Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026706.21ON35135118550.0
NDAI0I022406.21ON3503615472e-66
Kpol_1037.266.21ON3422504163e-47
NCAS0H008306.21ON3383703972e-44
SAKL0E01210g6.21ON3232293943e-44
TBLA0G010506.21ON3503553912e-43
Kpol_1032.86.21ON3433343892e-43
TPHA0J003406.21ON3383293892e-43
TDEL0G044806.21ON3432203876e-43
KNAG0M011706.21ON3393753841e-42
CAGL0E02739g6.21ON3433583806e-42
KAFR0L004106.21ON3312463771e-41
ACR005W6.21ON3272183752e-41
Ecym_30256.21ON3183653733e-41
NDAI0D008106.21ON3492243745e-41
ZYRO0C07788g6.21ON3342163719e-41
Skud_15.1686.21ON3482353692e-40
KLLA0D01155g6.21ON3352443612e-39
Suva_15.1826.21ON3462303605e-39
YOR007C (SGT2)6.21ON3462343581e-38
Kwal_56.224336.21ON3222243551e-38
Smik_15.1766.21ON3452353526e-38
KLTH0C11220g6.21ON3272503202e-33
TBLA0A072706.21ON3733993083e-31
TPHA0M002706.21ON3773722372e-21
KAFR0C058905.617ON5751121843e-14
NDAI0F009105.617ON5831071763e-13
CAGL0H08195g5.617ON5831341737e-13
TBLA0E033005.617ON5821091702e-12
Suva_8.805.617ON5861091666e-12
ZYRO0A05676g5.617ON5721101657e-12
Skud_15.1925.617ON5891061658e-12
KNAG0B032005.617ON5791061658e-12
NCAS0G008105.617ON5841061603e-11
KLLA0A07062g5.617ON5811101595e-11
Smik_15.2055.617ON5891091569e-11
YOR027W (STI1)5.617ON5891091551e-10
TDEL0A048405.617ON5761101551e-10
Kpol_1018.695.617ON5901091542e-10
SAKL0G07084g5.617ON5851091542e-10
TPHA0D028805.617ON5851061506e-10
KLTH0E02178g5.617ON5931101489e-10
Kwal_55.199355.617ON5931101471e-09
AEL224W5.617ON5801231373e-08
TDEL0D055003.481ON5121161363e-08
NDAI0B057903.481ON5231111363e-08
Ecym_55825.617ON5841091345e-08
NCAS0F034903.481ON5121111283e-07
KLLA0F24046g2.152ON6041121274e-07
KNAG0A079003.481ON5121221265e-07
Ecym_44133.481ON5101101231e-06
NCAS0A00490singletonON6201001222e-06
TBLA0C039503.481ON5121221185e-06
SAKL0F03102g3.481ON5131411141e-05
Kpol_505.413.481ON5131101141e-05
YGR123C (PPT1)3.481ON513821142e-05
Smik_6.2153.481ON513821132e-05
KLLA0B10912g3.481ON5121521123e-05
SAKL0E10956g2.152ON6001131114e-05
Suva_7.4083.481ON513811104e-05
CAGL0D05060g3.481ON5101421104e-05
KLTH0B05170g2.152ON5931181096e-05
Skud_7.4323.481ON513821087e-05
TPHA0D032203.481ON5131091087e-05
NDAI0F028102.152ON6091121071e-04
Kwal_33.147672.152ON5941071071e-04
AAR083C3.481ON5381321061e-04
KAFR0B066103.481ON5111081025e-04
Skud_8.1782.152ON6381391016e-04
NCAS0B070102.152ON6251291008e-04
KLTH0E11748g8.506ON378125960.002
YNL121C (TOM70)2.152ON617161960.002
Skud_14.2112.152ON617173960.003
TBLA0I023106.328ON11673890.003
Kwal_55.211753.481ON511114950.003
ABR131W2.152ON59494950.003
Suva_14.2192.152ON617180940.004
KLTH0F14542g3.481ON513111930.006
KAFR0J025706.328ON12164850.009
Kwal_27.118908.506ON334111900.011
Ecym_82042.152ON59794910.011
CAGL0L12936g2.152ON600162900.015
TPHA0D038606.328ON120119840.016
ZYRO0B04224g3.481ON513102890.017
Suva_15.3142.152ON644129890.019
TPHA0I015102.152ON603112880.020
Kpol_1048.212.152ON597129880.021
Ecym_20906.328ON17273850.023
TDEL0B051402.152ON599106880.024
Smik_14.2072.152ON617143870.031
TBLA0C055302.152ON610125850.058
NCAS0G024802.152ON596106820.13
Kpol_513.28.506ON37499810.15
KLLA0C08910g6.328ON11556750.21
Skud_2.2828.506ON38599790.23
KAFR0F007202.152ON60897790.25
ZYRO0G06512g2.152ON604180790.25
NDAI0C052908.506ON37996790.25
TDEL0A074306.328ON12472750.26
Skud_3.1356.328ON11865740.27
SAKL0E14542g5.689ON690231790.28
NDAI0F004005.689ON76471790.31
ZYRO0C02970g3.32ON89656780.40
Ecym_51871.203ON36559750.69
TDEL0A005103.32ON90350750.88
CAGL0H07425g8.506ON380126740.93
Suva_3.956.328ON11163700.98
Smik_3.1596.328ON11577700.99
YBR112C (CYC8)3.367ON96694731.4
KNAG0L016307.258ON80636731.5
Suva_4.3613.367ON96394731.5
Smik_2.2543.367ON102094731.6
Skud_2.2403.367ON98494731.6
Smik_2.2958.506ON38599721.7
KLLA0B09966g8.506ON370130721.7
AEL062C1.456ON383128721.7
KLLA0B09262g3.367ON94194731.8
SAKL0B00858g8.18ON76170722.0
Ecym_56372.665ON71770722.0
ADR230W5.689ON685135722.1
NDAI0A051003.367ON1007114722.1
CAGL0L04048g2.152ON58797722.2
ADL344W3.367ON91094712.6
KAFR0E029808.506ON38096712.6
Ecym_34593.367ON1115100712.6
ZYRO0C16522g3.367ON97492712.7
AAR054C6.328ON13372672.9
TPHA0L014208.506ON37496694.2
Suva_4.4058.506ON38599694.3
YCR060W (TAH1)6.328ON11157654.3
CAGL0K09240g6.328ON14234665.2
Smik_7.1356.239ON887133695.2
YBR155W (CNS1)8.506ON38599676.6
NCAS0B025608.470ON57851677.1
SAKL0D11110g1.456ON432118677.2
CAGL0L05368g2.649ON59085677.9
NCAS0C044903.32ON91834679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02670
         (351 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   719   0.0  
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   215   2e-66
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   164   3e-47
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   157   2e-44
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   156   3e-44
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   155   2e-43
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   154   2e-43
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   154   2e-43
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   153   6e-43
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   152   1e-42
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   150   6e-42
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   149   1e-41
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   149   2e-41
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   148   3e-41
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   148   5e-41
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   147   9e-41
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   146   2e-40
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   143   2e-39
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   143   5e-39
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   142   1e-38
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   141   1e-38
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   140   6e-38
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   127   2e-33
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   123   3e-31
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    96   2e-21
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    75   3e-14
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     72   3e-13
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    71   7e-13
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    70   2e-12
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    69   6e-12
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    68   7e-12
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    68   8e-12
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    68   8e-12
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    66   3e-11
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    66   5e-11
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    65   9e-11
