Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0E002603.567ON55853722760.0
NDAI0I032403.567ON56354316650.0
TDEL0D063503.567ON56554814410.0
ZYRO0E09526g3.567ON56054114380.0
YGL244W (RTF1)3.567ON55854114350.0
Skud_7.233.567ON56454514270.0
Smik_7.173.567ON56554614200.0
Suva_7.173.567ON56954814130.0
TPHA0A060003.567ON54954014060.0
Kpol_507.103.567ON46146213880.0
CAGL0H07711g3.567ON56655113980.0
KAFR0J028803.567ON55532312491e-166
KNAG0I002303.567ON57133312271e-163
KLTH0G00726g3.567ON56134612021e-159
SAKL0F00814g3.567ON57433111701e-154
Kwal_47.192653.567ON56734611681e-154
AFR266W3.567ON56234611281e-148
Ecym_25973.567ON56233211251e-147
TBLA0E002203.567ON57033711041e-144
KLLA0A00737g3.567ON58233410511e-136
Kpol_1054.581.530ON40164770.86
Smik_4.6255.417ON98241761.3
Skud_10.3644.375ON1648191732.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0E00260
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   881   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   645   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   559   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   558   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   557   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   554   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   551   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   548   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   546   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   539   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   543   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   485   e-166
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   477   e-163
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   467   e-159
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   455   e-154
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   454   e-154
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   439   e-148
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   437   e-147
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   429   e-144
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   409   e-136
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    34   0.86 
Smik_4.625 Chr4 complement(1118384..1121332) [2949 bp, 982 aa] {...    34   1.3  
Skud_10.364 Chr10 complement(649306..654252) [4947 bp, 1648 aa] ...    33   2.8  

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/537 (83%), Positives = 448/537 (83%)

Query: 22  QVLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISXXXXXXXQNPFPLE 81
           QVLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNIS       QNPFPLE
Sbjct: 22  QVLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISEEEEEMEQNPFPLE 81

Query: 82  GKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEX 141
           GKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEE 
Sbjct: 82  GKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEG 141

Query: 142 XXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXXXXXXX 201
                           D            RERKGLHRR                      
Sbjct: 142 TKTRTSTRTTHATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEEEEEEYDEEEYK 201

Query: 202 XXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFY 261
                      NPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFY
Sbjct: 202 KDEDSEYEEEYNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFY 261

Query: 262 PGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNR 321
           PGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNR
Sbjct: 262 PGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNR 321

Query: 322 KVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDT 381
           KVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDT
Sbjct: 322 KVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDT 381

Query: 382 IVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKH 441
           IVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKH
Sbjct: 382 IVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKH 441

Query: 442 HENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEV 501
           HENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEV
Sbjct: 442 HENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEV 501

Query: 502 XXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
                               NEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI
Sbjct: 502 QQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/543 (63%), Positives = 391/543 (72%), Gaps = 8/543 (1%)

Query: 22  QVLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISXXXXXXXQNPFPLE 81
           Q+LTTS KRAKNH+   SKRKKIEVDSEAEEE++ D   +G GN S        NPFPLE
Sbjct: 23  QLLTTSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDDYNPYG-GNQSEEEEIDEPNPFPLE 81

Query: 82  GKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEX 141
            KYKDE DRE LESLPEMERETLLFERSQ MRKYQERKLFRERQRN+KEQQ+RN   EE 
Sbjct: 82  NKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNELEEEG 141

Query: 142 XXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERK----GLHRRXXXXXXXXXXXXXXXXXX 197
                           D            RERK      +                    
Sbjct: 142 KKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDDNYKHE 201

Query: 198 XXXXXXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAK 257
                          NPY  +  Y  DK DEVEWAEEQTDRE ELDDFNKVK+GRSF+AK
Sbjct: 202 DSEYEEEGEEDEEDYNPYATRKSYDMDK-DEVEWAEEQTDREAELDDFNKVKVGRSFIAK 260

Query: 258 YCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQ 317
           YCFYPGF++L+KGCYG+VNVGTDRRTG +SYRMVKIEK+FL+ PYRMG+FFTNQY GVTQ
Sbjct: 261 YCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQ 320

Query: 318 GSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQ 377
           G +RKV QMN FSDGLFT  EF+RY R+L+ SH+TKPSI+ L+ K+KEIQ+F+SEPLT +
Sbjct: 321 GHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAK 380

Query: 378 LMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSV 437
           + D IVRNRM+FNKKLSGTNAVLEKTVL+DKLRYA+ENNNERDVAKYSSQLRNLEKR+SV
Sbjct: 381 MTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSV 440

Query: 438 YEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIY 497
           YEKHHENDQ+G NKLGALTSKNRKVNMDKI+N  H KKE+ G DSKSDPFSRLKTRTKIY
Sbjct: 441 YEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIY 500

Query: 498 YQEVXXXXXXXXXXXXXXXXXX-XXNEA-QARKENELLLAKFRRLGGLENMINSLNLDVN 555
           YQEV                     N+A    KE ELLLA+F+RLGGLEN+I +L+++V 
Sbjct: 501 YQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVT 560

Query: 556 FDI 558
           FDI
Sbjct: 561 FDI 563

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/548 (54%), Positives = 360/548 (65%), Gaps = 17/548 (3%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDD-------YDPGNFG--AGNISXXXXXX 73
           VLTTS KR K  ++ASSKR+KI V+   E+ED+       Y+P      +G  S      
Sbjct: 23  VLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEED 82

Query: 74  XQ---NPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKE 130
            +   NPFPLEGKYKD+ DR  LE LPEMERETLLFERSQ M+KY +R+LFRER RN+KE
Sbjct: 83  EEEEENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKE 142

Query: 131 QQQRNAPSEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXX 190
           QQ +N    E                 D            RE+KG HR            
Sbjct: 143 QQ-KNRQLREGNKTRSSARTTHATGHSDLKASKLSQLRKQREQKG-HR---ANRDRDFEE 197

Query: 191 XXXXXXXXXXXXXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKI 250
                                 +PY RK      K        +Q DRE ++ DFNK+KI
Sbjct: 198 EEEEEEDRYEGSEYEDEDEEDYDPYNRKSHRDARKGRRSGMGRDQLDREADITDFNKIKI 257

Query: 251 GRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTN 310
           GRSFVAK+CFYPGFN+++KG YG+VNVG D+R+G T YRMVKIEK+F QKPY MG FFTN
Sbjct: 258 GRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNFFTN 317

Query: 311 QYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFI 370
           QYFGVTQG +RKVFQMNFFSDG FT  E++RY+R+LD  HITKPS+Y+L NKAKE+ +F+
Sbjct: 318 QYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMNAFV 377

Query: 371 SEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRN 430
           S+PLT++L D IVRNRMLFNKKLSG+NAVLEKTVL++KLRYAQE  N+RD+AKYSSQLRN
Sbjct: 378 SQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQLRN 437

Query: 431 LEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRL 490
           L KR+S YEKHHE DQ G  KLGALTSKNRKVNMD+I+N  H KKE++ FD+KSDPFSRL
Sbjct: 438 LVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKEDVNFDAKSDPFSRL 497

Query: 491 KTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSL 550
           KTRTK+YYQE+                     EA AR+E ELL + F+RLGGLE +I  +
Sbjct: 498 KTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLERVIGQM 557

Query: 551 NLDVNFDI 558
            L   FD+
Sbjct: 558 QLPFTFDV 565

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/541 (53%), Positives = 364/541 (67%), Gaps = 8/541 (1%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDD----YDPGNFGAGNIS-XXXXXXXQNP 77
           VL +S KR+   + ASSK+++IEV+   ++ED+    Y+P   GAG           +NP
Sbjct: 23  VLASSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEENP 82

Query: 78  FPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAP 137
           FPLEGKYKDEADR+ L  LPEMERET+LFERSQ M+KYQ+RK+FR+R +NLKEQQQR+  
Sbjct: 83  FPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQ 142

Query: 138 SEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXXX 197
            EE                 D            RE+K  +R                   
Sbjct: 143 QEEGKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNR--PYSDEEEEGEDEGDDYG 200

Query: 198 XXXXXXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAK 257
                          +PY R+ R+ ED+ DEV+WAEE  DRE  + DFNK KIGRSFVA 
Sbjct: 201 YEDKKYSDEEDEEEYDPYSRRSRFEEDE-DEVQWAEEALDREANVADFNKAKIGRSFVAN 259

Query: 258 YCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQ 317
           +CFYPGFN++++G YG+VNVGTD+R+G T YRMVKIEK+FLQKPY MG+F TNQYFGVTQ
Sbjct: 260 FCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQ 319

Query: 318 GSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQ 377
           G +RKVFQM +FSDG  T  EFERY+ +L+  HIT PS+Y+L+NKAKEI SF+S+PLTEQ
Sbjct: 320 GKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQ 379

Query: 378 LMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSV 437
           L + IVRNRM+FNKKLSG NAVLEKTVL++KL+YA E  NERD+AKYSSQLR+ EKR+S 
Sbjct: 380 LTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMST 439

Query: 438 YEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIY 497
           YEK HEND+VG NKL ALT+KNR+VN+D++KN    KKE+  FDSKSDPFSRLKTRTK Y
Sbjct: 440 YEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFY 499

Query: 498 YQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFD 557
           YQE+                         RK++ELL A+FRRLGGL+ +I +++   + D
Sbjct: 500 YQEIQKEENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSID 559

Query: 558 I 558
           I
Sbjct: 560 I 560

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/541 (54%), Positives = 368/541 (68%), Gaps = 10/541 (1%)

Query: 22  QVLTT-SNKRAKNHEHASSKRKKIEVDS--EAEEEDDYDPGNFGAGNISXXXXXXXQNPF 78
           QVLTT S KRAKN++ + SK+++IEV S  + +EEDDY+P + G  +          NPF
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDYNPYSVGNADYGSEEEEEA-NPF 80

Query: 79  PLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPS 138
           PLEGKYKDE+DRE LESLPEMERETLLFERSQ M+KYQERKLFR R R++KEQQQR    
Sbjct: 81  PLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKND 140

Query: 139 EEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXXXX 198
           E+                 D            R RK  H                     
Sbjct: 141 EDSRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRH---YSDNEDEDDEEDYREEDY 197

Query: 199 XXXXXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKY 258
                         NP++R+  Y + +  E    E++ DRE E+ DFNK++IGRSFVAK+
Sbjct: 198 KDDEGSEYGDDEEYNPFDRRDTYDKREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAKF 257

Query: 259 CFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQG 318
           CFYPGF + +KGCYG+VNVGTD+RTG TSYRMV+IE++FLQKPY MG+F+TNQYFGVTQG
Sbjct: 258 CFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQG 317

Query: 319 SNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQL 378
            +RKVFQMN+FSDGLF  DE++RY+R+LD S + KPS+++L NK KE+  F++ PLT++ 
Sbjct: 318 KDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKT 377

Query: 379 MDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVY 438
            D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+AKYS+QLRN EKR+SVY
Sbjct: 378 TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVY 437

Query: 439 EKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEI-GFDSKSDPFSRLKTRTKIY 497
           EKHHENDQ    KLG LTSKNRK+NM  I+N  H KKE+   FDSKSDPFSRLKTRTK+Y
Sbjct: 438 EKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKVY 497

Query: 498 YQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFD 557
           YQE+                     +A+ ++E ELL+A+FRRLGGLE M+    LD+ FD
Sbjct: 498 YQEIQKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGE--LDIKFD 555

Query: 558 I 558
           +
Sbjct: 556 L 556

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/545 (53%), Positives = 369/545 (67%), Gaps = 14/545 (2%)

