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I + V G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNM 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K + 
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KLD 187
           K+D
Sbjct: 190 KID 192

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  102 bits (255), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 99/189 (52%), Gaps = 4/189 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         Y  ++ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDNMKLDDA 189
           ++ ++++DA
Sbjct: 250 EEYLEIEDA 258

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  100 bits (249), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 95/192 (49%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +A+AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDNMKLDDAIEL 192
              ++++D  EL
Sbjct: 177 DQFIEIEDPEEL 188

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  101 bits (251), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++K++  I +   G   DA      A+  A  +   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  100 bits (249), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 93/187 (49%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDNMKLD 187
              +K+D
Sbjct: 177 DTFIKID 183

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  100 bits (248), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 93/187 (49%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K +D + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDNMKLD 187
              +K+D
Sbjct: 177 DTFIKID 183

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  100 bits (249), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 97/187 (51%), Gaps = 6/187 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-AIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I  +   V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  I +   G   DA      A+  A  Y   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--- 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 182 -DNMKLD 187
            D +K D
Sbjct: 191 TDTLKED 197

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 99.0 bits (245), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 93/187 (49%), Gaps = 4/187 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K ++ + +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDNMKLD 187
              +K+D
Sbjct: 177 DTFIKID 183

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 98.6 bits (244), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 96/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ K +  + +++AGL  DA +L N  R         ++ ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDNMKLDDAIEL 192
            D +++D+  EL
Sbjct: 177 DDFLEIDNVEEL 188

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 97.8 bits (242), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + +  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDNMKLDDAIEL 192
              ++++D  EL
Sbjct: 177 DKYIEIEDPEEL 188

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 97.4 bits (241), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 97/192 (50%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120
           +   K+ K ++ + +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDNMKLDDAIEL 192
           ++ ++++DA EL
Sbjct: 177 EEYLEIEDADEL 188

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 96.3 bits (238), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 95/189 (50%), Gaps = 6/189 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADD-GLVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ + +   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIK 119
            +  +K+ K +D + +++AGL  DA +L N  R         +N ++ VE     LSD  
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSKLVFNRDLSVEKAGFLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLERV 175

Query: 180 YKDNMKLDD 188
             +  +L+D
Sbjct: 176 LDEFKELED 184

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 95.9 bits (237), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 52/179 (29%), Positives = 94/179 (52%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMADDGLVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            ++ ++  + +   G   DA      A+  A  +   Y  ++P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+  +K N
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 89.0 bits (219), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/197 (30%), Positives = 94/197 (47%), Gaps = 9/197 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMADDGLVLAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +    VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRL 115
           L    +   K+ K ++ + +++AGL  DA +L N  R         +N ++ VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDNMKLDDAIEL 192
           L+      ++++D  EL
Sbjct: 177 LERTLDTFLEIEDPNEL 193

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 83  DAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A S+ KTY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 96

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 60.5 bits (145), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 45/80 (56%)

Query: 102 YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWK 161
           Y  ++P ++L +R++++ Q YTQ   +RP GV   +   D+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 87/182 (47%), Gaps = 14/182 (7%)

Query: 20  YQVEYALESISHAG--------TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L + SHA         T +G+  + G+V+AA+ + T   +  D + EKL++++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF 131
           +I  A AG  AD E +        + +    N E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLIGSNIELHSLYTNREPRV---VSALQMLKQHLFKYQG--HV 123

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIE 191
           G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K N+  ++AIE
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAIE 182

Query: 192 LA 193
           LA
Sbjct: 183 LA 184

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  D G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +      
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  YAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
             + + +  N E  V   V  L  +KQ   ++ G    G   I AG D   G  L++   
Sbjct: 91  NLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLFSVQA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
            G+      +S+G+ + AA   L+ ++K N+  D+A++LA
Sbjct: 145 HGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  +DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+  +K ++  D+A++LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+  +K ++  D+AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 89