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    64   1e-10
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    64   1e-10
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    64   2e-10
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    64   2e-10
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    62   6e-10
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    62   9e-10
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    61   1e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    57   3e-08
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    57   3e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    57   3e-08
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    56   5e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   3e-07
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    54   4e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    53   5e-07
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    52   1e-06
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       52   2e-06
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    50   5e-06
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    49   1e-05
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    49   1e-05
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    49   2e-05
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    48   2e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    48   3e-05
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    47   4e-05
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    47   4e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    47   4e-05
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    47   6e-05
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    46   7e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    46   7e-05
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    46   1e-04
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    46   1e-04
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    45   1e-04
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    44   5e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    44   6e-04
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    43   8e-04
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    42   0.002
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    42   0.002
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    42   0.003
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    39   0.003
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    41   0.003
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    41   0.003
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    41   0.004
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    40   0.006
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    37   0.009
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    39   0.011
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    40   0.011
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    39   0.015
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    37   0.016
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    39   0.017
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    39   0.019
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    39   0.020
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    39   0.021
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    37   0.023
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    39   0.024
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    38   0.031
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    37   0.058
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    36   0.13 
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    36   0.15 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    33   0.21 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.23 
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    35   0.25 
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    35   0.25 
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    35   0.25 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    33   0.26 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    33   0.27 
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    35   0.28 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    35   0.31 
ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} simila...    35   0.40 
Ecym_5187 Chr5 complement(393102..394199) [1098 bp, 365 aa] {ON}...    33   0.69 
TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}...    33   0.88 
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    33   0.93 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    32   0.98 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    32   0.99 
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    33   1.4  
KNAG0L01630 Chr12 (289600..292020) [2421 bp, 806 aa] {ON} Anc_7....    33   1.5  
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    33   1.5  
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    33   1.6  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    33   1.6  
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    32   1.7  
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    32   1.7  
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    32   1.7  
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    33   1.8  
SAKL0B00858g Chr2 (80047..82332) [2286 bp, 761 aa] {ON} highly s...    32   2.0  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    32   2.0  
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    32   2.1  
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    32   2.1  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    32   2.2  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    32   2.6  
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    32   2.6  
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    32   2.6  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    32   2.7  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    30   2.9  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    31   4.2  
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    31   4.3  
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    30   4.3  
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    30   5.2  
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    31   5.2  
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    30   6.6  
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    30   7.1  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    30   7.2  
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    30   7.9  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    30   9.6  

