Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E002703.566ON38838819370.0
NDAI0I032303.566ON38638510451e-140
ZYRO0E09504g3.566ON3773849781e-130
KAFR0J028703.566ON3843839791e-130
TDEL0D063403.566ON4023909301e-123
Kpol_380.73.566ON3853869271e-123
Smik_7.183.566ON3853889161e-121
Skud_7.243.566ON3913909051e-119
YGL243W (TAD1)3.566ON4003878981e-118
KNAG0I002403.566ON3913868961e-118
SAKL0F00836g3.566ON3833878821e-116
KLTH0G00748g3.566ON3853838681e-114
Suva_7.183.566ON3853868641e-113
Kwal_47.192633.566ON3833848631e-113
TPHA0G036403.566ON3963848331e-108
Ecym_25963.566ON3873848241e-107
TBLA0E002303.566ON3943918151e-106
KLLA0A00759g3.566ON3803838031e-104
CAGL0H07733g3.566ON3853777496e-96
AFR267W3.566ON3853807481e-95
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00270
         (388 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   750   0.0  
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   407   e-140
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   381   e-130
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   381   e-130
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   362   e-123
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   361   e-123
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   357   e-121
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   353   e-119
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   350   e-118
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   349   e-118
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   344   e-116
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   338   e-114
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   337   e-113
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   337   e-113
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   325   e-108
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   322   e-107
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   318   e-106
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   313   e-104
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   293   6e-96
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   292   1e-95

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/388 (95%), Positives = 371/388 (95%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS 60
           MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS
Sbjct: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS 60

Query: 61  TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANG 120
           TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANG
Sbjct: 61  TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANG 120

Query: 121 KYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGR 180
           KYHLRAKWKLILYISRLPCGDASMRTL                 EFQYIDPNIPTILRGR
Sbjct: 121 KYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGR 180

Query: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240
           LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ
Sbjct: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240

Query: 241 LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG 300
           LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG
Sbjct: 241 LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG 300

Query: 301 ETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQT 360
           ETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQT
Sbjct: 301 ETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQT 360

Query: 361 ARLELIKYTNEILSSEGWLPTQPDDFAV 388
           ARLELIKYTNEILSSEGWLPTQPDDFAV
Sbjct: 361 ARLELIKYTNEILSSEGWLPTQPDDFAV 388

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  407 bits (1045), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 274/385 (71%), Gaps = 2/385 (0%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS 60
           M  E  L DR+A ++Q++Y+ LK SSKPV RSNG+KEWTV A  + ++++T +L++ISL+
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLA 60

Query: 61  TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANG 120
           TGVKALP+KEL RSGGKM+HD HAEI+ALRGFNTV+L+ I  + +N  ++DL+  S  + 
Sbjct: 61  TGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQL-KNGEETDLVIHSKDSE 119

Query: 121 KYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGR 180
            Y  ++  K+ LYIS+LPCGD SMR L                   QYI+ +  TILRGR
Sbjct: 120 YYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDS-IQYINQDNKTILRGR 178

Query: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240
           LNF++ G VRTKPGRLDS  T SKSCSDKLC++Q TSILNC+T+ LL+ PV++DY+++P 
Sbjct: 179 LNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPG 238

Query: 241 LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG 300
           +  + K D+ L F  + +        + YL+T+ +F + +N   +EPS++ +IK+F+ QG
Sbjct: 239 MTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQG 298

Query: 301 ETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQT 360
            +IE+ +LNGVKNGSYTK NKPLRKNCE++VSR++QW I+K I P YS  SYL+FK+SQ 
Sbjct: 299 NSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQH 358

Query: 361 ARLELIKYTNEILSSEGWLPTQPDD 385
            R +LI YT   +S +GW+ TQ DD
Sbjct: 359 ERRKLIDYTRSKMSPDGWISTQEDD 383

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/384 (51%), Positives = 255/384 (66%), Gaps = 13/384 (3%)

Query: 4   EVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGV 63
           +V L +R+A+ V E Y KL  S KP  RSNGVKEWTVLA  + +D    +L++IS++TGV
Sbjct: 3   DVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGV 62

Query: 64  KALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNL-RQSDLLEISDANGKY 122
           KALPD  L RSGGKM+HDCHAEILALR FN V+L  I  +N N   Q DL+E +  +  +
Sbjct: 63  KALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLF 122