Query: 22  QVLT-TSNKRAKNHEHASSKRKKIEVDS------EAEEEDDYDPGNFGAGNISXXXXXXX 74
           QVLT TS KRAKN++ + SK+++IEVDS      E EEEDDY+P  +  GN         
Sbjct: 22  QVLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNP--YSVGNAGYGSEGEE 79

Query: 75  QNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQR 134
            NPFPLEGK+KDE DRE LESLPEMERETLLFERSQ M+KYQERKLFR R R++KEQQQR
Sbjct: 80  ANPFPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQR 139

Query: 135 NAPSEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXX 194
               E+                 D            R RK  +R+               
Sbjct: 140 AKDKEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARK--NRQYSDNEDEEDDEDEYR 197

Query: 195 XXXXXXXXXXXXXXXXXXNPYERKGRYSE--DKNDEVEWAEEQTDRETELDDFNKVKIGR 252
                             NP++RK  Y +  ++ +  E  E++ DRE E+ D+NK++IGR
Sbjct: 198 EDNYKNEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIGR 257

Query: 253 SFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQY 312
           SFVAK+CFYPGF +++KGCYG+VN+GTD+RTG TSYRMV+IE++FLQKPY MG+F+TNQY
Sbjct: 258 SFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQY 317

Query: 313 FGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISE 372
           FGVTQG +RKVFQMN+FSDG F  DE+ RY ++LD SH+ KPS+++L NK KE+  F++ 
Sbjct: 318 FGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNT 377

Query: 373 PLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLE 432
           PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+AKYS+QLRN E
Sbjct: 378 PLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFE 437

Query: 433 KRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEE-IGFDSKSDPFSRLK 491
           KR+S+YEKHHENDQ     LG LTSKNRK+NM  I+N  H KKE+   FDSKSDPFSRLK
Sbjct: 438 KRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLK 497

Query: 492 TRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLN 551
           TRTK+YYQE+                     EA+ ++E ELLLA+FRRLGGLE MI  L+
Sbjct: 498 TRTKVYYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGELD 557

Query: 552 LDVNF 556
           +  +F
Sbjct: 558 IKFDF 562

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/546 (54%), Positives = 370/546 (67%), Gaps = 15/546 (2%)

Query: 22  QVLTT-SNKRAKNHEHASSKRKKIEVDS-------EAEEEDDYDPGNFGAGNISXXXXXX 73
           QVLTT S KRAKN++ + SK+++IEV +       + +EEDDY+P  +  GN S      
Sbjct: 22  QVLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNP--YSVGNASYGSEEV 79

Query: 74  XQ-NPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQ 132
            + NPFPLEGKYK+E+DRE LESLPEMERETLLFERSQ M+KYQERKLFR R R++KEQQ
Sbjct: 80  EEPNPFPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQ 139

Query: 133 QRNAPSEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXX 192
           QR    E+                 D            R RK  H               
Sbjct: 140 QRAKNDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRH--YSDNEGEVDDEDE 197

Query: 193 XXXXXXXXXXXXXXXXXXXXNPYERKGRYSE-DKNDEVEWAEEQTDRETELDDFNKVKIG 251
                               NP++R   Y + ++  E    E++ DRE E+ DFNKV+IG
Sbjct: 198 YREDDYKDDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPEISDFNKVRIG 257

Query: 252 RSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQ 311
           RSFVAK+CFYPGF +++KGCYG+VNVGTD+RTG TSYRMV+IE++FLQKPY MG+F+TNQ
Sbjct: 258 RSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQ 317

Query: 312 YFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFIS 371
           YFGVTQG +RKVFQMN+FSDGLF  DE++RY+R+LD S I KPS+++L NK KE+  F++
Sbjct: 318 YFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVN 377

Query: 372 EPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNL 431
            PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+AKYS+QLRN 
Sbjct: 378 TPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNF 437

Query: 432 EKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEI-GFDSKSDPFSRL 490
           EKR+SVYEKHHENDQ    KLG LTSKNRK+NM  I+N  H KKE++  FDSKSDPFSRL
Sbjct: 438 EKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRL 497

Query: 491 KTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSL 550
           KTRTK+YYQE+                      A+ ++E ELLLA+FRRLGGLE MI  L
Sbjct: 498 KTRTKVYYQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGEL 557

Query: 551 NLDVNF 556
           ++  +F
Sbjct: 558 DIKFDF 563

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/548 (53%), Positives = 370/548 (67%), Gaps = 15/548 (2%)

Query: 22  QVLT-TSNKRAKNHEHASSKRKKIEVDSEAEEE---------DDYDPGNFGAGNISXXXX 71
           QVLT TS KRAKN++ + SK+++IEV S  EEE         + Y  GN G G  S    
Sbjct: 22  QVLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYG--SEEEE 79

Query: 72  XXXQNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQ 131
               NPFPLEGKYKDE+DRE LESLPEMERETLLFERSQ M+KYQERKLFR R +++KEQ
Sbjct: 80  EVEPNPFPLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQ 139

Query: 132 QQRNAPSEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXX 191
           QQR    ++                              ++R   +R+            
Sbjct: 140 QQRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQE 199

Query: 192 XXXXXXXXXXXXXXXXXXXXXNPYERKGRYSE--DKNDEVEWAEEQTDRETELDDFNKVK 249
                                NP++RKG Y +  ++ +  E  E++ DR+ E+ DFNK++
Sbjct: 200 EYREDDYKNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLR 259

Query: 250 IGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFT 309
           IGRSFVAK+CFYPGF +++KGCYG+VNVGTD+RTG TSYRMV+IE+IFLQKPY MG+FFT
Sbjct: 260 IGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFT 319

Query: 310 NQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSF 369
           NQYFGVTQG +RKVFQMN+FSDGLFT DE++RY ++LD SH+ KPS++TL NK KE+  F
Sbjct: 320 NQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDF 379