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/351 (100%), Positives = 351/351 (100%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60
           MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 61  LANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLP 120
           LANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLP
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLP 120

Query: 121 VDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY 180
           VDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY
Sbjct: 121 VDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY 180

Query: 181 KQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTR 240
           KQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTR
Sbjct: 181 KQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTR 240

Query: 241 SSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNP 300
           SSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNP
Sbjct: 241 SSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNP 300

Query: 301 DAARKVQEISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFIPGAL 351
           DAARKVQEISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFIPGAL
Sbjct: 301 DAARKVQEISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFIPGAL 351

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  215 bits (547), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 204/361 (56%), Gaps = 29/361 (8%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS----DL 56
           MSL+ ++ AS I+SYLS L     + ED  ES+ VAI CI +SF L  ++   S     L
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 57  ATVLLANLN-LEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLK 115
            T+L  NLN LE   K+        NE+A  LK EGN+A+    Y++AI KYT AI   K
Sbjct: 61  KTILQENLNTLEATQKIH-------NEEAEALKKEGNEAMIEGQYEEAIKKYTEAIQFSK 113

Query: 116 KNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYED 175
                 +  Y SN+SLA +K GRYE+A +DA   I IDP+FSK YSRL  AK  Q+K ED
Sbjct: 114 ------NVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLED 167

Query: 176 AMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPP--- 232
            M AYK+ +DLEG  A+ T+  D+E  + K+E L    + DS     I E  ++  P   
Sbjct: 168 GMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQL--KKNDDSEERKSIKEVTSEECPEKN 225

Query: 233 --KDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQL 290
             +DE     +   + +    +  T EE+ +   +    NIA+L+G+G+G ++NNPQ++ 
Sbjct: 226 NNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLS--NIARLLGSGVGGLMNNPQLKQ 283

Query: 291 ALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDA--ANQSPEEFFKSEKFKNLVNSFIP 348
            +      NPDA+R+V+++ NNP+ +  LS+LM+     ++P+E  +S    NL+ SF+ 
Sbjct: 284 MVFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTKMGGKTPQEMLQSGTVNNLIQSFLA 343

Query: 349 G 349
           G
Sbjct: 344 G 344

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  164 bits (416), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 155/250 (62%), Gaps = 24/250 (9%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEE----VSADSDL 56
           MS+SNK+IA+ I+ +LS+++   +V+ED A+S++VA++CI ++F+ + +    V   S  
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 57  ATVLLANLNLEP-------------EPKLSEKERELVNEQAIKLKLEGNKAVERENYKDA 103
              L + LN                +  ++E + E  +E A  LKLEGNKA+  ++Y+ A
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTE-ASEAAEALKLEGNKAMAGKDYELA 119

Query: 104 IDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRL 163
           I KYT AI  L  N +     Y +N++ A +   +Y+EA +DA + IKI+PT+SKGYSRL
Sbjct: 120 IKKYTEAIATLPTNAV-----YFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRL 174

Query: 164 AEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGSATP 222
             AK  Q K EDA+ AYK+VLD+EG+KAT+ MKRD+E  K+K E +LN      SG+AT 
Sbjct: 175 GFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATA 234

Query: 223 ISEAANKYPP 232
            S++A+   P
Sbjct: 235 ESDSASAADP 244

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  157 bits (397), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 191/370 (51%), Gaps = 62/370 (16%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS------ 54
           MSLSNKE+ S IV +LS++I+  +++ED A+S++VAI+CI +SF+ + +  A +      
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 55  --DLATVLLANLNLEPEPKLSEKEREL-----VNEQAIK-----LKLEGNKAVERENYKD 102
              L  +L +          SEKE  +     V +  IK      KLEGNKA+  ++Y+ 
Sbjct: 61  GKTLKEILSSASATS---TGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162
           AI+KY+ AI       LP +  Y +N++ A +    Y+ A  DA   I+IDP +SKGYSR
Sbjct: 118 AIEKYSEAI-----KTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSR 172

Query: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATP 222
           LA AK   NK E+A+  YK+VLD+EG+KAT  MKRDFE+ K + E+   S +++  S T 
Sbjct: 173 LAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVES---SMNLEKSSTT- 228

Query: 223 ISEAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLI-----GN 277
                                     P    +  ++ + P   +   +++ L        
Sbjct: 229 -------------------------TPEPSRSAGQQPANPFAGSGMPDMSSLFGNGGGMG 263

Query: 278 GIGTILNNPQVQLALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSPEEFFKSE 337
           G+ + LNNPQV  A       +P++ +K+QE+  NP  +  ++Q + + + + ++   + 
Sbjct: 264 GLSSFLNNPQVMQAAQQM-MSDPNSMQKMQEMMQNPNLR-EMAQNLASGDANLDDLMNNP 321

Query: 338 KFKNLVNSFI 347
             K++ N+  
Sbjct: 322 SVKDMANNLF 331

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  156 bits (394), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 139/229 (60%), Gaps = 19/229 (8%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53
           M+ SNKEIA+ IV +LSS +    V+EDYA+S++VAI+CI ++F+ + +  ++       
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 54  ----SDLATVLLANLNLEPEPKLSEKERELVNEQAIK--LKLEGNKAVERENYKDAIDKY 107
                +L       L  + EP       E  N +A    LKL+GNKA+  ++++ AI KY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167
           T AI++L  N +     Y +N++ A +   +YEE+  DA + IK++P++SKGYSRL  AK
Sbjct: 121 TEAIEVLPSNAV-----YYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAK 175

Query: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215
               K E+A+ AYK VLD+EG+KATD MKRD+E  K+K E +LN    +
Sbjct: 176 YALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSV 224

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  155 bits (391), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/355 (31%), Positives = 181/355 (50%), Gaps = 66/355 (18%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLAT-- 58
           MS SNK+IA+ +V +LS+ I    V+ D A+S++VAI+CI ++F+ +++    S LA+  
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKD-DVKSTLASKF 59