Query: 123 HLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLN 182
           H +  W+L +YIS LPCGDASM  L                   Q++DP + +I+RGR N
Sbjct: 123 HFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDD----PIQFVDPAVTSIVRGRFN 178

Query: 183 FSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLN 242
           +SR  VVRTKPGR DS  TL KSCSDKLC RQV SILNCMTW LL+ PV++ YL+ P   
Sbjct: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP--- 235

Query: 243 YDNKNDLL-LSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGE 301
             N  DLL  SF +R+K   +   P+K L  + +F  DK+   EEPS+MSSIKL+ T   
Sbjct: 236 --NTTDLLHQSFYDRIKV--LPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPES 291

Query: 302 TIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA 361
           T+E+ALLNG+KNG YTKGNKPLR+NCE  VSRYAQW ++K + P ++  +YL+FK +   
Sbjct: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQD 351

Query: 362 RLELIKYTNEILSSEGWLPTQPDD 385
           R  LI+   ++LS +GW+ T  DD
Sbjct: 352 RNALIQDCRKLLSPKGWISTSRDD 375

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  381 bits (979), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 196/383 (51%), Positives = 262/383 (68%), Gaps = 9/383 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMISLSTGVK 64
           L D +AK+V EEY++LK SSKPV RSNG KEWTVLA+ + ++ N    +LK+I++STGVK
Sbjct: 5   LGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTGVK 64

Query: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHL 124
           A+P+  L RS G+++HDCHAEILALRGFN VLLK++ ++  N   S  L+ S   GK+  
Sbjct: 65  AMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNN-ETSSFLDKSAQGGKFRW 123

Query: 125 RAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNFS 184
           ++KWKL LY+SRLPCGDASM  L                   QYIDP    ILRGR+NF 
Sbjct: 124 KSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDD---RLQYIDPGKSKILRGRMNFK 180

Query: 185 RNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYD 244
           R G VRTKPGRLDS  TLSKSCSDKLC++Q+TS LN +TW L++TPV++ YL+IP+LN  
Sbjct: 181 RKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELNDT 240

Query: 245 NKNDLLLSFQNRLKCSKVN-YRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETI 303
           +K  L+  F  RL CS ++     ++LT    F++DK   ++ PS+ S IK+F +Q  TI
Sbjct: 241 DKKALIRCFHTRL-CSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299

Query: 304 EEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNY-SATSYLEFKRSQTAR 362
           E+A+LNGVKNG YTK +KPLR+ CESI+SRY+QW++YK +  +  +  SYL+FK  Q  R
Sbjct: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359

Query: 363 LELIKYTNEILSSEGWLPTQPDD 385
            +L++     LS   W+ T  DD
Sbjct: 360 RDLVENAKICLSHGSWIATLKDD 382

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 203/390 (52%), Positives = 264/390 (67%), Gaps = 11/390 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLD--SNTGNLKMISLSTGVK 64
           L DR+AK+ ++EY KL  + KPV+RSNG KEWTVL+  + +D  S    L+++S+ TGVK
Sbjct: 10  LGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGVK 69

Query: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNM-NQNLRQSDLLEISDANGKYH 123
           ALPD  L RS G+M+HDCHAEILALRGFNTVLL+ ++ M  +   ++DL+E + A G   
Sbjct: 70  ALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTA-GVCI 128

Query: 124 LRAKWKLILYISRLPCGDASMRTLXX---XXXXXXXXXXXXXXXEFQYIDPNIPTILRGR 180
           L++KWKL LYIS LPCGDASM+ L                    E Q+ID  I +ILRGR
Sbjct: 129 LKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILRGR 188

Query: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240
            N+ R GVVRTKPGR DS  T SKSCSDKLC++QVTSILN +TWSL+  PVF+DYL+IP 
Sbjct: 189 FNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVIPN 248

Query: 241 LNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQG 300
           L  D    +  SFQ+RL   ++  + ++ L   V F ++K+  +EEPSSMSS+KLFL   
Sbjct: 249 LAVDRCQGVHHSFQDRL--GRLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDLP 306

