Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D049408.841ON32732717470.0
KAFR0B00210singletonON32632714230.0
NDAI0F00250singletonON32932613830.0
TPHA0G03760singletonON33132713830.0
YPL273W (SAM4)8.841ON32532613630.0
SAKL0D01452g8.841ON32732513560.0
Suva_13.515na 1ON32532613510.0
KNAG0B06970singletonON33231513330.0
KLTH0C03850g8.841ON32932713310.0
Kwal_27.102558.841ON32932713290.0
Smik_6.4848.841ON32532613060.0
Ecym_46128.841ON32632512801e-178
KLLA0D01551g8.841ON33132512671e-176
TDEL0E05690singletonON32832712161e-168
Suva_64.1singletonON27327311631e-161
Suva_16.17singletonON32432611561e-159
TDEL0E00240singletonON32832611301e-155
YLL062C (MHT1)na 2ON32432711291e-155
Skud_12.4na 2ON32532611281e-155
Smik_12.1na 2ON32432711131e-153
KAFR0L00150singletonON32632611101e-152
KAFR0F04420singletonON32632710941e-150
ABL125W8.841ON33632710521e-143
Suva_16.328.841ON25925010361e-142
TBLA0B032608.841ON3263259611e-129
TPHA0I002608.841ON3233219221e-124
ZYRO0G14212g8.841ON3253279091e-122
Kpol_1068.78.841ON3233238921e-119
Skud_101.1singletonON2002008651e-117
Skud_100.1singletonON2002008421e-113
SAKL0D09306gna 3ON3263377551e-98
Kwal_0.322na 3ON3323416318e-80
AFR410WsingletonON3703286331e-79
KLTH0H12716gna 3ON3483425676e-70
YMR321Cna 1ON1051033943e-47
Skud_47.2singletonON96963925e-47
AFR290W5.706ON1217174810.17
TPHA0C020008.447ON21660750.55
YGL124C (MON1)6.127ON64475721.6
Smik_14.2252.178ON23371683.8
SAKL0H01980g5.60ON49239676.9
TPHA0C042302.539ON1279111677.5
Suva_7.1446.127ON64480668.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D04940
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               677   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       552   0.0  
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       537   0.0  
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     537   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   529   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   526   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   525   0.0  
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             518   0.0  
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   517   0.0  
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   516   0.0  
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   507   0.0  
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   497   e-178
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   492   e-176
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   473   e-168
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        452   e-161
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   449   e-159
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       439   e-155
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   439   e-155
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   439   e-155
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   433   e-153
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      432   e-152
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               426   e-150
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   409   e-143
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   403   e-142
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   374   e-129
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   359   e-124
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   354   e-122
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   348   e-119
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   337   e-117
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   328   e-113
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   295   1e-98
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   247   8e-80
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   248   1e-79
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   223   6e-70
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   156   3e-47
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      155   5e-47
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...    36   0.17 
TPHA0C02000 Chr3 complement(450359..451009) [651 bp, 216 aa] {ON...    33   0.55 
YGL124C Chr7 complement(274780..276714) [1935 bp, 644 aa] {ON}  ...    32   1.6  
Smik_14.225 Chr14 (417277..417978) [702 bp, 233 aa] {ON} YNL100W...    31   3.8  
SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {...    30   6.9  
TPHA0C04230 Chr3 complement(908823..912662) [3840 bp, 1279 aa] {...    30   7.5  
Suva_7.144 Chr7 complement(270934..272868) [1935 bp, 644 aa] {ON...    30   8.4  

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/327 (100%), Positives = 327/327 (100%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK
Sbjct: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG
Sbjct: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
           ARIIGGCCRTTPKDILEISKAVKKFSK
Sbjct: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/327 (80%), Positives = 289/327 (88%), Gaps = 1/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M RQ IKEYL++NP KVLVLDGGQGTELENRGI+VANPVWSTIPF+SESFWS+ SS DR+
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWSNASSKDRE 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVK MF+DFL AGA+ILMT TYQTSFKSV+ENT IKTL+EYNELL RIVSFSR CIG++K
Sbjct: 61  IVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAHVCAEFNGDYG HPENIDYY YFKPQLDNFF N++LDLIGFETVPN +E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWD+ ILSKPFYIGLSVHENGVLRDGTTM EIG   KSLG+K+NPN LLLGINCV
Sbjct: 181 LKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SF+ SP ILE IHK LPDMPLIAYPNSGE+YDTVKKIWLP N  + +TW  VV RYI+AG
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLP-NHYSDITWNDVVNRYIKAG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
           ARIIGGCCRT P DI ++S AVKK  K
Sbjct: 300 ARIIGGCCRTMPDDIEQVSAAVKKSHK 326

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/326 (76%), Positives = 286/326 (87%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           MTRQ IK+YL +NP K+L+LDGGQGTELENRGINVANPVWSTIPFV++SFWS +SS DR+
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQSSKDRE 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVK+MF DFL AGAEILMTTTYQTSFKSVSENT+IKTL+EY+ELL RIV+FSRDCIGE K
Sbjct: 61  IVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAH+C+EF G+YG HPE IDYY+YFKPQL NF  N++LD+IGFET+PNV E
Sbjct: 121 YLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LK ILSW   IL KPFYIGLSVHENGVLRDGTTM ++ +I  SL +K+NPNL+LLGINCV
Sbjct: 181 LKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           S  HSP IL+ IH NLPD+PLI YPNSGEVYDTVKKIWLP N E  ++W++VV+RY++AG
Sbjct: 241 SLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAG 300

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRTTP DI +IS AV K+S
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHKYS 326