Query: 59  -------VLLANLNLE-----PEP---KLSEKERELVNEQAIK---LKLEGNKAVERENY 100
                  +L A  N +     PE     +S+K+ E   E A K   LKLEGNKA+  ++Y
Sbjct: 60  GGKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDY 119

Query: 101 KDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGY 160
             A++KY  AI L+     P    Y +N++ A +   +Y+EA  DA + IK++P +SKGY
Sbjct: 120 NLAVEKYNAAIKLV-----PTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGY 174

Query: 161 SRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGS 219
           SRL  AK  Q K ++A+ AYK+ L+++G+KATD MKRD+E  K+K E +LN        +
Sbjct: 175 SRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSA 234

Query: 220 ATPISEAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGI 279
           +   S +A   P                                      ++A ++G G+
Sbjct: 235 SASASASAGGMP--------------------------------------DMASMLGGGL 256

Query: 280 GTILNNPQVQLALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSPEEFF 334
           G+ LNNPQ+  A       NP A  +++ +  NP  +     L   +++   +F 
Sbjct: 257 GSFLNNPQIMQAAQQM-MSNPRAMEQMESMMQNPSIRQMAENLSSGSSEGMGDFM 310

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  154 bits (389), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 177/334 (52%), Gaps = 63/334 (18%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDL----QEEVSAD--- 53
           MSL+NK+  + IV+YL  +I   +V+ED AES++VAI+CI D F+L    +E++  D   
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 54  -SDLATVLLANLNLEPEPKLSEKE--RELVNE----QAIKLKLEGNKAVERENYKDAIDK 106
            SDL T+ L  L L+    + E E   E ++E    +A  LKLEGNK +  +NYK AIDK
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 107 YTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEA 166
           Y++AI++      P +  Y SN++ A      +  A  DA   IK+DPT+SK YSRL  A
Sbjct: 121 YSKAIEIY-----PSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175

Query: 167 KIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITK---QKFETLNFSTHIDSGSATPI 223
           K+ +   EDA++A+K+VL+LEG+K+T+ MK D+E  K   Q F TLN +    SG     
Sbjct: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP---- 231

Query: 224 SEAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTIL 283
                  PP                              NT     +IA ++G+  G+++
Sbjct: 232 -------PPL-----------------------------NTTDVLTDIATVLGSSFGSLM 255

Query: 284 NNP-QVQLALSHFAQRNPDAARKVQEISNNPMFK 316
           NN   +Q A      +NP+  ++V+ +  NP+ +
Sbjct: 256 NNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVR 289

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  154 bits (389), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/329 (32%), Positives = 178/329 (54%), Gaps = 46/329 (13%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53
           M+ SNKEIA+ IV YL++++   +V+ D A+S++VA++CI ++F+ + +   D       
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 54  -----SDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYT 108
                S L+     ++ +      +++E++   E    LKLEGNKA+  ++Y+ AI KY+
Sbjct: 61  GNGLTSFLSGSATNDIQVNIADDAADEEQKATAE---GLKLEGNKAMATKDYESAIKKYS 117

Query: 109 RAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKI 168
            AI++L  N +     Y +N++ A +   +Y++A +DA + IK++PT+SKGYSRL  AK 
Sbjct: 118 EAIEVLPTNAV-----YYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKF 172

Query: 169 GQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGSATPISEAA 227
            Q K EDA++AYK+VLD+EG+KATD MKRD+E  K+K E +LN                 
Sbjct: 173 AQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLE--------------- 217

Query: 228 NKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQ 287
            K  PK+ E  + +     D              P+ ++            +G +L NPQ
Sbjct: 218 -KVTPKEAETESNA-----DAGTGAAGMGGMGGFPDLSSMLGGGLGGG---LGDLLKNPQ 268

Query: 288 VQLALSHFAQRNPDAARKVQEISNNPMFK 316
           +  A     Q NP+A ++++ +  NP  +
Sbjct: 269 IMQAAQQMMQ-NPNAMQQMESMMQNPAVR 296

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  153 bits (387), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/220 (42%), Positives = 132/220 (60%), Gaps = 18/220 (8%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQE----EVSADSDL 56
           MS SNKE+AS IV YLS L+    V+E+  +S++VAI+CI +SF++Q+     V     L
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVFGGKGL 60

Query: 57  ATVLLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDAIDKY 107
             +L        E   ++ E   VN          +A  LKLEGNKA+  +++  AI KY
Sbjct: 61  VELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLAIKKY 120

Query: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167
           + AI++L     P +  Y +N++ A +    YEEA  DA + IK DPT+SKGYSRL  AK
Sbjct: 121 SDAIEVL-----PTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207
               + EDA+ AYK+VLD+EG+KA+D MKRD+E  K+K E
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVE 215

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  152 bits (384), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 107/375 (28%), Positives = 175/375 (46%), Gaps = 74/375 (19%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEV---------- 50
           M+ SNKE++S I+ YL+ ++   +V+ D  +S++VAI+C+ + F ++++           
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 51  --------------SADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVE 96
                         + ++D        +N+  E   ++ + E        LKLEGNKAV 
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAE-------ALKLEGNKAVA 113

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
            ++Y  A++KYT AI +L  N +     Y +N++ A T S  Y+EA  DA   IK+DP +
Sbjct: 114 SKDYDLAVEKYTEAIKILPTNAV-----YFANRAAAYTNSQNYDEAVKDAEEAIKLDPAY 168