Query: 301 E--TIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRS 358
           E    E+A+LNG+KNG YTKGNKPLRKNCES VSR AQW IY  I P+    +YLEFK  
Sbjct: 307 ERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKAG 366

Query: 359 QTARLELIKYTNEILSSEGWLPTQPDDFAV 388
            + R  +I+   ++LS +GW+ T+ DD  +
Sbjct: 367 LSERNRIIQEVKKVLSPDGWISTRNDDCHI 396

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 182/386 (47%), Positives = 257/386 (66%), Gaps = 9/386 (2%)

Query: 4   EVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGV 63
           E  L D+++ I+ EEY+KLK SSKP  RSN VKEWTVLA+ + + ++   +  I++STGV
Sbjct: 3   EKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITISTGV 62

Query: 64  KALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYH 123
           KA P+ EL RS GK++HDCH+EIL+LR FNT LL+ +  +++   +S  +  + A+GKY+
Sbjct: 63  KATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEG-DKSKFILPAKADGKYN 121

Query: 124 LRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNF 183
               +K+ LYIS+LPCGDASM TL                  +Q+IDP I T++RGRLN+
Sbjct: 122 WNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGRLNY 181

Query: 184 SRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNY 243
           S+  VVRTKPGR DS  TLSKSCSDKLC++Q  SILN + W L + P+F+ Y++IP L  
Sbjct: 182 SKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPTL-- 239

Query: 244 DNKNDLLL----SFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQ 299
             K++LLL     F  RL+   +   P+ +LT   KF +DK  I  EP+ +SSIK+ L +
Sbjct: 240 --KDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPR 297

Query: 300 GETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQ 359
              IE++++NGV+NGSYTK NKPL+KNC+S +S+Y+QW ++K +     A SY+E+K+SQ
Sbjct: 298 EHQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQ 357

Query: 360 TARLELIKYTNEILSSEGWLPTQPDD 385
           T R +L       LS +GW+ T  DD
Sbjct: 358 TLREDLKDIIKSKLSPDGWISTFQDD 383

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  357 bits (916), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 257/388 (66%), Gaps = 8/388 (2%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLD--SNTGNLKMIS 58
           M  E  L DR++  V  EY+KLKP  +PV R  GVKEWTVLA  + ++  ++T N+ ++S
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118
           ++TGVKA+PD EL RSGGK++HDCHAEILALRG NTVLL  I   N     SD ++ +D 
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNP-ANGSDFIQSNDE 119

Query: 119 NG-KYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTIL 177
              ++ L+  W+L LYIS+LPCGDAS+  L                 EFQY++ ++ TIL
Sbjct: 120 TPPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTIL 179

Query: 178 RGRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLL 237
           RG LNF+R  VVRTKPGR DS  TLSKSCSDKL +++++SILN + + L   PVF+ Y++
Sbjct: 180 RGNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVV 239

Query: 238 IPQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFL 297
           IP L  + K+ L  SF +RL     N+  + +++    F +DK    + PS M SIKLF+
Sbjct: 240 IPGLENEVKHVLKQSFHDRL--PNANHETI-FMSCNTSFYDDKAGEEDVPSLMCSIKLFM 296

Query: 298 TQGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKR 357
               T EEA+LNGVKNG YTK +KPLRK+C+S+VSR+AQW ++K+I P Y   SYL+FK 
Sbjct: 297 ND-HTNEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKS 355

Query: 358 SQTARLELIKYTNEILSSEGWLPTQPDD 385
           SQ  R  LI    +ILS +GW+PT+ DD
Sbjct: 356 SQKRRTRLIIAIKDILSPDGWIPTKIDD 383

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 183/390 (46%), Positives = 253/390 (64%), Gaps = 8/390 (2%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMIS 58
           M  +  L + ++  V  EY+KLK   KP  R  G+KEWT+LA  ++++ + G  N++++S
Sbjct: 7   MSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLS 66

Query: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118
           ++TGVKALPD EL RSGGK++HDCHAEILALRG NTVLLK I + +     SD +E ++ 
Sbjct: 67  VATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDP-ANGSDFIESNNE 125

Query: 119 NG-KYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTIL 177
              +++L+  W+L LYISRLPCGDASM  L                  FQY+DP + TIL
Sbjct: 126 IPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTIL 185