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/327 (76%), Positives = 285/327 (87%), Gaps = 1/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M RQ IK YLQ+NP+KVLV+DGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS DR+
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWSDQSSEDRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF DF+ AGAEILMTTTYQTSFKSVSENT IK  + YNELLNRI+ FSRDCIGE++
Sbjct: 61  IVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEER 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIG WGAH+CAEF+GDYG HPENID+Y+YFKPQLDNFF N  LDLIGFETVPN++E
Sbjct: 121 YLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDEKILSKPFYIGLSVHENG+LRDGT+M+E+ N+ K  G K+NPNL LLGINCV
Sbjct: 181 LKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           S+NHS  I++ IHK LP++PLIAYPNSGE+YDT KKIWLP N     TW+ +VK YIEAG
Sbjct: 241 SYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLP-NKNPIFTWDDIVKGYIEAG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
            RIIGGCCRTTP DI  ++ AVK+ +K
Sbjct: 300 VRIIGGCCRTTPNDIKAVTIAVKERAK 326

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/326 (76%), Positives = 283/326 (86%), Gaps = 1/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +K++L  NP KVLVLDGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS +R+
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF DFL AGAEILMTTTYQTS+KSVSENT I+TL EYN LLNRIV FSR+CIGE K
Sbjct: 61  IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAH+C EF GDYGA PENID+YQYFKPQL+NF  N+ LDLIGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE ILS+PFYIGLSVHE+GVLRDGTTMEEI  + K LG+K+NPN   LGINCV
Sbjct: 181 LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN SP ILE +H+ LP+M L+AYPNSGEVYDT KKIWLP NS+   +W+ VVK+YI +G
Sbjct: 241 SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP-NSDKLNSWDTVVKQYISSG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRT+PKDI EIS AVKK++
Sbjct: 300 ARIIGGCCRTSPKDIQEISAAVKKYT 325

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/325 (74%), Positives = 286/325 (88%), Gaps = 1/325 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M RQ IK++ Q++PD++LV+DGGQGTELENRGI VANPVWSTIPF+SESFWS++SS DRQ
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNESSRDRQ 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF+DF+  G+ ILMTTTYQTSFKSVSENT IKTL+EYN+LL RIV+FSR+CIGE K
Sbjct: 61  IVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIG WGAHVC EF GDYGA+PE ID+ +YF+PQL NF ++E +DLIGFET+PNV+E
Sbjct: 121 YLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE I+SKPFYIGLSVHENGVLRDGTTM+E+ +I KSLG+K+NPNL+LLGINCV
Sbjct: 181 LKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFNHS  IL  +HK LPDMP+I YPNSGE+YDTVKKIWL  N    +TW+ VVK YIE G
Sbjct: 241 SFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWL-HNENQKVTWDDVVKSYIENG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKF 325
           ARIIGGCCRT+P+DI +I +A++K+
Sbjct: 300 ARIIGGCCRTSPQDIKDIVQAIEKY 324

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/326 (75%), Positives = 283/326 (86%), Gaps = 1/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +K+ L  +P KVLVLDGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF DFLAAGAEILMT TYQTSFKSVSENT IKTL  Y+ LL RIV FSRDCIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           +LIGCIGPWGAHVC EF G+YG +PE+ID+YQYFKPQLDNF  N+ LDL+GFET+PN++E
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE ILSKPFYIGLSVHE+GVLRDGTTME +  + K LG+K+NPN LLLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN SP ILE +H+ LP+MPL+AYPNSGEVYDT KKIW+P NS+   +W+ VVK+YI +G
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMP-NSDKLNSWDTVVKQYIGSG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRTTPKDI E+S AVKK++
Sbjct: 300 ARIIGGCCRTTPKDIQEVSAAVKKYT 325

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/315 (77%), Positives = 275/315 (87%), Gaps = 1/315 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M RQ I+EYL+ NP KVLVLDGGQGTELENRGINVANPVWST+PF+  SFWS+KSS DR 
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWSNKSSKDRV 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVK MF+ FL AGAEILMTTTYQTSFKSVSENT I+ L+EY+ LL+RIV FSRDCIG  K
Sbjct: 61  IVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAHVCAEFNGDYG +P  IDY  YFKPQLDNFF N+NLDLIGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           L+AILSWDE ILSKPFYIGLSVH NG+LRDG+TM+++ ++ KS G K+N NL LLGINCV
Sbjct: 181 LRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SF+ SP ILE IHK LPDMPLIAYPNSGEVYDTVKKIWLP N +  +TWE+VV RYI+AG
Sbjct: 241 SFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLP-NRDMVMTWEEVVDRYIKAG 299

Query: 301 ARIIGGCCRTTPKDI 315
           ARI+GGCCRT+PKDI
Sbjct: 300 ARIVGGCCRTSPKDI 314

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 282/327 (86%), Gaps = 3/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND 58
           M R S+KEYL  NP++VLVLDGGQGTELENRGI VANPVWSTIPF+S+SFW+  D SS D
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 59  RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE 118
           RQIVKEM+EDFL AGA +LMT TYQ SFKSVSENT I TL+EY+ LL+RIVSFSR CIG+
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 119 QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV 178
            K+L+GCIGPWGAH C+EF GDYG+ PE IDY QYFKPQLDNF  N++LDLIGFET+PN+
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 179 NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN 238
           +EL+AILSWD  IL KPFYIGLSVHE+GVLRDGTTM E+  + KSLG+K+NPN +LLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 239 CVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIE 298
           CVS+NHSP IL  +H+ +P++PLIAYPNSGEVYDTVKKIW P+  +++LTW+QVVK YI+
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPK-GDHTLTWDQVVKSYID 299

Query: 299 AGARIIGGCCRTTPKDILEISKAVKKF 325
           +GARIIGGCCRT+PKDI  I+ AV K+
Sbjct: 300 SGARIIGGCCRTSPKDIAAINAAVNKY 326

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 284/327 (86%), Gaps = 3/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND 58
           M R SIKE+L++NP +VLVLDGGQGTELENRGI VANPVWSTIPF+SESFWS  D+SS D
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 59  RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE 118
           RQIVKEM+ DFL AGA +LMT TYQ SFKSVSENT IKTL+EY+ LLNRIV+FSR+CIG+
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 119 QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV 178
            K+L+GCIG WGAH C+EF GDYGA PE ID+ QYFKPQLDNF  NEN+DLIGFET+PN+
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 179 NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN 238
           +EL+AILSWDE I++KPFYIGLSVHENG+LRDGTTM ++  + KS G+++NPN  LLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 239 CVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIE 298
           CVS+N S  IL  +H+ LP+MPLIAYPNSGEVYDTVKKIW P+NS+ +L+WEQ+VK YI+
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQ-TLSWEQIVKSYID 299