Query: 157 SKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215
           SKGYSRLA AK  Q  +E+++ AYK+VL++EG+ AT+  KR +E  K++ E +LN    +
Sbjct: 169 SKGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV 228

Query: 216 DSGSATPISEAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLI 275
            + SA                               QTN       P+        + L+
Sbjct: 229 PTESA-----------------------------GGQTNPAAGGGFPD-------FSSLM 252

Query: 276 GNGIGTILNNPQVQLALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSPEEFFK 335
             G+  ++NNPQ+  A       NP A  K+Q +  NP  +    Q          E   
Sbjct: 253 SGGLEGLMNNPQMMQAAQSM-MSNPGAMEKIQSMMQNPAIQQMAEQFKGGNTPDFSEMMN 311

Query: 336 SEKFKNLVNSFIPGA 350
           +   +N+ +S   GA
Sbjct: 312 NPAVRNMASSLFSGA 326

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  150 bits (380), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 105/358 (29%), Positives = 178/358 (49%), Gaps = 55/358 (15%)

Query: 5   NKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQ----EEVSADSDLATVL 60
           +KE+A+ I+ YL  ++    V EDY +S++VAI+CI +SF+++    + V   S ++  L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 61  LANLNLEPEPKLSEKEREL--------VNEQAIKLKLEGNKAVERENYKDAIDKYTRAID 112
              L       +  ++ ++           +A  LKLEGNKA+  ++++ AI KY+ AI+
Sbjct: 62  EECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIE 121

Query: 113 LLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNK 172
           +L  N +     Y +N++ A +   +Y+EA  DA   I+IDP +SKGYSRL  AK  QNK
Sbjct: 122 VLPTNAI-----YYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 173 YEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGSATPISEAANKYP 231
            E+A+ AYK+V+DLEG+KATD MKRD+E  K+K E +LN     D+              
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDA-------------- 222

Query: 232 PKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLA 291
                                 ++             F+ + ++  G+  ++NNPQ+  A
Sbjct: 223 -------------------RGADSGAGAGAGAGGAGGFDFSSMLSGGLSGLMNNPQIMQA 263

Query: 292 LSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSP--EEFFKSEKFKNLVNSFI 347
                  NP A +++Q +  +P  +    Q   + N +P  ++   +   +N+ +S  
Sbjct: 264 AQQM-MSNPQALQQMQSMMQDPSIRQMAEQFT-SGNGTPNMDDLMSNPALRNMASSMF 319

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  149 bits (377), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 144/246 (58%), Gaps = 33/246 (13%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60
           M LSNKEI++ IV YL  +     V+ED  +S++VAI+CI DSF+ + + +  S L    
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDST--SGLIKSK 58

Query: 61  LANLNLEPEPKL-------SEKERELVN-------------EQAIKLKLEGNKAVERENY 100
             NL+L   P+L       S KE   VN              +A KLKLEGNKA+  +++
Sbjct: 59  FYNLSL---PELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDF 115

Query: 101 KDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGY 160
             AI KY+ AI +   N +     Y +N++ A +    +E+A +DA + I++DP +SKGY
Sbjct: 116 DLAIAKYSEAISISPNNAI-----YYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGY 170

Query: 161 SRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSA 220
           SRL  AK   NK E+A+ AYK+VLDLEG+KAT+ MKRD+E  K++ E    S +++   +
Sbjct: 171 SRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQ---SLNLEKKES 227

Query: 221 TPISEA 226
           TP  E+
Sbjct: 228 TPKEES 233

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  149 bits (375), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 139/218 (63%), Gaps = 21/218 (9%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDL---------QEEVS 51
           MS SNK+IA+ IV +L++  +T  V EDY +S+ VAI+CI ++F+L          E+  
Sbjct: 1   MSPSNKDIAALIVDFLTTSAKT--VGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 52  ADS--DLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTR 109
             S   L T  +A+ +   EPK++ +E   + ++A  LKLEGN+A+  ++Y+ AI KYT 
Sbjct: 59  GRSLSQLLTTGMAHTSDAGEPKVAAEE---LKKEAEALKLEGNRAMAAKDYETAIQKYTA 115

Query: 110 AIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIG 169
           AI++L     P D  Y +N++ A +   +YE+A +DA    K+D ++SKG+SRL  AK  
Sbjct: 116 AIEVL-----PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYA 170

Query: 170 QNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207
             ++E+A+ AYK+VLD+EG+ AT+ M+RD+E  K+K E
Sbjct: 171 LGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVE 208

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  148 bits (373), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 184/365 (50%), Gaps = 68/365 (18%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVS------ADS 54
           M  SNKEIA+ IV +LS+   T  V E+Y +S++VAI+CI ++F+++ E S      A +
Sbjct: 1   MPGSNKEIAALIVQFLST--STKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 55  DLATVLLANLNLEPEPKLSEKE---------RELVNEQAIKLKLEGNKAVERENYKDAID 105
               V L       EP LS  E            V E+A  LKLEGNKA   ++++ A+ 
Sbjct: 59  GRGLVDLVKSGAS-EPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVK 117

Query: 106 KYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAE 165
           KYT AI+L+  N +     +  N++ A +   ++EEA  DA + ++I+P++S+GYSRL  
Sbjct: 118 KYTEAIELMPNNAV-----FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGL 172

Query: 166 AKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHIDSGSATPIS 224
           AK    K E+AM AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN              
Sbjct: 173 AKYALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEAL---------- 222