Query: 178 RGRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLL 237
           RGRLNF +  VVRTKPGR DS  TLSKSCSDKL ++Q++SILN + + L + PV++ Y++
Sbjct: 186 RGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIV 245

Query: 238 IPQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFL 297
           IP +    K+ L  SF NRL C   +   +++L     F +D+    + PSSM SIKLF+
Sbjct: 246 IPDIEDKTKHILERSFHNRLPC---DGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFV 302

Query: 298 TQGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKR 357
               T EEA+ NG+KNG YTK +KPLRK+C+S VSR+AQW ++++I P + + SYL FK 
Sbjct: 303 NDSST-EEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKS 361

Query: 358 SQTARLELIKYTNEILSSEGWLPTQPDDFA 387
            Q  R  LI      LS +GW+ T+ DD +
Sbjct: 362 QQKERNRLITTAKNALSPDGWISTRIDDVS 391

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  350 bits (898), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 183/387 (47%), Positives = 250/387 (64%), Gaps = 7/387 (1%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMIS 58
           M  E  L + ++  V  EY+KLK + +P++R +G++EWT+LA    ++ + G   ++++S
Sbjct: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76

Query: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118
           ++TGVKALPD EL RS GK++HDCHAEILALRG NTVLL  I N N +     +    + 
Sbjct: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136

Query: 119 NGKYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILR 178
             +++L+  W+L LYISRLPCGDASM +                  EFQY+D ++ TILR
Sbjct: 137 PARFNLKENWELALYISRLPCGDASM-SFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILR 195

Query: 179 GRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLI 238
           GRLNF+R  VVRTKPGR DS  TLSKSCSDKL ++Q +S+LNC+ + L + PVF+ Y++I
Sbjct: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255

Query: 239 PQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLT 298
           P L  + K+ L  SF  RL         +K+L     F +DK    + P  M S+KLF+ 
Sbjct: 256 PNLEDETKHHLEQSFHTRLPNLD---NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMD 312

Query: 299 QGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRS 358
              T EEA+LNGV+NG YTK +KPLRK+C+S VSR+AQW ++K+I P Y   SYLEFK  
Sbjct: 313 DFST-EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSR 371

Query: 359 QTARLELIKYTNEILSSEGWLPTQPDD 385
           Q  R +LI     ILS +GW+PT+ DD
Sbjct: 372 QKKRSQLIIAIKNILSPDGWIPTRTDD 398

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  349 bits (896), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/386 (46%), Positives = 254/386 (65%), Gaps = 6/386 (1%)

Query: 6   LLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG-NLKMISLSTGVK 64
           LL + +A +V  EY++L  SSKP +RSNG KEWT+L+  + +  + G  L++ISL+TGVK
Sbjct: 4   LLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGVK 63

Query: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLE-ISDANGKYH 123
           A P+++L RS G+++HDCHAEILALRGFN VLL+ +     N R   +L  I D N K+ 
Sbjct: 64  ATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTN-KFR 122

Query: 124 LRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNF 183
           L  +++L L+ISRLPCGD SM +L                   QYIDPN  ++LRGR N+
Sbjct: 123 LNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNY 182

Query: 184 SRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNY 243
           ++ G VRTKPGR+DS  T SKSCSDKLC  Q TSILN  TW L++  V+IDYL++P ++ 
Sbjct: 183 AKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISA 242

Query: 244 DNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETI 303
            ++N L   F  RL  +      M+ L+    F++D+    E+PSS+S +KL++T+GET+
Sbjct: 243 SDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGETL 302

Query: 304 EEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSA--TSYLEFKRSQTA 361
           E+A+L+G++NG +TK +KPLR NCE+ VSR +QW ++  +NP  S   TSY +FK     
Sbjct: 303 EQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLVP 362

Query: 362 RLELIKYTNEILSS-EGWLPTQPDDF 386
           R ELI  T  +L++ + W+PT  DDF
Sbjct: 363 RAELITRTRSLLTNGQPWIPTCSDDF 388

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 180/387 (46%), Positives = 244/387 (63%), Gaps = 7/387 (1%)

Query: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLS 60
           M  E  +    +K++ E Y +LKP  KP +RSNG+KEWTVLA  + ++     ++++SL 
Sbjct: 1   MSYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLG 60