Query: 370 ISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLR 429
           ++ PLT++  D +VR+RM FNKKLSGTNAVLEKTVLR+KL+YA+E NNE+D+AKYS+QLR
Sbjct: 380 VNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLR 439

Query: 430 NLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIG-FDSKSDPFS 488
           N EKR+SVYEKHHENDQ     LG LTSKNRK+N+  I+N  H KKE+   FDSKSDPFS
Sbjct: 440 NFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFS 499

Query: 489 RLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMIN 548
           RLKTRTK+YYQE+                     E++ R+E ELLLA+FRRLGGLE MI 
Sbjct: 500 RLKTRTKVYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMIG 559

Query: 549 SLNLDVNF 556
            L++  +F
Sbjct: 560 ELDIKFDF 567

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/540 (53%), Positives = 364/540 (67%), Gaps = 18/540 (3%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISXXXXXXXQNPFPLEG 82
           V+++++KR +++E + SK++ I V  +  +EDDY+P + G G+           PFPLEG
Sbjct: 24  VISSTSKRGRSNEDSVSKKRHINVGED--DEDDYNPASAGLGDDDDNDDEEEA-PFPLEG 80

Query: 83  KYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEXX 142
           KY+DE DR+ LESLPEMERETLLFERSQ M+KY++R LFRERQR LK Q++    S E  
Sbjct: 81  KYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRE----SSENR 136

Query: 143 XXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXXXXXXXX 202
                          D            RERK  H                         
Sbjct: 137 KVRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHH--YSDEDDEDEYEEEENIYEDKYE 194

Query: 203 XXXXXXXXXXNPYERKGRYSEDKNDE-VEWAEEQTDRETELDDFNKVKIGRSFVAKYCFY 261
                     +PY+RK  Y+E+  +E V+WA++ TDRE+ ++DFNK+KIGRSFVAKYCFY
Sbjct: 195 EGSEYEDESYDPYKRKSTYAEESEEEDVKWADD-TDRESNVNDFNKIKIGRSFVAKYCFY 253

Query: 262 PGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNR 321
           PGFN+++K CYG+VNVG ++ T    YRMVKIEK+FLQKPY MG FFTNQYFGVTQG +R
Sbjct: 254 PGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVTQGKDR 313

Query: 322 KVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDT 381
           KVFQM FFSDG  T DE+ERYVR+L++S++T PS Y L NK KE+  F++EP+T +L D 
Sbjct: 314 KVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMTVKLTDE 373

Query: 382 IVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKH 441
           +VRNRM+FNKKLSGTNAVLEKTVLR+KL +A++NN+ERD+AKYSSQLRNLEKRL  YEKH
Sbjct: 374 VVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLMTYEKH 433

Query: 442 HENDQVGSNKLGALTSKNRKVNMDKIK---NTGHEKKEEIGFDSKSDPFSRLKTRTKIYY 498
           HENDQ G+ KLG LTSKNRK+NMDKIK   N   ++ E   FD K+DPFSRLKTRTK+YY
Sbjct: 434 HENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDE--SFDIKTDPFSRLKTRTKVYY 491

Query: 499 QEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
           QE+                     EA  +KE ELLLAKFRRLGGLE++++  NLD+N  +
Sbjct: 492 QEIQEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVH--NLDINIKL 549

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/462 (59%), Positives = 331/462 (71%), Gaps = 5/462 (1%)

Query: 99  MERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEEXXXXXXXXXXXXXXXXXD 158
           MERETLLFERSQ M+KYQ+RKLFRERQRNLK QQ+ N  ++E                 D
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 159 XXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXXNPY 215
                       RE K  +R+                                    +PY
Sbjct: 61  VKASKLSQLKRQRE-KNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDPY 119

Query: 216 ERKGRY-SEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGK 274
            RK RY  E++ ++V+WAEE T+RE+++DDFNK+KIGRSFVA+YCF+P FNE++KGCYG+
Sbjct: 120 SRKPRYREEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCYGR 179

Query: 275 VNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLF 334
           VNVG DRRT  T+YRMVKIEK+FLQKPY MG+FFTNQYFGVTQG +RKVFQMNFFSDG  
Sbjct: 180 VNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPI 239

Query: 335 TPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLS 394
           T +EF+RY RSLD S+ +KPS+Y+L  K KEI  F+SEP+T++L D IVRNRM+FNKKLS
Sbjct: 240 TIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKKLS 299

Query: 395 GTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGA 454
           GTNAVLEKTVLR KL+YA+ENNNERD+AKYS+QLRNLEKRLS YEKHHENDQ G+ KLGA
Sbjct: 300 GTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKLGA 359

Query: 455 LTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXX 514
           LTSKNRKVNMDK KN  H K+E+I FDSK+DPFSRLKTRTKIYYQEV             
Sbjct: 360 LTSKNRKVNMDKAKNVEHVKEEDINFDSKADPFSRLKTRTKIYYQEVQKEENEKAKELAQ 419

Query: 515 XXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNF 556
                   EA A+KE ELLLAKFRRLGGLE++I+S++++++ 
Sbjct: 420 QKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/551 (54%), Positives = 365/551 (66%), Gaps = 21/551 (3%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEE-----EDDYDPGNFGAGNISXXXXXXXQNP 77
           VLTT+NKR K   ++  K+++IEVDSE EE     +D Y+P +              +NP
Sbjct: 22  VLTTTNKRTKGSSNSQVKKRRIEVDSEDEEDDYNPDDGYEPVDVS----DKEEEEEEENP 77

Query: 78  FPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAP 137
           FPLEGKYKD ADR+ LESLPEMERET+LFERSQ MRKYQERKLFRER RNLK  QQ+   
Sbjct: 78  FPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLK--QQKIQA 135

Query: 138 SEEXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXRERKGLHRRXXXXXXXXXXXXXXXXX- 196
            E+                 D            RERK   RR                  
Sbjct: 136 GEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEF 195