Query: 225 EAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILN 284
                  PK EE +T         P                    +++ ++G G+G +LN
Sbjct: 223 -------PKGEEQQTSEGSSAGGFP--------------------DLSSMLGGGLGGLLN 255

Query: 285 NPQVQLALSHFAQRNPDAARKVQEISNNPMFKMALSQLMDAANQSPE--EFFKSEKFKNL 342
           NPQV  A     Q NP A   +QE+ NNP  K  ++Q   +   +P   +  K    K++
Sbjct: 256 NPQVMQAAQKMMQ-NPSA---MQEMMNNPAIKQ-MAQNFASGGGTPNLGDMMKDPNIKDM 310

Query: 343 VNSFI 347
              F 
Sbjct: 311 AGKFF 315

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  148 bits (374), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 134/224 (59%), Gaps = 22/224 (9%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS------ 54
           MSL+NK+I + IV +LS++I   +V+ED A+S++VA++CI ++ +   EV  ++      
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 55  --DLATVLLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDA 103
              L  +L           + ++E   VN           A   KLEGNKA+  +++  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 104 IDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRL 163
           ++KYT AI +L  N +     Y +N++ A +    +EEA  DA + IKIDP++SKGYSRL
Sbjct: 121 VEKYTEAIKILPTNAI-----YYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRL 175

Query: 164 AEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207
           A AK G  K+E+A+ +YK+VLD+EG+ AT  MKRD+E  K++ E
Sbjct: 176 AFAKYGLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVE 219

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  147 bits (371), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 14/216 (6%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60
           M+ SNK+I+S IV YL+ ++    V+ED  +S++VAIECI ++F +++  S+ +     L
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAAFGGKNL 60

Query: 61  LANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDAIDKYTRAI 111
              L+       S+ E   VN          +A  LKLEGNKA+  ++Y+ AI KY+ AI
Sbjct: 61  AELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKYSEAI 120

Query: 112 DLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQN 171
            ++  N +     Y +N++ A +    Y+EA  DA + +K+D ++SKGYSRL  AK  Q 
Sbjct: 121 SVVPTNAV-----YYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175

Query: 172 KYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207
           K E+A+ AYK+VLD+EG+ ATD MKRD+E  K+K E
Sbjct: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVE 211

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  146 bits (369), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 141/235 (60%), Gaps = 26/235 (11%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEE----VSADSDL 56
           MS S  EIAS IV+Y SS++   +++ED A+S++VA++CI ++F  + E    +  +S+ 
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 57  ATVLLANLNLEPEPKLSE---------------KERELVNEQAIKLKLEGNKAVERENYK 101
               L +L L    ++SE               +E   +  +A  LK++GNKA+  ++Y+
Sbjct: 61  KGQNLTDL-LNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYE 119

Query: 102 DAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYS 161
            AI+KYT AI +L  N +     Y +N++ A +    Y+EA +DA + I IDPT+ +GYS
Sbjct: 120 LAINKYTEAIKVLPTNAI-----YYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYS 174

Query: 162 RLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215
           RL  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTV 229

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  143 bits (361), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 144/244 (59%), Gaps = 31/244 (12%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60
           MSLSNKEIA+ IV +LSS   +  V EDY +S++VAI+CI ++F  + +     +  +++
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSS--VNEDYVDSLNVAIDCITEAFQFERD-----ETDSLI 53

Query: 61  LANLNLEPEPKL--SEKERELVNEQAIKLKL----------------EGNKAVERENYKD 102
               N +  P+L  S      V+ + +K+ +                +GNKA+  + + +
Sbjct: 54  SGPFNGKKLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDE 113

Query: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162
           AI+KYT AI++   N +     Y SN++ A +   +YE+A  DA   I++DPT+SKG+SR
Sbjct: 114 AIEKYTAAIEVSPSNAV-----YYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSR 168

Query: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFET-LNFSTHIDSGSAT 221
           L  AK   NK E+A++AYK+VLD+EG KATD MKRD+E  K+K ET +N      S S+ 
Sbjct: 169 LGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSE 228

Query: 222 PISE 225
            +S+
Sbjct: 229 DVSD 232

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  143 bits (360), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/230 (39%), Positives = 140/230 (60%), Gaps = 24/230 (10%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEE-VSADSDLATV 59
           MS S +EIAS IV+Y SS++   +V+ED A+S++VA++CI ++F  + + VS+  D +T 
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  --------LLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKD 102
                   L ++  L    K  + +   VN          +A +LK++GNKA+  + Y+ 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162
           AI KYT AID+L  N +     Y +N++ A +    Y+EA  DA + I +DP++ +GYSR
Sbjct: 121 AIKKYTEAIDVLPTNAI-----YYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSR 175

Query: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNF 211
           L  AK  Q K E+A+ AYK+VLD+EG+ ATD MKRD+E  K++ E +LN 
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNL 225

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  142 bits (358), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 138/234 (58%), Gaps = 24/234 (10%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53
           MS S +EIA+ IV+Y SS++   +++ED A+S++VA++CI ++F  + E  +        
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 54  --SDLATVLLANLNLEPEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKD 102
               LA +L +   +    K  + E   +N          +A  LK++GNKA+  ++Y+ 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 103 AIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSR 162
           AI+KYT AI +L  N +     Y +N++ A +    Y++A  DA + I IDP++ +GYSR
Sbjct: 121 AINKYTEAIKVLPTNAI-----YYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSR 175