Query: 61  TGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQS-DLLEISDAN 119
           TGVKA P++EL RS GK++HDCHAEILALRGFNTVLL  +  + Q   +  DL+E +   
Sbjct: 61  TGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDG 120

Query: 120 GKYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRG 179
             + +   W   LYIS+LPCGD+SM TL                   QY++ N  T+LRG
Sbjct: 121 LSFKVPDHWSFALYISKLPCGDSSMDTLEEEDLNSFNIENTDAC---QYLEQNNHTLLRG 177

Query: 180 RLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIP 239
           R N+ + G VRTKPGR DS  TLSKSCSDKL +RQVTS+LN + W L DTP+++ Y++IP
Sbjct: 178 RFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIP 237

Query: 240 QLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFL-T 298
            L+      L  SF+ RL C+  ++  +++L+ +  F +DK    ++PSSMSSI L +  
Sbjct: 238 NLDEHALVGLERSFE-RL-CNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHN 295

Query: 299 QGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRS 358
            GE  +EA+LNGVKNG Y K  KPLRKNCESIVSR +QW +Y  I+ N    +YL+FK +
Sbjct: 296 NGEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKST 355

Query: 359 QTARLELIKYTNEILSSEGWLPTQPDD 385
           Q  R  L       LS +GW+PT  DD
Sbjct: 356 QVERNILKNEAKLCLSPDGWIPTGVDD 382

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  338 bits (868), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 250/383 (65%), Gaps = 10/383 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKAL 66
           + D++A++  E Y KLKPS+KP +RSNG KEW VLA  + ++    +L+++SL+TGVKA 
Sbjct: 7   VADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLATGVKAA 66

Query: 67  PDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNM--NQNLRQSDLL-EISDANGKYH 123
           P+++L RS G+++HDCHAEILALRGFN VLLK I  +  +Q+    DL+   SD +G Y 
Sbjct: 67  PNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSDNSGIYR 126

Query: 124 LRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNF 183
           L  +W   LYISR PCGDASM  L                   QY+D N  TI+RGR N+
Sbjct: 127 LNEEWSFALYISRAPCGDASMGLL-----YDEGCISFTDDDRCQYVDDNNKTIIRGRFNY 181

Query: 184 SRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNY 243
           ++ G VRTKPGR DS  TLSKSC+DKLC +QV SILN +TW LL+ PVF++Y++IPQL  
Sbjct: 182 AKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQLPR 241

Query: 244 DNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGE-T 302
             + D   +F  R+K S V    ++ L+ + +F +DK +  + PS MSSI L + +G+ T
Sbjct: 242 VAEADFERAFDTRIKDS-VPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLNIIEGQVT 300

Query: 303 IEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTAR 362
            ++++LNGVK G++ K   PL+KNCE++VSR +QW ++K+I     + +Y EFK  QT R
Sbjct: 301 QQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKSQQTDR 360

Query: 363 LELIKYTNEILSSEGWLPTQPDD 385
             L +     LS +GW+ T+ DD
Sbjct: 361 NALKERIRLALSKDGWVGTESDD 383

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  337 bits (864), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 249/386 (64%), Gaps = 16/386 (4%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMISLSTGVK 64
           L ++++  V  EY+KLK   +PV R +G++EWT+LA    ++ N    N+K++S++TGVK
Sbjct: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66

Query: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLL---KDIDNMNQNLRQSDLLEIS-DANG 120
           +LPD EL RS GK++HDCHAEILALRG NTV L   KD D  N +    DL+E + +   
Sbjct: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGD----DLIESNNEIPP 122

Query: 121 KYHLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGR 180
           K+ L+ KW+L LYIS+LPCGDASM  L                  FQY+DP++ TILRGR
Sbjct: 123 KFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILRGR 182

Query: 181 LNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQ 240
           LNF +  VVRTKPGR DS  TLSKSCSDKL +RQ +SILN +  +L   PVF+ Y++IP 
Sbjct: 183 LNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVIPN 242

Query: 241 LNYDNKNDLLLSFQNRLK-CSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQ 299
           L+   ++ L  SF NRL  CS       ++L     F +DK      PS M S KLF+  
Sbjct: 243 LDEKTRHTLEQSFHNRLPFCS----HRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMND 298