Query: 197 -----XXXXXXXXXXXXXXXXNPYERKGRYSEDKNDEVEWAEE---QTDRETELDDFNKV 248
                                +PY RK +Y++D ++E +   E   Q DR+ E+ DFNK+
Sbjct: 196 KDDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKI 255

Query: 249 KIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFF 308
           +IGRSFVAKYCFYPGFNELI+GCYG+VNVG D+RTG  +YRMVKIEK+FLQKPY MG+FF
Sbjct: 256 RIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFF 315

Query: 309 TNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQS 368
           TNQYFGVTQG +RKVFQMNFFSDG F   EFERY+++LD+S+I KPS Y +K K KEI  
Sbjct: 316 TNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISE 375

Query: 369 FISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQL 428
           FIS+PLTE+L D IVRNRM+ NKKLSGTNAVLEKT+L+DKLRYA+EN NE D+AKYS QL
Sbjct: 376 FISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQL 435

Query: 429 RNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEE-IGFDSKSDPF 487
           RN EKR+++YEKHHENDQ    KL  LTSKNRK+NM++I+N    KKEE + FDSKSDPF
Sbjct: 436 RNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPF 495

Query: 488 SRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMI 547
           SRLKTRTK+YYQE+                     E +  KE +L+LA+FRRLGGL+ +I
Sbjct: 496 SRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKII 555

Query: 548 NSLNLDVNFDI 558
            S+N+D+  DI
Sbjct: 556 GSINVDIKLDI 566

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  485 bits (1249), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/323 (70%), Positives = 272/323 (84%), Gaps = 1/323 (0%)

Query: 236 TDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEK 295
           TDR+TEL+DFNK++IGRSFVAK+CFYP F E++KGCYG+VNVG D+RTG TSYRMVKIE+
Sbjct: 234 TDRDTELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIER 293

Query: 296 IFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPS 355
           IFLQKPY MG+FFTNQYFGVTQG +RKVFQM+FFSDGL TP E+ERY+RSL++SHI KP+
Sbjct: 294 IFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPT 353

Query: 356 IYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQEN 415
           +YTLK+K+KE+ SF+SEPLTE+L + IVRNRM+FNKKLSGTNAVLEKTVL++KL+YA+E 
Sbjct: 354 VYTLKSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARET 413

Query: 416 NNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKK 475
           NNERDVAKYS+QLRN EKR+++YEKHHENDQ GS KLGALTSKN+KVNMDK++N  H KK
Sbjct: 414 NNERDVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKK 473

Query: 476 EEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQARKENELLLA 535
           E++  D KSDPFSRLKTRTKIYYQE+                     EA  RKE ELLLA
Sbjct: 474 EDLPID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLA 532

Query: 536 KFRRLGGLENMINSLNLDVNFDI 558
           +FRRLGGLE MI+ LN++ +  I
Sbjct: 533 QFRRLGGLEKMISGLNIEFDLGI 555

 Score =  100 bits (250), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 90/121 (74%), Gaps = 5/121 (4%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDP----GNFGAGNISXXXXXXXQNPF 78
           VLTTS +  ++ + +++K+++IE DS+ +E+D Y+P    G  GA N +       +NPF
Sbjct: 22  VLTTSKRTKQSGDSSANKKRRIESDSDEDEDD-YNPAAIDGGDGAYNENDDEEEYEENPF 80

Query: 79  PLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPS 138
           PLEGKYK+E DR+ LESLPEMERET+L++RSQTMRKY+ER+ F++R +NLK Q++RN   
Sbjct: 81  PLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNEDD 140

Query: 139 E 139
           E
Sbjct: 141 E 141

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  477 bits (1227), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 233/333 (69%), Positives = 271/333 (81%), Gaps = 6/333 (1%)

Query: 229 VEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSY 288
           V+WAE+  DR +EL DFNK++IGRSFVAK+CFYPGFN+L+ GCYG+VNVG D+R+G T Y
Sbjct: 240 VKWAED-NDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLY 298

Query: 289 RMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDT 348
           RMVKIEK+FLQKPY MG+F+TNQYFGVTQG +RKVFQMNFFSDG FT +E+ERY+RSL+T
Sbjct: 299 RMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLET 358

Query: 349 SHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDK 408
           ++I++PS + L NK+KEI SFI+EPLTE+L D IVRNRMLFNKKLSGTNAVLEKTVLR K
Sbjct: 359 ANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSK 418

Query: 409 LRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIK 468
           L+YA+E+NNERDVAKYS+QLRN EKR++ YEKHHEND  G+ KLGALTSKNRKVNM K K
Sbjct: 419 LQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTK 478

Query: 469 NTGHEKKEEIG---FDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQ 525
           N  H KKE+      DSKSDPFSRLKTRTKIYYQEV                     EA 
Sbjct: 479 NYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEAD 538

Query: 526 ARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
            RKE ELLLA+FRRLGGLENMI+ +N  VNFDI
Sbjct: 539 ERKEKELLLAQFRRLGGLENMISKIN--VNFDI 569

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 87/132 (65%), Gaps = 22/132 (16%)

Query: 22  QVLT-TSNKRAKNHEHASSKRKKIEVDSEAE-----------EEDDYDP---GNFGAGNI 66
           +VLT T +KR+K  +  +SK+++I   SE E           EEDDY+P   GN+  G+ 
Sbjct: 22  RVLTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGD- 80

Query: 67  SXXXXXXXQNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQR 126
                   QNPFPL+GKYKDE DRE LESLPE+ERET+LF+RSQTMRKYQERKLFRER+R
Sbjct: 81  -DEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR 139

Query: 127 NLKEQQQRNAPS 138
                QQ   P+
Sbjct: 140 -----QQEAKPT 146

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  467 bits (1202), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 226/346 (65%), Positives = 277/346 (80%), Gaps = 3/346 (0%)