Query: 299 AGARIIGGCCRTTPKDILEISKAVKKF 325
           +GARIIGGCCRT+PKDI  I +AV+K+
Sbjct: 300 SGARIIGGCCRTSPKDIEAIHEAVQKY 326

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/326 (76%), Positives = 282/326 (86%), Gaps = 1/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +K+ L  NP KVLVLDGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS+ R+
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF DFL AGAEILMTTTYQTS+KSVSENT IKTL EYN LL RIV FSR CIGE K
Sbjct: 61  IVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIGCIGPWGAH+C EF GDYGA+PE+ID+YQYFKPQLDNF  N+NLDLIGFET+PN++E
Sbjct: 121 YLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE +LSKPFYIGLSVHE+GVLRDGTTM+E+  + K LG+K+NPN  LLGINCV
Sbjct: 181 LKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN SP ILE +H+ LPDM L+AYPNSGEVYDT KKIWLP NS+   +W+ VVKRYI +G
Sbjct: 241 SFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLP-NSDKLNSWDAVVKRYISSG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRT+PKDI EI  AVKK++
Sbjct: 300 ARIIGGCCRTSPKDIQEIFTAVKKYT 325

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  497 bits (1280), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 223/325 (68%), Positives = 276/325 (84%), Gaps = 1/325 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R S+K+ LQ NPD++L++DGGQGTELENRGINVANPVWSTIPF+++SFWSD+SS DRQ
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWSDRSSRDRQ 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IV  MFE+++AAGA +LMT TYQ+SFKSVSENTDIKTL+EYN+LL+RIV+FSR CIG   
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YL+GCIG WGAH+CAEF+GDYG HPE I Y  YF+PQL+NF   E++D+IGFET+PN++E
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           L AILSWDE I+ KPFYIG+SVHE+G LRDGTTM ++  +F+SLG K+NPN L LGINC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SF +S  ILE +H+ LP +PLIAYPNSGE+YDTVKKIWL +N    +TW+++VK Y+++G
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWL-KNENCIVTWDEIVKSYLQSG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKF 325
           ARIIGGCCRTTP DI +I  AVKK+
Sbjct: 300 ARIIGGCCRTTPNDIRQIVTAVKKY 324

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 274/325 (84%), Gaps = 1/325 (0%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQIV 62
           R  IK+Y ++NPD VLV+DGGQGTELENRGINVANPVWST+PF++ESFWS  +S DR IV
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRIIV 61

Query: 63  KEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYL 122
           K+MFEDF+ AGA+ILMT TYQTSFKSVSENT I+TL+EYN LL+RIVSFSR CIGE +YL
Sbjct: 62  KQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDRYL 121

Query: 123 IGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELK 182
           IGCIG WGAHVC+EF GDYG HP+ IDY++YF+PQL NF  ++++D+IGFET+PN++EL+
Sbjct: 122 IGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHELR 181

Query: 183 AILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSF 242
           AILSWDE +LSKPFYIGLSVHE GVLRDGT+M++I ++  SLG+K+N NL+ +GINC +F
Sbjct: 182 AILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCCAF 241

Query: 243 NHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGAR 302
           N S  ILE +H + P+MPLI YPNSGE+YDTVKKIWL +N     TW+ VVK YIE GAR
Sbjct: 242 NQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWL-KNENQLCTWDDVVKSYIENGAR 300

Query: 303 IIGGCCRTTPKDILEISKAVKKFSK 327
           IIGGCCRTT  DI E+  AV K++K
Sbjct: 301 IIGGCCRTTVDDIKEVRLAVNKYAK 325

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  473 bits (1216), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 221/327 (67%), Positives = 267/327 (81%), Gaps = 2/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  IK+ + ++ + +LVLDGGQGTELENRGI VANPVWSTIPF+SESFW+D SS +R+
Sbjct: 1   MVRIPIKKLVIESKE-ILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWTDSSSKERK 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IV+ +F+DF  +G+ ILMT TYQTSF S+ ENT  KTL EYN LL+RIV FSR CIG+++
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIG +GPWGAHVC EF G+YG HPE+IDYY+YFKPQLDNF   + +DLIGFETVPN +E
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE  ++KPFYIGLSVH NGVLRDGTTMEEIG   K LG K++ N LLLG+NCV
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN S  +++ IHK LPDMPL+AYPNSGEVYDT KKIW   N +   +W+ VV+ YI+ G
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWF-DNKDKLDSWDSVVRSYIDNG 298

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
           ARIIGGCCRT+P+DI E+S AVKK++K
Sbjct: 299 ARIIGGCCRTSPRDIAEVSAAVKKYNK 325

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  452 bits (1163), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 211/273 (77%), Positives = 239/273 (87%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +K+ L  +P KVLVLDGGQGTELENRGI VANPVWSTIPF+SESFWSD+SS +R+
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVKEMF DFLAAGAEILMT TYQTSFKSVSENT IKTL  Y+ LL RIV FSRDCIGE+K
Sbjct: 61  IVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           +LIGCIGPWGAHVC EF G+YG +PE+ID+YQYFKPQLDNF  N+ LDL+GFET+PN++E
Sbjct: 121 HLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE ILSKPFYIGLSVHE+GVLRDGTTME +  + K LG+K+NPN LLLGINCV
Sbjct: 181 LKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDT 273
           SFN SP ILE +H+ LP+MPL+AYPNSGEVYDT
Sbjct: 241 SFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  449 bits (1156), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 207/326 (63%), Positives = 261/326 (80%), Gaps = 2/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R +I++ + ++P KVLVLDGGQGTELENRGI++ +PVWS  PF+S+SFW + +S+DR 
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW-ESTSSDRT 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           +V+EM+ DF+ AGA +LMT TYQ +F S+SENT IKTL +YN  L+R+VSF+R  IGE +
Sbjct: 60  LVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDR 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIG IGPW AHV +E+ GDYG+HPE+IDY Q+FK QLDNF  +  +DLIGFETVPN +E
Sbjct: 120 YLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE I+SKPFY+GLSVH+NG+LRDGTTMEEI    KSLG K+N + LLLG+NC+
Sbjct: 180 LKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCI 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN S SIL+ +H+ LPDMPL+AYPNSGEVYDT  K W     + + +WE VV+ +I+ G
Sbjct: 240 SFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQN-SWEVVVEEFIDNG 298