Query: 300 GETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQ 359
             T+EEA+LNG+KNG YTK  KPLRK+CES +SR+AQW ++ +I P Y  TSYL+FK  Q
Sbjct: 299 S-TVEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQ 357

Query: 360 TARLELIKYTNEILSSEGWLPTQPDD 385
           T R +LI      LS +GW+PT+ DD
Sbjct: 358 TERNQLITLIKGALSPDGWIPTKTDD 383

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/384 (45%), Positives = 246/384 (64%), Gaps = 10/384 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKAL 66
           L D+++ +    Y KLKPS+KPV+RSNGVKEW VLA  + +  + G L+++SL+TGVK+ 
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG-LRLVSLATGVKST 65

Query: 67  PDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNM--NQNLRQSDLLE-ISDANGKYH 123
           P+ EL RS G+++HDCHAEILALRGFN VLLK I  +   +     DL+   SD +GK+ 
Sbjct: 66  PNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGKFK 125

Query: 124 LRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNF 183
           L   W   LYISR+PCGDASM  L                   QY++P   TILRGR N+
Sbjct: 126 LGDDWSFALYISRIPCGDASMDLLQSESDMEFSEDTSC-----QYVNPCNRTILRGRFNY 180

Query: 184 SRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNY 243
           ++ G VRTKPGR DS  TLSKSCSDKLC RQV SILN MTW L+++P+F+ Y+++P+++ 
Sbjct: 181 NKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVSN 240

Query: 244 DNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETI 303
             +     +F++RL+      + ++ L    +F +DK  + + PSS+S I L    G+  
Sbjct: 241 TARRGFESAFKDRLR-EFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQPE 299

Query: 304 EEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTARL 363
           ++++LNGVK+G+Y +  KPLRKNCE+++SR AQW ++K++       SY  FK  Q AR 
Sbjct: 300 QQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVARN 359

Query: 364 ELIKYTNEILSSEGWLPTQPDDFA 387
            L       LSS+GW+ T PDDFA
Sbjct: 360 VLKNKVRSSLSSDGWISTGPDDFA 383

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  325 bits (833), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 167/384 (43%), Positives = 246/384 (64%), Gaps = 9/384 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKAL 66
           + ++V+  V  EY+KL+PSSKPV++SN V EWTVLA  + +++ TG  + I+++TGVKA 
Sbjct: 16  IAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITTGVKAT 75

Query: 67  PDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHLRA 126
           PD +L RS GK+IHDCHAEILALR FN  LL  I+ ++ +   S  ++++  N  Y    
Sbjct: 76  PDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTSKFVQVTKTNS-YEWNK 134

Query: 127 KWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNFSRN 186
           KW L LYIS+LPCGDASM  L                   QYIDP   T +RGRLN+ + 
Sbjct: 135 KWDLALYISKLPCGDASMDDL--MKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLNYKKR 192

Query: 187 GVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYDNK 246
            V+RTKPGR DS  TLSKSC+DKLC++QV  IL+     L+  P+F+ Y++IP+++   +
Sbjct: 193 DVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRIS-GKE 251

Query: 247 NDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKN--FITEEPSSMSSIKLFLTQGETIE 304
           + L  +F +RL+      +  K+++    F +D +   I  EP+ ++SIK+F+     +E
Sbjct: 252 SILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNRVME 311

Query: 305 EALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSA---TSYLEFKRSQTA 361
           ++++NGVKNG Y+K  KPLRKNCE I+SRY++W++ K+I  N +     SYLEFK + T 
Sbjct: 312 QSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKSTLTK 371

Query: 362 RLELIKYTNEILSSEGWLPTQPDD 385
           R+ L +    +LS +GW+ T+ DD
Sbjct: 372 RMTLQQEVRSLLSPDGWITTKKDD 395

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  322 bits (824), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/384 (46%), Positives = 247/384 (64%), Gaps = 9/384 (2%)

Query: 6   LLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKA 65
           LL + V+++V ++Y+ LK S+KP ++SNG+KEWTVLA  + +D NT  L++IS++TGVKA
Sbjct: 7   LLAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKA 66

Query: 66  LPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQS-DLLEISDANGKYHL 124
           LP++EL RS G+M+HD HAEILALR FN VLLK +  +  N  ++ DL+E  +    Y +
Sbjct: 67  LPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRM 126