Query: 163 LAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215
           L  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 176 LGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTV 229

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  141 bits (355), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/224 (38%), Positives = 134/224 (59%), Gaps = 19/224 (8%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS------ 54
           MS SNK++A+ IV +LS  +   +V+EDY +S++VAI+CI ++F+   E  A +      
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 55  --DLATVLLANLNLEPEPKLSEK-----ERELVNEQAIKLKLEGNKAVERENYKDAIDKY 107
              L  V+ A       P+ S K     E      +A  LKLEGNKA+  ++++ A+ KY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 108 TRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAK 167
           + AI +L  N +     Y +N++ A +   +YEEA  DA   IK++P++SKGYSRL  A+
Sbjct: 121 SEAIQVLPTNAV-----YYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQ 175

Query: 168 IGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKF-ETLN 210
               K E+A++AYK+VLD+EG  ATD MKRD++   +K  ++LN
Sbjct: 176 YALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLN 219

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  140 bits (352), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 139/235 (59%), Gaps = 26/235 (11%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD----SDL 56
           M  S +EIA+ IV+Y SS++   +++ED A+S++VA++CI ++F  + + ++     S+ 
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 57  ATVLLANLNLEPEPKLSE---------------KERELVNEQAIKLKLEGNKAVERENYK 101
               LA++ L    K SE               +E      +A  LK++GNKA+  ++Y+
Sbjct: 61  KGKSLADV-LNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYE 119

Query: 102 DAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYS 161
            AI+KYT AI +L  N +     Y +N++ A +    Y+EA  DA + I IDP++ +GYS
Sbjct: 120 LAINKYTEAIQVLPTNAI-----YYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYS 174

Query: 162 RLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNFSTHI 215
           RL  AK  Q K E+A+ AYK+VLD+EG+ AT+ MKRD+E  K+K E +LN    +
Sbjct: 175 RLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAV 229

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  127 bits (320), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/250 (34%), Positives = 145/250 (58%), Gaps = 26/250 (10%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60
           M+ + KE+AS I+ YL       ++ EDY +S++VAI+C+ ++F++++E +  S +    
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESA--SSVIEKS 58

Query: 61  LANLNLE-------PEPKLSEKERELVN---------EQAIKLKLEGNKAVERENYKDAI 104
               +LE         P  +++E   VN          +A  LKLEGNKA+  ++++ AI
Sbjct: 59  FGGQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAI 118

Query: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164
            KY+ AI  L  N +     Y +N++ A +   +Y EA +DA A IK++P++SKGYSRL 
Sbjct: 119 SKYSEAIRTLPSNAV-----YFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLG 173

Query: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNF--STHIDSGSAT 221
            A+    + E+A++AYK+VLD+EG+ ATD MKRD++   +K E +LN   S    S + +
Sbjct: 174 FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAES 233

Query: 222 PISEAANKYP 231
           P +   + +P
Sbjct: 234 PDAAGGSGFP 243

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  123 bits (308), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 105/399 (26%), Positives = 176/399 (44%), Gaps = 102/399 (25%)

Query: 3   LSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADS-------- 54
           +++K++A  IV++L ++I   ++++D  +S++VAI+CI+  ++L E   + S        
Sbjct: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKS 65

Query: 55  DLATVL----------------LANLNLEPEP---------------------------- 70
           DL ++L                   L LEP                              
Sbjct: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125

Query: 71  --KLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSN 128
               S+K++++    A   K EGN+ +  E+YK AI+ YT AI     +  P D  Y SN
Sbjct: 126 KNNFSDKDKQI----ADTFKDEGNRLMFSEDYKKAIECYTNAI-----SKYPCDPIYYSN 176

Query: 129 KSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG 188
           +S+A  K   YE A +DA  CI ID  FSK Y RLA  K+ Q++Y DA++ YK+ ++L  
Sbjct: 177 RSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNK 236

Query: 189 NKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSLVKVDV 248
           +   + + R+FE  K K                               ++T  SL ++  
Sbjct: 237 DSVPEKITREFEDLKLK-------------------------------VQTDISLREISN 265

Query: 249 PAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNPDAARKVQE 308
                N NE       N+P  +I  ++G+G   +L+NP +Q  +    Q NPDAA+ +  
Sbjct: 266 DHSNNNYNENSYNSTKNSP--DIGSILGDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGY 323

Query: 309 ISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFI 347
           +  NP  K  L    + +       F  + F +L++S +
Sbjct: 324 VLANPAMKNLLQNFKNGS------AFDKKLFMDLLDSLL 356

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 163/372 (43%), Gaps = 95/372 (25%)

Query: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSAD------- 53
           M+ +++EIAS IV Y +  I +G++ +D  +S++VAI+CI D FD+ +++ ++       
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 54  -SDLATVL---------------LANLNLEPEPKLS------------------------ 73
            +DL T L                 N++++ + K++                        
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 74  EKERELVNE---QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKS 130
            KE ++ N+   +A KLK +GN+ ++ + Y  AI  Y+ AI L      P +  Y +N++
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKL-----YPTNFNYYNNRA 175

Query: 131 LALTKSGRYEEACDDALACIKID----PTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
           LA  K+  ++ A  DA   I+ID    PT  K Y RL  AK     YE ++ A+K+++++
Sbjct: 176 LAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEI 235