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRT+ KDI EI+ AV K S
Sbjct: 299 ARIIGGCCRTSAKDISEIASAVDKHS 324

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  439 bits (1130), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 199/326 (61%), Positives = 265/326 (81%), Gaps = 2/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +++ L  +  K+LVLDGGQGTE+ENRGI VANPVWS+IPFVSESFW+D+ S +R+
Sbjct: 1   MGRVPLRKVLT-DSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEWSKERK 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IV+E+++DF+++G+++LMT TYQ SFK+++ENT+++TL EYN LL+RIV+FSR CIG+++
Sbjct: 60  IVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDER 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YL+G +GPW A+  +E+ GDYG H ++IDYY Y+KPQLDNF   E +D+IG ETVPN +E
Sbjct: 120 YLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDEK ++KPFY+ L+ H++GVLRDGT ME+I    K LGN +NPN +LLGINCV
Sbjct: 180 LKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCV 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           SFN S  ILE +H  LP+M L+AYPNSGEVY+  KKIWL  N   + +W+ VVK +I +G
Sbjct: 240 SFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLA-NKCKTTSWDSVVKSFINSG 298

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
           ARIIGGCCRT+P+DI ++S AVKK+S
Sbjct: 299 ARIIGGCCRTSPQDIADVSIAVKKYS 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  439 bits (1129), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 259/327 (79%), Gaps = 4/327 (1%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  IKE + ++P KVL+LDGGQGTELENRGIN+ +PVWS  PF SESFW + SS +R+
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW-EPSSQERK 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           +V+EM+ DF+ AGA ILMT TYQ +F+S+SENT IKTL  Y   L++IVSF+R+ IGE++
Sbjct: 60  VVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEER 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIG IGPW AHV  E+ GDYG HPENIDYY +FKPQL+NF  N ++DLIGFET+PN +E
Sbjct: 120 YLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSWDE I+SKPFYIGLSV +N +LRDGTT+EEI    K LGNK+N NLLL+G+NCV
Sbjct: 180 LKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCV 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIW-LPQNSENSLTWEQVVKRYIEA 299
           SFN S  IL+ +H++LP MPL+ YPNSGE+Y+  +K W  P N  +   WE  VK++++ 
Sbjct: 240 SFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDD--WETTVKKFVDN 297

Query: 300 GARIIGGCCRTTPKDILEISKAVKKFS 326
           GARIIGGCCRT+PKDI EI+ AV K+S
Sbjct: 298 GARIIGGCCRTSPKDIAEIASAVDKYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  439 bits (1128), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 201/326 (61%), Positives = 262/326 (80%), Gaps = 4/326 (1%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R SI++ + + P +VLVLDGGQGTELENRGIN+  PVWS  PF S+SFW ++SS+DR+
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW-EQSSHDRE 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           +V+EM+ DF+ AGA +LMT TYQ +FKS+SENT I+TL  YN  L+RIVSF+R  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEER 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YL+G IGPW AHV +E+ G+YG HPE+IDYY +FKPQLD+F  N+++DLIGFETVPN +E
Sbjct: 120 YLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSW E I+SKPFY+GLSVH+NG+LRDGTTMEE+    K LG+++N +LLL+G+NC+
Sbjct: 180 LKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCI 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIW-LPQNSENSLTWEQVVKRYIEA 299
           SFN S  IL  +H++LPD PL+ YPNSGEVYD  +K W  P +   S  W+  VK +I++
Sbjct: 240 SFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPES--WDITVKTFIDS 297

Query: 300 GARIIGGCCRTTPKDILEISKAVKKF 325
           GARIIGGCCRT+PKDI EI+ AV+++
Sbjct: 298 GARIIGGCCRTSPKDIAEIATAVRRY 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  433 bits (1113), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 261/327 (79%), Gaps = 4/327 (1%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  I++ L ++P KVLVLDGGQGTELENRGIN+ +PVWS  PFVS+SFW +KSS +R+
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW-EKSSRERK 59

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           +V+EM+ DF+ AGA +LMT TYQ +FKS+S+NT IKTL  Y   L++IV FSR  IGE++
Sbjct: 60  VVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEER 119

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIG IGPW AHV +E+ G+YG HPE+IDYY++F+PQLD F  NE++DLIGFET+PN +E
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHE 179

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LKAILSW E I+S+PFY+GLSVH+NG+LRDGTT+EEI    K LG+K+N N LLLG+NC+
Sbjct: 180 LKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCI 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWL-PQNSENSLTWEQVVKRYIEA 299
           SFN S  IL+ +H+ LPD PL+ YPNSGE+YD  +K W  P +  +S  W+  V+++I++
Sbjct: 240 SFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDS--WDVTVRKFIDS 297

Query: 300 GARIIGGCCRTTPKDILEISKAVKKFS 326
           GARIIGGCCRT+PKDI EI+ +V  +S
Sbjct: 298 GARIIGGCCRTSPKDIAEIAASVDTYS 324