Query: 214 PYERKGRYSEDKNDEVEWAE-EQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCY 272
           P  +KG+ +ED+ +E++WAE E  DRE EL DFN++KIGRSFVAK+CFYP FN++IKGCY
Sbjct: 218 PMYKKGK-TEDE-EELKWAEDEDLDREPELGDFNRIKIGRSFVAKFCFYPEFNDMIKGCY 275

Query: 273 GKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDG 332
           G+VNVG D+R+G T YRMVKIEK+FLQKPY MG+FFTNQYFGVTQG NRKVFQMNFFSDG
Sbjct: 276 GRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKNRKVFQMNFFSDG 335

Query: 333 LFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKK 392
             T  EFERY+RSL+TS I KPS+Y + NK+ EI SF+S+P+T +L D +VRNRM+FNKK
Sbjct: 336 AITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFVSQPVTSKLTDELVRNRMIFNKK 395

Query: 393 LSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKL 452
           LSGTNAVLEKT+L+DKL+YA+E+ +ERDVAKYSSQLRNLEKRLS YEKHHENDQ GS KL
Sbjct: 396 LSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLEKRLSSYEKHHENDQAGSKKL 455

Query: 453 GALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXX 512
           GALTSKNR+VN+DK KN    KKE+  FD+K+DPFSRLKTRTKIYYQE+           
Sbjct: 456 GALTSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRLKTRTKIYYQEIQREENEKAKEL 515

Query: 513 XXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
                    +     KE +LLLAKF+ LGGLE++I++++  V+ D+
Sbjct: 516 ARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMDFQVSLDV 561

 Score = 91.7 bits (226), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 6/113 (5%)

Query: 24  LTTSNKRAKNHEHASSKRKKIEVDSEAEEEDD------YDPGNFGAGNISXXXXXXXQNP 77
           + +S KR+++   +SSKR+ ++ D E +++++      Y+P        S        NP
Sbjct: 26  IGSSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDYNPEAASYDMDSEEDEDEEPNP 85

Query: 78  FPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKE 130
           FPLEGKYK+E DR  LESLPEMERET+LFERSQTM+KYQER++ +ER +N+++
Sbjct: 86  FPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRD 138

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  455 bits (1170), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 216/331 (65%), Positives = 262/331 (79%), Gaps = 1/331 (0%)

Query: 229 VEWAE-EQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTS 287
           V+WAE E  DR+T L DFNKVKIGRSFVAK+CFYPGFNEL++  YG+VNVG D+ TG T+
Sbjct: 244 VKWAETEDFDRDTGLADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTA 303

Query: 288 YRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLD 347
           YRMVKIEK+FLQKPY MG+FFTNQYFGVTQG +RKVFQMNFFSDG  T  E+ERY++SL+
Sbjct: 304 YRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLE 363

Query: 348 TSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRD 407
              I KPS+Y L NK+KEI  F+S+P+T +L D IVRNRM+FNKKLSGTNAVLEKTVL++
Sbjct: 364 KYGINKPSVYNLNNKSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKE 423

Query: 408 KLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKI 467
           KL+YA+E +NERD+AKYSSQL+NLEKR+S YEKHHENDQ G  KLG LTSKNRK+N+D+I
Sbjct: 424 KLQYAKETSNERDIAKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRI 483

Query: 468 KNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEAQAR 527
           K+    +K+++ FD+KSDPFSRLKTRTKIYY+EV                         R
Sbjct: 484 KHAELVQKDDVNFDAKSDPFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGTATR 543

Query: 528 KENELLLAKFRRLGGLENMINSLNLDVNFDI 558
           KENELLLAKFR LGGLE +I  ++L +N ++
Sbjct: 544 KENELLLAKFRSLGGLEEIIGGIDLQINVNL 574

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/55 (70%), Positives = 49/55 (89%)

Query: 76  NPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKE 130
           NPFPLEGKYKDE DR QLESLPEMERE+LLFERSQ M++YQER+  ++R +N+++
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRD 147

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  454 bits (1168), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/346 (63%), Positives = 268/346 (77%), Gaps = 2/346 (0%)

Query: 214 PYERKGRYSEDKNDEVEWAEEQ-TDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCY 272
           P  +K +  ED ++EV+WAEE   DR+ EL DFNKVKIGRSFVAK+CFYP FN+LI+GCY
Sbjct: 223 PGYKKDKIDED-DEEVKWAEEDDLDRDPELSDFNKVKIGRSFVAKFCFYPEFNDLIRGCY 281

Query: 273 GKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDG 332
           G+VNVG D+R   T YRMVKIE++FLQKPY MG+FFTNQYFGVTQG +RKVFQMNFFSDG
Sbjct: 282 GRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDG 341

Query: 333 LFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKK 392
             T  EFERY++SLD S I  PS+YTL NK+ EI  F+S+P+T +L D +VRNRMLFNKK
Sbjct: 342 AITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTPKLTDELVRNRMLFNKK 401

Query: 393 LSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKL 452
           LSGTNAVLEKT+LRDKL+YA+E  +ERDVAKYSSQLR+LE+RL+ YEKHHENDQ GS KL
Sbjct: 402 LSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLTSYEKHHENDQAGSKKL 461

Query: 453 GALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXX 512
           GALTS+NR+ NMDK KN    KKE+  FD+K+DPFSRLKTRTKIYYQE+           
Sbjct: 462 GALTSRNRRANMDKGKNVDTTKKEDTPFDAKTDPFSRLKTRTKIYYQEIQKEENEKAKEL 521

Query: 513 XXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
                    N   A KE +LLLA+F+ LGGLE +++ ++  ++ ++
Sbjct: 522 ARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSGIDFKLSIEV 567

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 81/111 (72%), Gaps = 8/111 (7%)

Query: 27  SNKRAKNHEHASSKRKKIEVDSEAEEEDD----YDP--GNFG--AGNISXXXXXXXQNPF 78
           S KR+++ ++AS+KR+ ++ D E +E+DD    Y+P  G +G  +G          +NPF
Sbjct: 30  SKKRSRSSQNASNKRRIVDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEEDEEEEENPF 89