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  GSNIELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+  ++  +  ++AIELA
Sbjct: 145 AHGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELA 185

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 73/158 (46%), Gaps = 6/158 (3%)

Query: 32  AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           AGT +GI  +D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+++ ++   R +  +  G      + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
           +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 184

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+  +K ++  D+AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 85/182 (46%), Gaps = 14/182 (7%)

Query: 20  YQVEYALESISH--------AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF 131
           +I  A AG  AD E +        + +  +   E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHSLSTRREPRV---VTTLQMLKQHLFRYQG--HI 123

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIE 191
           G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ ++  D+AIE
Sbjct: 124 GAYLIVAGVDP-TGAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKDEAIE 182

Query: 192 LA 193
           LA
Sbjct: 183 LA 184

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 83/161 (51%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  D +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+  +K ++  ++AI+LA
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 84/161 (52%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  +
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++  
Sbjct: 90  GSNVELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQ 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+      +S+G+ + AA  +L+ ++K+++  ++AI+LA
Sbjct: 145 AHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLA 185

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 85/161 (52%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  + + EKL+K++ +I  A AG  AD + +  T  +
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAV--TGLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + +    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNLELHSLFTGREPR--VVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSVH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+       S+G+ + AA  +L+ ++K+++  ++AI+LA
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLA 184

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  D G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  YAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
             + +    N E  V   V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NIELHSLYSNREPRV---VSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
            G+       S+G+ + AA  +L+ ++K ++  ++AI+LA
Sbjct: 145 HGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  KL+++  +I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y E  P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+       ++G+ + AA  +L+  +K ++  +DAI+LA
Sbjct: 144 AHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 88/183 (48%), Gaps = 16/183 (8%)

Query: 20  YQVEYALESISHAG--------TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SHA         T +G+  ++G+V+AA+ + T   +  D +  KL++++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TQLISSNLELHSLYASREPR--VVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAI 190
            G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K ++  ++AI
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAI 181

Query: 191 ELA 193
            LA
Sbjct: 182 NLA 184

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 72/159 (45%), Gaps = 6/159 (3%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K+++  D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+++ ++   R +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
            +P G+Y   +  + G+  S     L  Q++ K+  + D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A + I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 80/161 (49%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  KL++++ +I  A AG  AD E +  T  +
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAV--TQLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNIELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+       S+G+ + AA  +L+  +K +M  ++AI+LA
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 8/172 (4%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKI 73
           P      +E+     S + GT +GI  +D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARVYAQSYLKTYNEE-IPVEILVRRLSDIKQGYTQHGGLRPFG 132
            ++  G  AD+  L+   R   + Y    NE+ + +    R +  +  G        P+ 
Sbjct: 79  VISANGFAADSTALVKRFRNSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----FFPYY 134

Query: 133 VSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 135 VHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E R   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 81/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  + G+++AA+ + T   +  D + EKL+++  +I  A AG  AD E +  T  +
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAV--TQLI 89

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 90  SSNIELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 144

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+       S+G+ + AA  +L+ ++  ++  ++AI+LA
Sbjct: 145 AHGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLA 185

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 88  NILISANGFAADGEALVKRFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR----FFP 143

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 144 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 202

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 81/165 (49%), Gaps = 16/165 (9%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+++AA+ + T   +  D +  KL+++  +I  A AG  AD E +  T  V
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAV--TQLV 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDR----YGYQL 148
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D      +  Q 
Sbjct: 89  GSNLELHSLYTHREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFAVQA 144

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           + S   G Y      S+G+ + AA  +L+ ++K ++  ++A++LA
Sbjct: 145 HGSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAMKLA 184

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 79/177 (44%), Gaps = 8/177 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E     +E+A    + + GT +GI  +D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMK 185
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  +
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFE 180

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 74/177 (41%), Gaps = 15/177 (8%)