Query: 125 RAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNFS 184
           R +WK+ LYISR PCGD SM  L                   QYI+P I T LRGR N+ 
Sbjct: 127 RKRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCC---QYINPGIRTTLRGRFNYD 183

Query: 185 RNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYD 244
             GV RTKPGR DS  TLSKSCSDKL  +QV SILN   W LL+TPVF+ YL++PQ + +
Sbjct: 184 CKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHRE 243

Query: 245 NKND-LLLSFQNR-LKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGET 302
             +D  L +F  R L  ++V+   M + +   KF+ DK   ++ P  +S + + +   E 
Sbjct: 244 KASDGCLRNFHYRLLGLNEVHSIEMIFCSK--KFNGDKEEESQTPCPISGVYINIKPMEM 301

Query: 303 -IEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA 361
            IEE +LNGV NG Y K  +PLRKNCESI+SR + W ++ ++    ++ SYL+FK  QT+
Sbjct: 302 DIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTS 361

Query: 362 RLELIKYTNEILSSEGWLPTQPDD 385
           R +L +     LSS+GW+PT  DD
Sbjct: 362 RNQLKEQVRLHLSSDGWIPTSADD 385

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  318 bits (815), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 171/391 (43%), Positives = 253/391 (64%), Gaps = 14/391 (3%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLL-DSNTGNLKMISLSTGVKA 65
           L D++A ++  EYNKLK S+KP+ +SNG+KEWT+++  + + + +T  +K+ISL+TGVKA
Sbjct: 6   LGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLATGVKA 65

Query: 66  LPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMN-QNLRQSDLL-EISDAN-GKY 122
            PD EL RS G ++HDCHAEILA+RGFNT LL++I+N    +    DL+ ++ ++   KY
Sbjct: 66  TPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKCKKY 125

Query: 123 HLRAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLN 182
               ++ L LYIS+LPCGD+SM                      QY+DP I TILRGR+N
Sbjct: 126 SWNDEYDLGLYISKLPCGDSSMEEENSLESNSLIQFQENDLT--QYVDPTIRTILRGRIN 183

Query: 183 FSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLN 242
           ++++G VRTKPGR+DS  T SKSCSDK+C++QV S+LN +   LL++P++I YL+ P + 
Sbjct: 184 YNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPDIK 243

Query: 243 YDNKNDLLLSFQNRLK------CSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLF 296
             N   L  SF NR++       S   Y P+ ++ ++++F + K    +EPS  S +K+F
Sbjct: 244 PQNLILLKKSF-NRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVKIF 302

Query: 297 LTQGE-TIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEF 355
            +  +  +E++++NGVK G+YTK +KPL KN  +IVSR  QW+I+K I P +   SYL F
Sbjct: 303 NSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYLTF 362

Query: 356 KRSQTARLELIKYTNEILSSEGWLPTQPDDF 386
           KR QT R+E      + LS +GW+ T  DD 
Sbjct: 363 KRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 234/383 (61%), Gaps = 8/383 (2%)

Query: 5   VLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVK 64
            ++ DR+A  V   Y+KL  S KP +RSNGV EWTVL+  +  D      + ISL TGVK
Sbjct: 2   AVIADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVK 61

Query: 65  ALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHL 124
           A P++EL RS G+++HDCHAE++ LR FN +LLK+I ++ QN ++S L+E S A+G Y +
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDL-QNGQKSFLIEKS-ADG-YKV 118

Query: 125 RAKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEF--QYIDPNIPTILRGRLN 182
           +  WK  +YISR+PCGDASM  L                     QY+ P I TI+RGR N
Sbjct: 119 KDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRAN 178

Query: 183 FSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLN 242
           +    VVRTKPGR DS  TLSKSCSDKL ++Q+ SI N +TWSLL +PV+++++++P+  
Sbjct: 179 YKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPKQY 238

Query: 243 YDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGET 302
              +  L  +F  RLK     + P K+L     FS D+  ++++PS  S + L+    E 
Sbjct: 239 QYEQVQLEDTFWLRLK--NQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLY-GSNEA 295