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  432 bits (1110), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 200/326 (61%), Positives = 256/326 (78%), Gaps = 1/326 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  +K+YL++NP+KVLV DGGQG ELE RG+++ + +WST PF+S+SFWSD SSND +
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWSDPSSNDIR 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IVK MFEDF+ AGAEILMTTTYQTSFK+VSE+T++K+L+EYNELL++IV F+R CIG+ +
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YLIG IG +GA V  E++GDYG  PE +D+Y YFKPQLDNF  N+ +D++GFET+ N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           LK++LSWDEK +SKPFYI LSVH+NG LRDGT M  I +  KSL   +NPNL  LG+NCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           ++N +  I++ IH  LP MPL  +PNSGEV++  K IW   N E + +WE VVKR+I +G
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIW-TANPEAAASWEAVVKRFISSG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFS 326
            RI+GGCCRT P DI +ISKAVKK S
Sbjct: 300 VRIVGGCCRTRPHDIEQISKAVKKLS 325

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  426 bits (1094), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 192/327 (58%), Positives = 262/327 (80%), Gaps = 1/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  IKEYL +N DK+LVLDGGQGTELE RGIN+++PVWST+PF++ESFWS+ SSNDR+
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWSNSSSNDRK 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           I+K+M+ DF++AGA++L TTTYQTSF S+SENT+I+TL++Y+ELLNRI  F+R+CIG+ K
Sbjct: 61  IIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YL+G IG + A++ AE+ GD+G   + IDY+ YFKPQLDNF  +  +D+IGFET+PN++E
Sbjct: 121 YLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           L+AILS ++K LSKPFYI LS +    LRDGT+++ + ++ KS  + +NPNL+LLGINC+
Sbjct: 181 LRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCI 240

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
             N S   +E ++ +LP  PLI YPNSGE YD V+KIWL  + + + TWE +V RY++AG
Sbjct: 241 GLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWL-ADEDPAFTWEYIVHRYLDAG 299

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
           ARI+GGCCRTTP DI  IS+A+K ++K
Sbjct: 300 ARIVGGCCRTTPSDIRSISEAIKCYTK 326

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  409 bits (1052), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 186/327 (56%), Positives = 239/327 (73%), Gaps = 3/327 (0%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M R  I++YL+++P +VLV+DGGQGTELENRGI VA+PVWS  PF+  + W    S +R 
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDSRERA 60

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQK 120
           IV  +  DF+AAGAE++MT TYQ SF SV+ NT I TLQ+YN LL+RIV F R+ +G+ K
Sbjct: 61  IVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDK 120

Query: 121 YLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNE 180
           YL+G IG WGAHVCAEF GDYG  P++IDY  YFKPQLDNF A   LDLIGFET+PN +E
Sbjct: 121 YLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHE 180

Query: 181 LKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCV 240
           L+AILSWDE +++KPFY+ LSVH+ G LRDGT M ++     +    +NPN L LGINC 
Sbjct: 181 LRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADV-AAIVAAAAPLNPNFLGLGINCS 239

Query: 241 SFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAG 300
           S + +P+IL ++H  LP +P+  YPNSGE+YD VKK+W    S + + W  VV  YI +G
Sbjct: 240 SLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSG 297

Query: 301 ARIIGGCCRTTPKDILEISKAVKKFSK 327
           ARIIGGCCRT P DI +I+ AV+  ++
Sbjct: 298 ARIIGGCCRTIPNDIRQIADAVRTHAR 324

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  403 bits (1036), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 217/250 (86%), Gaps = 1/250 (0%)

Query: 77  LMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYLIGCIGPWGAHVCAE 136
           LMT TYQTSFKSVSENT IKTL  Y+ LL RIV FSRDCIGE+K+LIGCIGPWGAHVC E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 FNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELKAILSWDEKILSKPF 196
           F G+YG +PE+ID+YQYFKPQLDNF  N+ LDL+GFET+PN++ELKAILSWDE ILSKPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSFNHSPSILEDIHKNL 256
           YIGLSVHE+GVLRDGTTME +  + K LG+K+NPN LLLGINCVSFN SP ILE +H+ L
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 257 PDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGARIIGGCCRTTPKDIL 316
           P+MPL+AYPNSGEVYDT KKIWLP NS+   +W+ VVK+YI +GARIIGGCCRTTPKDI 
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLP-NSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQ 249

Query: 317 EISKAVKKFS 326
           E+S AVKK++
Sbjct: 250 EVSAAVKKYT 259

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  374 bits (961), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 240/325 (73%), Gaps = 2/325 (0%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS-DKSSNDRQI 61
           RQS KEY   +P+ V+V+DGGQGTELE RG++V++ VWST+PF+   FW  D+ S +  I
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61

Query: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121
           VK+MF+ F+AAG++ LM+ TYQ SF ++S NT I+ L+EYNELLN+IV F R+CIG  KY
Sbjct: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121

Query: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181
           LIG IGP+ +HV AE+ GDYG HPEN+DY  YFKPQLDNF  N+++DLI  ETVPN  EL
Sbjct: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYEL 181

Query: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241
           KA+LSWD   + KPFYI LSV ++G LRDGT+M+ I  +F++   K NPNL+++G+NCVS
Sbjct: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240

Query: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301
           ++ +  I++ +   +PD+PL+ YPNSGEVYD + + W   N     +WE +VK  +  G 
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 302 RIIGGCCRTTPKDILEISKAVKKFS 326
           R++GGCCRTTP DI +I++AV   S
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHLS 325

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 232/321 (72%), Gaps = 3/321 (0%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSN-DRQI 61
           R   ++++ ++P+++LVLDGGQGTELENRG+N+ +P+WSTI FV++ FW +   N +R+ 
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERKC 61

Query: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121
           ++EMF DF  AGA +  T TYQTSF SVSENTDIK+LQEY+ELL +I  F R CI +  Y
Sbjct: 62  IREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDDY 121

Query: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181
           L+GCIG + A + AE++G+YG     IDY +YFKPQLD F  + N+D+IGFET+PN +EL
Sbjct: 122 LLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHEL 181

Query: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241
           +AILSWDE I+++PF+I LS+ +   LRDGT+ EE+G +F     + N NL+ +G NC+S
Sbjct: 182 EAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCIS 240