Query: 20  YQVEYALESISH--------AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           Y  E A   I H         GT +GI  +D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMK 185
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  +
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFE 180

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 86/168 (51%), Gaps = 8/168 (4%)

Query: 27  ESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEI 86
           ++ S   T +G+  D G+++AA+ + T   +  + +  KL++++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 87  LINTARVYAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG 145
           +  T  + +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 84  V--TKLIGSNLELHSMYASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADPT-G 136

Query: 146 YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             L++ +  G+       S+G+ + AA  +L+ +++ ++K ++A++LA
Sbjct: 137 THLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 17/184 (9%)

Query: 20  YQVEYALESISHA--------GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLN 70
           YQ   AL + SH+        GT I G+   +G+++AA+ + T   +  + +  KL++++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITVAVAGLTADAEILINTARVYAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLR 129
            +I  A AG  AD E +  T  + +   L + Y    P   +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAV--TQLIGSNIELHSLYTSREPR--VVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++  M  + A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 IELA 193
           +ELA
Sbjct: 182 VELA 185

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 82/161 (50%), Gaps = 8/161 (4%)

Query: 34  TAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARV 93
           T +G+  + G+V+AA+ + T   +  + +  KL++++ KI  A AG  AD E +  T  +
Sbjct: 31  TIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEEV--TKLI 88

Query: 94  YAQSYLKT-YNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
            +   L + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 89  GSNLELHSLYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIH 143

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
             G+       S+G+ + AA  +L+  +K+++  ++A++LA
Sbjct: 144 AHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLA 184

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 26/179 (14%)

Query: 20  YQVEYALESISH--------AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  + + EKL+++  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPV------EILVRRLSDIKQGYTQH 125
           +I  A AG  AD E         A ++L   N E+          +V  L  +KQ   ++
Sbjct: 69  RIWCAGAGTAADTE---------AVTWLIGSNLELHSLYTGREPRVVSALQKLKQHLFKY 119

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNM 184
            G    G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ M
Sbjct: 120 QG--HIGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 74/170 (43%), Gaps = 8/170 (4%)

Query: 22  VEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARVYAQSYLKTYNEE-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAG 139
            AD E L+   +   + Y    N++ + +    R +  +  G        P+ V  I AG
Sbjct: 78  AADGEALVKRFKNSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHTIIAG 133

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
            D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 72/159 (45%), Gaps = 7/159 (4%)

Query: 32  AGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
            GT +GI  +D  V+A + + T+       +  K++   D I ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKKF 88

Query: 92  RVYAQSY-LKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
           +   + Y     N+++ ++   R +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 89  KNNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKGAVYS 144

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
            +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 145 FDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPD 183

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLND 71
           +S E +   +E+     S + GT +GI  +D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KITVAVAGLTADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD   L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 69  NILISANGFAADGNALVKRFQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKR----FFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ ++   R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSIKWYHFDHNDKKLTMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 75/170 (44%), Gaps = 8/170 (4%)

Query: 22  VEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAG 139
            AD   L+   +   + Y   +N+ ++ ++   R +  +  G        P+ V  I AG
Sbjct: 78  AADGTALVKRFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHTIIAG 133

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
            D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 183

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 66/154 (42%), Gaps = 10/154 (6%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDN 183
           + +P G+Y   +  + GA  S     L M + DN
Sbjct: 146 SFDPVGSYEREQCRAGGAAAS-----LIMPFLDN 174

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 75/165 (45%), Gaps = 15/165 (9%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E   ++   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDNMKLDDAIEL 192
           Y S P G     ++ S+  + SA        +YK++M  ++ IE 
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEF 173

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 74/173 (42%), Gaps = 14/173 (8%)

Query: 22  VEYALESIS-HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGL 80
           +E+     S + GT +GI  +D  VLA + + T+          K++   D I ++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILI----NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFI 136
            AD E L+    N+ + Y   +    ++++ +    R +  +  G        P+ V  I
Sbjct: 77  AADGEALVKRFKNSIKWY---HFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHTI 129