Query: 303 IEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTAR 362
           + E +LNGVKNG Y KG KPLRK C+SI+SR AQW  +K+I    S T Y  FK S   R
Sbjct: 296 VSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVDR 355

Query: 363 LELIKYTNEILSSEGWLPTQPDD 385
             +I      LS+ GW+ T  D+
Sbjct: 356 NHIISKAKATLSASGWISTCRDN 378

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  293 bits (749), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 233/377 (61%), Gaps = 6/377 (1%)

Query: 10  RVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKALPDK 69
           ++ ++V  EY KL    +PV RSNG KE T++A+ +  D+ T    +++++TGVK+ P+ 
Sbjct: 10  KITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTPND 69

Query: 70  ELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDANGKYHLRAKWK 129
           EL+RS GK++HDCHAEILALRGFN +LL+ I    + + +S+L+  +  NG +    + +
Sbjct: 70  ELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGI-ESNLIH-NTPNG-FEWNNELE 126

Query: 130 LILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNFSRNGVV 189
           L L+IS+LPCG+ SM  L                   QYI P I TILRGR NF++   V
Sbjct: 127 LTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKRNYV 186

Query: 190 RTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYDNKNDL 249
           RTKPGR+DS  T SKSCSDKL +R  TS+LN +T  ++ TP++I   +IP +N     ++
Sbjct: 187 RTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINSHQIEEM 246

Query: 250 LLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETIEEALLN 309
            L F NR      + R +   T+  KF +D +  T  PSSMS++K+     +  EE +LN
Sbjct: 247 NLYF-NRPMDLHSSARRLYIHTSHYKFGDDLSPET-PPSSMSALKILFNDNDIQEEQILN 304

Query: 310 GVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA-RLELIKY 368
           GVKNG YTK +KPLRKNCES VSRY+ W ++  ++  +   +YLEFKR   A R ELI+ 
Sbjct: 305 GVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAERAELIRS 364

Query: 369 TNEILSSEGWLPTQPDD 385
               LSS+GWL T  DD
Sbjct: 365 IKSSLSSDGWLSTAEDD 381

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  292 bits (748), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 158/380 (41%), Positives = 219/380 (57%), Gaps = 9/380 (2%)

Query: 7   LPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGVKAL 66
           L + +   V  +Y   KPSSKP  RSNG  EWTVLA  +L+D  T   +++S +TGVKAL
Sbjct: 6   LAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAATGVKAL 65

Query: 67  PDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLR-QSDLLEISDANGKYHLR 125
           PDKEL RS G+M+HD HAEILALRGFN VLL+    +      + DL+E +    ++ L 
Sbjct: 66  PDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQDRFRLA 125

Query: 126 AKWKLILYISRLPCGDASMRTLXXXXXXXXXXXXXXXXXEFQYIDPNIPTILRGRLNFSR 185
           ++W+  LYIS+ PCGD SM                      QY+  +  T+LRGR N+SR
Sbjct: 126 SRWQAALYISKAPCGDCSMDMA----DDDADEMTFSPDDPIQYVAEHNYTMLRGRFNYSR 181

Query: 186 NGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLNYDN 245
            GV RTKPGR DS  TLSKSCSDKL  + V S+L+ MTW L + PVF+DYL++P  +   
Sbjct: 182 KGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLP--HTIA 239

Query: 246 KNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGETIEE 305
                  F  RL   +  + P + L     F  D+    + P+  +S+ L +T  + +E+
Sbjct: 240 TAGFERCFAERLAGLEGTHMP-RLLCCHTAFPGDRAAPQQPPALTASVYLNITAKKHVEQ 298

Query: 306 ALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTARLEL 365
           ALLNGV+NG+Y +  + L  + E+IVSR A W ++ +++      SY  FKR Q AR  L
Sbjct: 299 ALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHARNRL 357

Query: 366 IKYTNEILSSEGWLPTQPDD 385
            ++    LS +GW  T+ DD
Sbjct: 358 KRHVRHRLSPDGWPTTRVDD 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,351,059
Number of extensions: 1782009
Number of successful extensions: 5698
Number of sequences better than 10.0: 34
Number of HSP's gapped: 5795
Number of HSP's successfully gapped: 34
Length of query: 388
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 277
Effective length of database: 40,753,473
Effective search space: 11288712021
Effective search space used: 11288712021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)