Query: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301
           + +S   +  +H  +P + LIAYPNSGE+YD   K W    S   ++WE+VV  Y +AG 
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQW-SSTSAIKISWEEVVNEYADAGV 299

Query: 302 RIIGGCCRTTPKDILEISKAV 322
           +IIGGCCRTTP DI +I KAV
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAV 320

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  354 bits (909), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 232/327 (70%), Gaps = 9/327 (2%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS-DKSSNDRQI 61
           RQ + E L+ + D+VLV+DGGQGTELENRG+N++ P+WST+PF  E FW+ D+   DR +
Sbjct: 2   RQQLLEVLR-DTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRDV 60

Query: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121
           V  MF+ ++ AGA++L T TYQTS+K++  +TDI T  +Y++LL+RIV F R CIG+  Y
Sbjct: 61  VNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHY 120

Query: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181
           L+G IGP+ AHV AE+ GDYG  PE IDY+QYF+PQ+ NF  NE +D+IG ETVPNV+EL
Sbjct: 121 LVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHEL 180

Query: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241
           K+ILSWDE  +SKPFY+ L V ++G LRDGT +E++  +F    N+ N NLLL+GINC S
Sbjct: 181 KSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLF---ANRSNKNLLLVGINCCS 237

Query: 242 FNHSPSILEDIHKNLPDMP--LIAYPNSGEVYDTVKKIWLPQNSENS--LTWEQVVKRYI 297
            + S   L  +++ L   P  L+ YPNSGE+YD   + W      +S  L+W  +V+ Y 
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 298 EAGARIIGGCCRTTPKDILEISKAVKK 324
           + GAR IGGCCRTTP DI EI K V +
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVVDR 324

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 230/323 (71%), Gaps = 4/323 (1%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFW-SDKSSNDRQI 61
           R  I+E ++  PD+VLV DGG GT LE+RGINV++P+WST+PF+ + FW S+  ++DR I
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61

Query: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121
           ++ ++ D++ +G+ IL T TYQTSF  +S +T++KT++ Y +L+  I SF R  IGE  Y
Sbjct: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121

Query: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181
           LIG IGP+GA + AE+ G+YG  P NI+Y +YFKPQL+ F  N+++D+IGFETVPN  EL
Sbjct: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181

Query: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241
           +AILSWD+ ++SKP+Y+ LS+ +NG LRDGT+ EEI  IFK   N  N NL+L G NC+S
Sbjct: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239

Query: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301
           F ++   +  +H+ +P +PLI YPNSGE+YD + K W    +   LTWE ++K    +  
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQT-FGLTWEDLIKELRTSNV 298

Query: 302 RIIGGCCRTTPKDILEISKAVKK 324
           RI+GGCCRTTP DI +I   + K
Sbjct: 299 RIVGGCCRTTPDDINKIKDMITK 321

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  337 bits (865), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/200 (78%), Positives = 174/200 (87%)

Query: 78  MTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYLIGCIGPWGAHVCAEF 137
           MTTTYQTS+KSVSENT IKTL EYN LL RIV FSRDCIGE KYLIGCIGPWGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 NGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELKAILSWDEKILSKPFY 197
            GDYG  PE+ID+Y+YFKPQLDNF  N+ LDLIGFET+PNV+EL+AILSWDE ILSKPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSFNHSPSILEDIHKNLP 257
           IGLSVHE+GVLRDGTTMEE+  + K LG+K+NPN  LLGINCVSFN SP ILE +H+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 258 DMPLIAYPNSGEVYDTVKKI 277
           DM L+AYPNSGEVYDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  328 bits (842), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 173/200 (86%)

Query: 78  MTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKYLIGCIGPWGAHVCAEF 137
           MTTTYQTS+KSVSENT IKTL EYN LL RIV FSR CIGE KYLIGCIGPWGAH+C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 NGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNELKAILSWDEKILSKPFY 197
            GDYG  P++ID+Y+YFKPQLDNF  ++ LDLIGFET+PNV+EL+AILSWDE ILSKPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 IGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVSFNHSPSILEDIHKNLP 257
           IGLSVHE+GVLRDGTTMEE+  + K LG+K+NPN  LLGINCVSFN SP ILE +H+ LP
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 258 DMPLIAYPNSGEVYDTVKKI 277
           +M L+AYPNSGEVYDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  295 bits (755), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 157/337 (46%), Positives = 217/337 (64%), Gaps = 25/337 (7%)

Query: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
           M RQ I EYL+ +   +LVLDGGQGTE+E RGI+V +P+WST+PF+       K+     
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIK------KNPTHLN 51

Query: 61  IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTD--IKTLQEYNELLNRIVSFSRD-CIG 117
            +K M+ DF  +GA  L T TYQ SF ++ + +D  + T Q+Y + LN I+ F+RD CI 
Sbjct: 52  HIKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCIS 111

Query: 118 EQKYLIGCIGPWGAHVC--AEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETV 175
           + +YLIGC+GP+ A++C  AE++GDYG+  E ID+ QYFKPQLD F  ++ +D++GFET+
Sbjct: 112 DSQYLIGCVGPYAAYLCNGAEYSGDYGS--EKIDFKQYFKPQLDVFSRDDRIDMVGFETI 169

Query: 176 PNVNELKAILSWD--EKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLL 233
           PN+ ELK +LS D    + +KPFYI +S   NG LRDGT + +I    K       PNLL
Sbjct: 170 PNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLL 229

Query: 234 LLGINCVSFNHSPSILEDIHKNLPD----MPLIAYPNSGEVYDTVKKIWLPQNSENS--L 287
            LGINCV ++HS +IL  ++  L D    +    YPNSGE+YD     W   NSE +  L
Sbjct: 230 FLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTW-HTNSEIAPEL 288