Query: 137 YAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDNMKLD 187
            AG D+     +Y+ +P G+Y      + GA  S     L  Q+++K+    D
Sbjct: 130 IAGLDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPD 182

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQSYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           YT    G+         G+ ++        +++DNM  ++ +  
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNF 173

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E   E+   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           Y+    G+         G+ ++        ++K++M  ++ IE 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEF 173

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y E   E+   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           Y+    G+         G+ ++        ++K++M  ++ IE 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEF 173

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 69/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + Y   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           Y+    G+    K    G+ ++        +YKD M  D+ ++ 
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDF 173

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINT 90
           + GT +GI  +D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARVYAQSYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 70/164 (42%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y     E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           YT    G+         G+ ++        ++++NM  ++ ++ 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVYAQSYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           YT    G+         G+ ++        ++++NM  ++ ++ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   Y   + E    I      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           YT    G+         G+ ++        ++++NM  ++ ++ 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDF 173

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 13/164 (7%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + Y + Y   + E   +    I      + K   T            I AGYD++   ++
Sbjct: 79  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           Y+    G+    K    G+ ++        +YK+NM  D+ +  
Sbjct: 130 YSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSF 173

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/154 (20%), Positives = 66/154 (42%), Gaps = 12/154 (7%)

Query: 42  DGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKT 101
           DG++L A+ + T+     +  T+KL +++DK+    +G  AD + + +  + Y + Y   
Sbjct: 7   DGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYLELYTAQ 66

Query: 102 YNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYT 158
           + E   +    I      + K   T            I AG+DD+   ++Y+    G+  
Sbjct: 67  FGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGFDDKNKGEVYSIPLGGSVH 117

Query: 159 GWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
             K    G+ ++        ++K++M  D+ I  
Sbjct: 118 KQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISF 151

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 7/161 (4%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + +   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
              G+         G+ ++        ++K+NM  ++ I  
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRF 173

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 71/165 (43%), Gaps = 14/165 (8%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           +Y+    G+    K    G+ ++        +YK+NM  D+ ++ 
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDF 174

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 34/161 (21%), Positives = 68/161 (42%), Gaps = 7/161 (4%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + Y + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
              G+         G+ ++         ++++M  ++ I+ 
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDF 173

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 68/161 (42%), Gaps = 12/161 (7%)

Query: 35  AIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTARVY 94
           ++ +   DG++L A+ + T+     +  T+KL ++++KI    +G  AD + + +  + +
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
              Y   Y E   +    +      + K   T            I AGYD++   ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
              G+    K    G+ ++        ++KD+M  D+ +  
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNF 177

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 71/162 (43%), Gaps = 8/162 (4%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  D G++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + + + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
               G+    K    G+ ++        +Y++NM  ++ +E 
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEF 174

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 70/165 (42%), Gaps = 14/165 (8%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL ++ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           +Y+    G+    K    G+ ++        ++KD+M  D+ +  
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNF 174

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK  + +++A+EL 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELG 232

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLG 232

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLG 232

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +Y+ ++ ++DA+ L 
Sbjct: 186 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLG 230

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 188 YYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 71/163 (43%), Gaps = 10/163 (6%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + + + Y   Y   IP     R  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISV-GANTSAAQTLLQMDYKDNMKLDDAIEL 192
           S P G     +  ++ G+ ++        +YK +M  D+ +E 
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEF 174

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLG 232

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLG 232

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 71/161 (44%), Gaps = 7/161 (4%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + Y   Y   + E  P       +   K    Q+      G+  I AGYD++   ++Y+ 
Sbjct: 79  QYYLDMYEGQFGE--PDTYTAANM--FKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
              G+         G+ ++        ++++NM  D+ I+ 
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDF 173