Query: 79  PLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLK 129
           PLEGKYKDE DRE LESLPEMERETLLF+RSQ M+KY+ER++ +ER RN++
Sbjct: 90  PLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIR 140

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  439 bits (1128), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 210/346 (60%), Positives = 263/346 (76%), Gaps = 4/346 (1%)

Query: 213 NPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCY 272
           +P++ +  Y E+  DEV+WAE+  DR+ ELDDFNK+K+GRSFVAK+CFYP FN+ ++GCY
Sbjct: 219 DPHDGRQLYREEA-DEVKWAEDDLDRDAELDDFNKIKVGRSFVAKFCFYPEFNQRVQGCY 277

Query: 273 GKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDG 332
           G+VN+G D+ TG   YRMVKIEK+FLQKPY MG+FFTNQYFGVTQG +RKVFQMNFFSDG
Sbjct: 278 GRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDG 337

Query: 333 LFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKK 392
                E+ERY+  +    I KPS+YTL NKAK++ +F+S+P+T +L D IVRNRM FNKK
Sbjct: 338 PILQPEYERYLNQIAKHDINKPSLYTLNNKAKDLTNFVSQPMTPKLTDQIVRNRMQFNKK 397

Query: 393 LSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKL 452
           L+GTNAVLEKTVLRDKL+YA++ NNE+D+AKYSSQL+NLEKR+S YEKHHENDQ G  KL
Sbjct: 398 LTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQLKNLEKRMSSYEKHHENDQTGIRKL 457

Query: 453 GALTSKNRKVNMDKIKNTGHEKKEEIG-FDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXX 511
            ALTSKNRKVN+DKI++  + KKE+    + K+DPFSRLKTRTKIYYQE+          
Sbjct: 458 DALTSKNRKVNLDKIRHVENVKKEDSATLNVKTDPFSRLKTRTKIYYQEIQQEENEKAQE 517

Query: 512 XXXXXXXXXXNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFD 557
                      E   RK+   LLAKFRRLGGLE+ ++ L+  +  D
Sbjct: 518 LAKQKQQQDKEEKHDRKQQ--LLAKFRRLGGLEDALSKLDFRIKLD 561

 Score =  100 bits (248), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 78/121 (64%), Gaps = 16/121 (13%)

Query: 25  TTSNKRAKNHEHASSKRKKIEVDSEAEEEDD-------------YDPG---NFGAGNISX 68
            TS KR+K+    S KR+ ++ +S  +E++D             Y+PG    F  G+ + 
Sbjct: 26  VTSQKRSKHDSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHEAS 85

Query: 69  XXXXXXQNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNL 128
                 +NP+PL GKY+D+ADRE +E++PEMERETLLFERSQ M+KYQERK+ RER +N+
Sbjct: 86  EDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKNI 145

Query: 129 K 129
           +
Sbjct: 146 R 146

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  437 bits (1125), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/332 (62%), Positives = 257/332 (77%), Gaps = 1/332 (0%)

Query: 224 DKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRT 283
           D ++EV+WAEE  DR+ EL+DFNKVKIGRSFVAK+CFYP F E ++ CYG+VN+G D+ T
Sbjct: 227 DHDNEVKWAEEDLDRDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHT 286

Query: 284 GTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYV 343
           G   YRMVKIE++FLQKPY MG+FFTNQYFGVTQG +RKVFQMN+FSDG  T  EFERY+
Sbjct: 287 GLPMYRMVKIERVFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYL 346

Query: 344 RSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKT 403
             +    + KPS+YTL NKAKE+ +F+S+P+T +L D IVRNRM+FNKKL+GTNAVLEK+
Sbjct: 347 NQMAKYDMNKPSLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKS 406

Query: 404 VLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVN 463
           VL+DKL+YA++ NNE  VAKY++QL+NLEKR+S YEKHHENDQ G  KLGALTSKNRKVN
Sbjct: 407 VLKDKLQYAKDTNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVN 466

Query: 464 MDKIKNTGHEKKEEIG-FDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXN 522
           MDKI+   + +KE+    D+KSDPFSRLKTRTKIYYQE+                     
Sbjct: 467 MDKIRLAENVRKEDSSNVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDK 526

Query: 523 EAQARKENELLLAKFRRLGGLENMINSLNLDV 554
           E Q  KE +LLLAKFRRLGGLE +++S+   +
Sbjct: 527 ETQENKERQLLLAKFRRLGGLEEIVSSIPFKI 558

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 77/123 (62%), Gaps = 16/123 (13%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSE-------------AEEEDDYDPG---NFGAGNI 66
           V+ +S KR+KN    S KR  ++ D E             +E EDDY+PG   +F   + 
Sbjct: 21  VMVSSKKRSKNDIAGSKKRMLMDDDDEDDSNDDEDNDVEDSEGEDDYNPGTQYDFEGNDD 80

Query: 67  SXXXXXXXQNPFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQR 126
                   +NP+PLEGKYKDE DR +++ +PEMERETLLFERSQ M+KYQERK+ R+R +
Sbjct: 81  GSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQERKVLRQRAK 140

Query: 127 NLK 129
           +++
Sbjct: 141 SIR 143

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  429 bits (1104), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 208/337 (61%), Positives = 255/337 (75%), Gaps = 4/337 (1%)

Query: 223 EDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRR 282
           ED +D+V+WAE+  DRE+ + DFNK+KIGRSF  K+CFYP FN+++K CY KVNV  DR 
Sbjct: 237 EDDDDDVKWAED-IDRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH 295

Query: 283 TGTTSYRMVKIEKIFLQK-PYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFER 341
                YRMVKIEK+FL K P+ MG+FFTNQ FGVTQG+NRKV+ M +FSD   T  EF+R
Sbjct: 296 KPV--YRMVKIEKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDR 353