Query: 288 TWEQVVKRYIEAGARIIGGCCRTTPKDILEISKAVKK 324
           TW  +V ++ E   ++IGGCCRTTP DI +I+ AV K
Sbjct: 289 TWNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  247 bits (631), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 203/341 (59%), Gaps = 28/341 (8%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQIV 62
           R  ++EYL+    ++L+LDGGQGTELE RGIN+A+P+WST+P+V+      K     +I+
Sbjct: 2   RLQLEEYLKH---EILLLDGGQGTELEKRGINIAHPLWSTLPYVT------KDKKHLKII 52

Query: 63  KEMFEDFLAAGAEILMTTTYQTSFKSVSENTD--IKTLQEYNELLNRIVSFSRD-CIGEQ 119
           KEM+  F +AG   LMT TYQ SF S+  ++D  I   +EY   L+ ++ ++ + CI   
Sbjct: 53  KEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCISPN 112

Query: 120 KYLIGCIGPWGAHVC--AEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPN 177
            YL+G +GP+ A++   AE++G Y    +NID+ ++F+PQ+ +F  +  +DLIG ET+PN
Sbjct: 113 SYLVGSVGPYAAYLSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETIPN 170

Query: 178 VNELKAILSWDEKILS--KPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLL 235
             E KA+L  +   L   KP+YI ++    G LRDGT  ++I    K     + PNL+  
Sbjct: 171 FEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLVFF 230

Query: 236 GINCVSFNHSPSILEDIHKNLPDMPL-------IAYPNSGEVYDTVKKIWLPQNSE--NS 286
           GINCVSF H   IL+ ++ +L D+ +         YPNSGEVY      W P N E   +
Sbjct: 231 GINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGP-NPEIGPA 289

Query: 287 LTWEQVVKRYIEAGARIIGGCCRTTPKDILEISKAVKKFSK 327
            TWE +  + ++ G  +IGGCCRT+P D+ +I+  V    K
Sbjct: 290 DTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVSDIKK 330

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  248 bits (633), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 200/328 (60%), Gaps = 21/328 (6%)

Query: 5   SIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQIVKE 64
           +I E+L++N   VLV+DGG G ELE RG++V +P+WST PF+      D+++ D   ++ 
Sbjct: 50  AITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLR----GDRAALD--TIRG 100

Query: 65  MFEDFLAAGAEILMTTTYQTSFKS-VSENTDIKTLQEYNELLNRIVSFS-RDCIGEQK-Y 121
           ++ +F AAG+  + T TYQ SF S V  +  + +  +Y + L ++V F+ R+C+   + Y
Sbjct: 101 LYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDY 160

Query: 122 LIGCIGPWGAHVC--AEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVN 179
           +IG +GP+ A +C  AE+ GDYG   E I+++ YF+PQ+  F  +  +D I FETVPNV 
Sbjct: 161 IIGSVGPYAAFLCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVV 218

Query: 180 ELKAILSWDEKIL--SKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGI 237
           EL A+L  +   L  +KPFYI +S  +  VLRDGT +  +G + +   + + PNLL  G+
Sbjct: 219 ELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGL 278

Query: 238 NCVSFNHSPSILEDIHKNLPDMPL---IAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVK 294
           NCV    S ++L +++  L D P+     YPN   V+D     W P     SLTW + VK
Sbjct: 279 NCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVK 338

Query: 295 RYIEAGARIIGGCCRTTPKDILEISKAV 322
            Y+    R+IGGCC TTP+D+ +I++A+
Sbjct: 339 LYLNQDCRMIGGCCGTTPQDMRQIAEAL 366

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  223 bits (567), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 197/342 (57%), Gaps = 36/342 (10%)

Query: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQIV 62
           R+ +KE+ + N   +L+LDGGQGTELE +G+++++P+WST+PF+       K+    + +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFII------KNKTHLEAI 52

Query: 63  KEMFEDFLAAGAEILMTTTYQTSFKSVSENTD--IKTLQEYNELLNRIVSFS-RDCIGEQ 119
           KEM+ DF  AG+  LMT TYQ SF S+ + ++  + + ++Y   L+ ++ F+ R+CI   
Sbjct: 53  KEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECITPD 112

Query: 120 KYLIGCIGPWGAHVC--AEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPN 177
           KYL+G +GP+   +   AE++G YG     ID+  Y+ PQ+ +F  +  +DLIG ET+PN
Sbjct: 113 KYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETIPN 170

Query: 178 VNELKAILS--WDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLL 235
           ++E KA+LS  +     SKP+YI ++   NG LRDGT++ EI    K   + +  N +  
Sbjct: 171 IDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFVFF 230

Query: 236 GINCVSFNHSPSILEDIHKNLPDMPLI--------AYPNSGEVYDTVKKIWLPQNSENSL 287
            INCV F H   IL+ ++  L +M  +        AYPNSGE+Y      W    S N  
Sbjct: 231 AINCVEFLHCVEILQSLNDCL-EMQGVDRRFRFRGAYPNSGEIYHGGTHSW----SSNPY 285

Query: 288 -----TWEQVVKRYIEAGARIIGGCCRTTPKDILEISKAVKK 324
                TWE +    +     ++GGCCRT  ++I +++   KK
Sbjct: 286 AGPEDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  156 bits (394), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/103 (70%), Positives = 87/103 (84%), Gaps = 1/103 (0%)

Query: 224 LGNKVNPNLLLLGINCVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNS 283
           LG+K+NPNL  LGINCVSFN SP ILE +H+ LP+M L+AYPNSGEVYDT KKIWLP NS
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLP-NS 62

Query: 284 ENSLTWEQVVKRYIEAGARIIGGCCRTTPKDILEISKAVKKFS 326
           +   +W+ VVK+YI +GARIIGGCCRT+PKDI EIS AVKK++
Sbjct: 63  DKLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKYT 105

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  155 bits (392), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 84/96 (87%)

Query: 1  MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKSSNDRQ 60
          M R  +K+ L+ NP KVLVLDGGQGTELENRGI VANPVWSTIPF+S+SFWSD+SS +R+
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDESSANRK 60