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTYNE 104
           + + + Y   Y E
Sbjct: 79  QYHLELYDSQYGE 91

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       +  K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +D+A+ L 
Sbjct: 187 YYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 231

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 8/162 (4%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL K++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADI- 77

Query: 92  RVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
               Q +L  Y+ +          S  K    ++      G+  I AG+DD     ++Y+
Sbjct: 78  ---VQYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDATNKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
               G+    K    G+ ++        ++KD+M  D+ +  
Sbjct: 133 VPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHF 174

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFW- 130

Query: 89  NTARVYAQSYLKTYNEE--IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
               + +Q  L    E+  I V    + LS++   Y   G      +  +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
            +Y  +  G         VG+  + A  +L  +YK ++ +D+A+ L 
Sbjct: 186 TIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLG 232

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/164 (19%), Positives = 68/164 (41%), Gaps = 4/164 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           ++H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIEL 192
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYL 231

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTY 102
           + Y   Y   Y
Sbjct: 79  QYYLDLYTTQY 89

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/165 (18%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     + I V    + L ++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ ++DA+ L 
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLG 232

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 33  GTAI-GIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVYAQSYLKTY 102
           + + + Y   Y
Sbjct: 79  QYHLELYESQY 89

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + L ++   Y   G      +  +  GY  + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKEGPTI 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 187 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 231

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 32.7 bits (73), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 73/169 (43%), Gaps = 12/169 (7%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEI-- 86
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R++    LK  N  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKN-RISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           G  +Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/165 (19%), Positives = 67/165 (40%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+V+A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + L ++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 186 YYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLG 230

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/165 (18%), Positives = 68/165 (41%), Gaps = 4/165 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + ++       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + L ++   Y  +G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
           Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLG 232

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/162 (18%), Positives = 67/162 (41%), Gaps = 4/162 (2%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 89  NTARVYAQSYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 129 TWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 184

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAI 190
           Y  +  G         VG+  + A  +L  +Y+ ++ +++A+
Sbjct: 185 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEAL 226

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYK-----LNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSD 117
             KL +     L  K+ V +  LT + +   + A++    Y ++  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 32.0 bits (71), Expect = 1.8,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKL 66
           DS   I     RLY+ E A+  I+H     GI + D L L AER      +  + +  KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YKLNDKI 73
           YK+ DK+
Sbjct: 211 YKM-DKV 216

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 71/167 (42%), Gaps = 8/167 (4%)

Query: 29  ISHAGTAIGIMADDGLVLAAERKVTSTLLEQDTSTEKLYKLNDKITVAVAGLTADAEILI 88
           I+H  T +      G+++A + + T+       + +K+ ++N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYW- 130

Query: 89  NTARVYAQSYLKTYNEE--IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY 146
               + +Q  L    E+  I V    + LS++   Y   G      +  +  GY  + G 
Sbjct: 131 -ETWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGP 185

Query: 147 QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDNMKLDDAIELA 193
            +Y  +  G         VG+  + A  +L  +YK ++ +++A+ L 
Sbjct: 186 TVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLG 232

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 20/89 (22%)

Query: 88  INTARVYAQSYLKTYNEEIPV----------EILVRRLSDIKQGYTQHGGLRPFGVSFIY 137
           IN  +   + Y+++ +E + V          + L++ L D K+    HGGL     +F  
Sbjct: 664 INDLKAKVEIYVESSSEPLDVHQFKRMLKRADELIKELEDAKE--VTHGGLASINETFNQ 721

Query: 138 AGYDDRYGY-----QLYTSNPSGNYTGWK 161
           AGY+ +  +       Y SNP    +GW+
Sbjct: 722 AGYNSQQEFAKINLPHYISNP---LSGWQ 747

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,756,983
Number of extensions: 837851
Number of successful extensions: 2061
Number of sequences better than 10.0: 248
Number of HSP's gapped: 1849
Number of HSP's successfully gapped: 248
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)