Query: 342 YVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLE 401
           Y+R+L+  HIT+PS+Y + NK KEI +F +EPLT++L D IVRNRM FNKKLSGTNAVLE
Sbjct: 354 YIRTLEHDHITRPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLE 413

Query: 402 KTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRK 461
           KTVLR KL++A+E  NERDV KYS+QLRNLEKRLS+YEKHHENDQ G+ KLG LTS+NRK
Sbjct: 414 KTVLRGKLQFAKETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRK 473

Query: 462 VNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXX 521
           +NMDK +N  H+K E  GFD+K+DPFSRLKTRTKIYYQE+                    
Sbjct: 474 LNMDKARNVEHKKVELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEED 533

Query: 522 NEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
            EA+A+ E E LLA+F+ LGGLE M+ SLN   +FDI
Sbjct: 534 AEAKAQSEKEQLLAEFKCLGGLEKMVGSLNFKFDFDI 570

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (3%)

Query: 23  VLTTSNKRAKNHEHASSKRKKIEVDSEAEEEDDYDPGNFGAGNISXXXXXXXQ----NPF 78
           ++ +S KRA+N++ +S +RK    + + EEEDDY+P      N S       +    NPF
Sbjct: 23  LMVSSKKRARNNDSSSKRRKIEVDNEDEEEEDDYNPVFNEDNNQSTYNTMDGEREEPNPF 82

Query: 79  PLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQR 126
           PLEGKYKDE DRE++ES+PEMERETLLFERSQ M+KYQERK+FRER R
Sbjct: 83  PLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR 130

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  409 bits (1051), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 256/334 (76%), Gaps = 4/334 (1%)

Query: 228 EVEWAEEQT-DRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTT 286
           EVEWAE+   DRE+ LDD+NK++IGRSFVAK+CFYP FN++++GCYG+VN+G D+ TG +
Sbjct: 250 EVEWAEDDNLDRESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNS 309

Query: 287 SYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSL 346
            YRMVKIE++FLQKPY MG+FFTNQYFGVTQG +RK+FQM++FSD   T  E+ERY+ SL
Sbjct: 310 MYRMVKIERVFLQKPYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSL 369

Query: 347 DTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLR 406
           +   IT+PS Y L NK+K +  F+ EPLT +LMD IVRNRM+FNKKLSGTNAV+EK VL+
Sbjct: 370 EKYDITQPSPYILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLK 429

Query: 407 DKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDK 466
           +KL++++++ +    +KY++QL+ LEKRLS YEKHHENDQ     LGALTSKNRK+N+D+
Sbjct: 430 EKLQFSKQSGDIESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDR 489

Query: 467 IKNTGHEKKEEI--GFDSKSDPFSRLKTRTKIYYQEVXXXXXXXXXXXXXXXXXXXXNEA 524
           I++    K+EE     D+KSDPFSRLKTRTKIYYQE+                     EA
Sbjct: 490 IRHAETIKREEGVNKVDAKSDPFSRLKTRTKIYYQEI-QQEENEKAREEAKRQLEVDQEA 548

Query: 525 QARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558
           + +K+ ELLLAKFRRLGGLE +I SL+L ++ DI
Sbjct: 549 EEQKKKELLLAKFRRLGGLEEIIGSLDLKLHIDI 582

 Score = 92.0 bits (227), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/57 (73%), Positives = 51/57 (89%)

Query: 77  PFPLEGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQ 133
           PFPLEGKYKDE DRE+LE LPEMERE++LFERSQ M+KYQERKL R+  +++K+QQQ
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQ 145

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 366 IQSFISEPLTEQL--MDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAK 423
           ++  IS+ LTEQ    D +V+ R L  KK++    + E   LR+KL Y  E N  R    
Sbjct: 75  LEELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPA 134

Query: 424 YSSQ 427
           Y  Q
Sbjct: 135 YIWQ 138

>Smik_4.625 Chr4 complement(1118384..1121332) [2949 bp, 982 aa] {ON}
           YDR359C (REAL)
          Length = 982

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 318 GSNRKVF--QMNFFSDGLFTPDEFERYVRSLDTS-HITKPS 355
           GSN ++F  ++NF  DGLF     +R V S+DT   +TKPS
Sbjct: 472 GSNEQIFRDELNFAGDGLFQEGTNDRVVSSIDTKVLLTKPS 512

>Skud_10.364 Chr10 complement(649306..654252) [4947 bp, 1648 aa]
           {ON} YJR140C (REAL)
          Length = 1648

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 79/191 (41%), Gaps = 38/191 (19%)

Query: 310 NQYFGVTQGSNRKVFQMNFF--SDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQ 367
           N Y       N ++FQ+N    S+     D F +Y+  LDTSH               ++
Sbjct: 445 NDYLSSGSNENEELFQLNALLKSNAFDDKDGFPKYLSDLDTSH---------------VK 489

Query: 368 SFISEPLTEQLMDTIVRNRMLFNKKLSGT-----------NAVLEKTVLRDKLRYAQENN 416
           SFISE     L    VR ++LF  KL GT           + + E  +L+  L +     
Sbjct: 490 SFISEVNAGNLHFHQVRLKLLF--KLLGTYDGGNERRLVIDYLWEPQLLKTVLWFVFGIE 547

Query: 417 NERDVAKYSSQLRNLEKRLSVYE---KHHEN--DQVGSNKLGALTSKNRKVNMDKIKN-- 469
           +      Y ++L+     LS+YE    H  N  +++ + ++    S + K   +KI+   
Sbjct: 548 SNIFAFIYKNKLQCKYLALSIYELLVNHLGNIVEEITNKRIQGHKSADLKSQRNKIEKRI 607

Query: 470 -TGHEKKEEIG 479
            + HE  EEI 
Sbjct: 608 RSWHELLEEIA 618

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,843,469
Number of extensions: 2210609
Number of successful extensions: 10569
Number of sequences better than 10.0: 126
Number of HSP's gapped: 10847
Number of HSP's successfully gapped: 154
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)