Query: 61 IVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIK 96
          IVK MF DFL AGAEILMTTTYQTS+KSVSENT IK
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 68/174 (39%), Gaps = 33/174 (18%)

Query: 84   TSFKSVSENTDIKTLQEYNELLNRIVSFSR--DCIGEQKYLIGCIGPWGAHVCAEFNGDY 141
            T +  ++ + DI+TLQ Y  LL     F+R  D I    Y IG +   G H   +FNG  
Sbjct: 918  TPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNG-- 975

Query: 142  GAHPENIDYYQYFKPQLDN--FFANENLD---LIGFETVPNVNEL------KAILSWDEK 190
                         K  L+N    + E  D   LI  E  P ++E       K  + W++ 
Sbjct: 976  -------------KRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQM 1022

Query: 191  ILSKPFYIGLSVHENGVLRDGTT-MEEIGNIFKSLGNKVNPNLLLLGINCVSFN 243
            +     +     H    + D TT +   G+++K   N    N+L   I   +F 
Sbjct: 1023 LPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAAN----NILKFAICLTTFQ 1072

>TPHA0C02000 Chr3 complement(450359..451009) [651 bp, 216 aa] {ON}
           Anc_8.447 YDL200C
          Length = 216

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 5/60 (8%)

Query: 179 NELKAILSWDEKILSKPFYIGLSVHEN--GVLRDGTTMEEIGNIFKSLGN--KVNPNLLL 234
           N LK  L+W EK+  K  Y  +S H N     +D   + EI NIF S+ N  K +PN LL
Sbjct: 40  NLLKGTLAWFEKVTKKK-YNNMSYHLNDESKFKDKVKLHEIKNIFVSILNQEKESPNELL 98

>YGL124C Chr7 complement(274780..276714) [1935 bp, 644 aa] {ON}
           MON1Protein required for fusion of cvt-vesicles and
           autophagosomes with the vacuole; associates, as a
           complex with Ccz1p, with a perivacuolar compartment;
           potential Cdc28p substrate
          Length = 644

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 178 VNELKAILSWDEKILSKPFYIGL-SVHENGVLR---DGTTMEEIGNIFKSLGNKVNPNLL 233
           +N+L  + S+    LS+   + L S  EN  LR   + T  E +  I   + N++ P+LL
Sbjct: 262 LNQLDFLYSYILSSLSERQLLRLFSKRENFDLRNYLESTDFENLDEICSLICNRMFPDLL 321

Query: 234 LLGINCVSFNHSPSI 248
           L  + C+ FNHS  +
Sbjct: 322 LNSLQCLPFNHSSRL 336

>Smik_14.225 Chr14 (417277..417978) [702 bp, 233 aa] {ON} YNL100W
           (REAL)
          Length = 233

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 11/71 (15%)

Query: 236 GINCVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNS-------ENSLT 288
           G   + FNH+ SILE +  +LP    + +  +   +    K W PQ S       EN L 
Sbjct: 127 GAKRIIFNHNSSILEKLCTSLPSRTFLPWVLAAATF----KCWSPQTSRNLVNATENDLF 182

Query: 289 WEQVVKRYIEA 299
            +  VK Y +A
Sbjct: 183 PDDFVKSYHDA 193

>SAKL0H01980g Chr8 complement(195237..196715) [1479 bp, 492 aa] {ON}
           similar to uniprot|Q756H4 Ashbya gossypii AER292C
           AER292Cp and some similarities with YHR176W
           uniprot|P38866 Saccharomyces cerevisiae YHR176W FMO1
           Flavin-containing monooxygenase localized to the
           cytoplasmic face of the ER membrane catalyzes oxidation
           of biological thiols to maintain the ER redox buffer
           ratio for correct folding of disulfide-bonded proteins
          Length = 492

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%)

Query: 17  VLVLDGGQGTELENRGINVANPVWSTIPFVSESFWSDKS 55
           V+V +G  GT++ N+   VAN V+ ++  VS++ WS K+
Sbjct: 251 VVVGNGSSGTDIANQLSTVANKVFHSVTDVSKTDWSGKN 289

>TPHA0C04230 Chr3 complement(908823..912662) [3840 bp, 1279 aa] {ON}
           Anc_2.539 YMR076C
          Length = 1279

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 52/111 (46%), Gaps = 19/111 (17%)

Query: 1   MTRQSIKEYLQ-----QNPDKVLVLDGGQGTELENRGINVANPVWSTIP--------FVS 47
           MTR   K Y +      N D+ L +D  + +++ ++  N+   VW T+P        FV 
Sbjct: 229 MTRYFTKYYSEVLYELTNDDENLYVDKNEISKVLDKLHNLLIKVWETVPDMIAPVTGFVY 288

Query: 48  ESFWSDKSSND--RQIVKEMFEDFLAAGAEILMTTTYQTSFKS-VSENTDI 95
               S+   ND  RQ   ++    L+  +EI + TTYQ  F + +S+  DI
Sbjct: 289 HELCSE---NDLFRQKSTDLVGKLLSIKSEINLVTTYQDVFNAWLSKIADI 336

>Suva_7.144 Chr7 complement(270934..272868) [1935 bp, 644 aa] {ON}
           YGL124C (REAL)
          Length = 644

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 178 VNELKAILSWDEKILSKPFYIGL-SVHENGVLR---DGTTMEEIGNIFKSLGNKVNPNLL 233
           +N+L  + S+    LS+   + L S  EN  LR   + T  E +  I   + N++ P+LL
Sbjct: 262 LNQLDFLYSYILSSLSERQLLRLFSGRENFDLRNYLETTDFENLNEICSLICNRMFPDLL 321

Query: 234 LLGINCVSFNHSPSI-LEDI 252
           L  + C+ F HS  + L+D+
Sbjct: 322 LNSLQCLPFRHSSRLKLQDL 341

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,649,848
Number of extensions: 1824785
Number of successful extensions: 5438
Number of sequences better than 10.0: 51
Number of HSP's gapped: 5533
Number of HSP's successfully gapped: 51
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)