Query: 187 -----EGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRS 241
                +G++ T  M  D+E  K+K + L F     S        + N             
Sbjct: 236 AQENNKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVN------------- 282

Query: 242 SLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNPD 301
                D P  +   N+             I  + GN +  I++NP  +  +      NP 
Sbjct: 283 -----DGPKRKVTLND-------------ILNMAGNNLNIIMSNPLFKEVVEQLLASNPQ 324

Query: 302 AARKVQEISNNP 313
           A ++   + N+P
Sbjct: 325 AKQQFDNVMNDP 336

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 70/112 (62%), Gaps = 4/112 (3%)

Query: 80  VNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRY 139
           +++ A + K EGN A   ++Y+ AID +T+AI++   +  P    Y SN+S A T S +Y
Sbjct: 1   MSKTADEYKQEGNTAFVAKDYQKAIDAFTKAIEV---SETPNHVLY-SNRSAAYTSSKQY 56

Query: 140 EEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKA 191
           E+A  DA  CIKI+P+++KGY+R   A  G +KYE+A   Y + L ++ N A
Sbjct: 57  EQALSDADECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 64/121 (52%), Gaps = 11/121 (9%)

Query: 67  EPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVD-RGY 125
           E + K  E E  L  E+A + +LEG +   + ++ +A+  YT   +++K+   P D RGY
Sbjct: 368 EKDLKQQEAEAYLSPEKAEEARLEGKEYFTKADWPNAVKSYT---EMIKR--APDDARGY 422

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
            SN++ AL K   + +A  D    I+ DP+F + Y R A  +I   ++  A+    + LD
Sbjct: 423 -SNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRKATCQIAVKEFAGAI----ETLD 477

Query: 186 L 186
           L
Sbjct: 478 L 478

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 13/109 (11%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE-- 140
           +A K K EGNKA +   + +AI  Y +A +  K      D  YL+N+S A  + G YE  
Sbjct: 250 EADKAKAEGNKAYKARQFDEAISHYNQAWETFK------DITYLNNRSAAEYEKGDYETC 303

Query: 141 -----EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
                EA ++A          +K ++R+  A    +  + A+  Y++ L
Sbjct: 304 IKTLTEAVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL 352

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 6/107 (5%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL-SNKSLALTKSGRYEEA 142
           A + K +GN A   +++  AI+ +T+AI++      P     L SN+S A T + +++EA
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVS-----PTPNHVLYSNRSAAYTSAKQFQEA 59

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
            +DA  C+KI+PT+SKGY+RL  A+ G    E+A   YK+ L L+ N
Sbjct: 60  LNDATECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNN 106

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 90/174 (51%), Gaps = 12/174 (6%)

Query: 40  IRDSFDLQEEVSADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVEREN 99
           ++ S D  ++   +   A +L    N E E K  E E+ +  E+A + +LEG +   + +
Sbjct: 345 LKKSIDYYQKSLTEHRTADILTKLRNCEKELKKQEAEQYIDPEKAEEARLEGKEYFTKGD 404

Query: 100 YKDAIDKYTRAIDLLKKNGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSK 158
           + +A+  Y+   +++K+   P D RGY SN++ AL+K   + EA  D    IK DP F +
Sbjct: 405 WPNAVKAYS---EMIKR--APEDARGY-SNRAAALSKLMSFPEAIKDCDNAIKKDPNFVR 458

Query: 159 GYSRLAEAKIGQNKYEDAMNAYKQVLDLE-----GNKATDTMKRDFEITKQKFE 207
            Y R A A+I   +Y +A++  ++    +     G  + + M+   + T+++F+
Sbjct: 459 AYIRKATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMRLQMKATQERFQ 512

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A + K+EGNK  +   + +AI++Y +A  L K      D  YL+N+S A  + G +E  
Sbjct: 254 EADEAKVEGNKLYKAHKFDEAIEQYNKAWALNK------DITYLNNRSAAEFEKGDFE-- 305

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE 187
                A   ++    +G    A+ KI    +    NAY +  DL+
Sbjct: 306 ----TAIATLNEAVDQGRELRADYKIIAKSFARIGNAYHKKGDLK 346

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y+ AID +++AI++ +      +  + SN+S       ++ EA 
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSET----PNHVFYSNRSACYASLKKFPEAL 59

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKAT----DTMKRD 198
           +DA  C+KI+PT+SKGY+RL  A +G    ++A  +YK+ L+L+G N+A     D +KR 
Sbjct: 60  NDAEECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSNQAAKDGLDQVKRT 119

Query: 199 FEITKQKFETLNFS 212
            E ++Q    L  S
Sbjct: 120 QE-SRQGMPDLGLS 132

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 5/113 (4%)

Query: 65  NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRG 124
           N E E K  E E  +  E+A + +LEG     + ++ +A+  YT  I    ++     RG
Sbjct: 371 NTEKELKKQEAEEYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDA----RG 426

Query: 125 YLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           Y SN++ AL+K   + EA +D    I+ DP F + Y R A A+I   ++  A+
Sbjct: 427 Y-SNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRKATAQIAVKEFAAAI 478

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 67/109 (61%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   +NY +AI+K+T+AI++   +  P    Y SN+S   T   ++ +  
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEV---SETPNHVLY-SNRSACYTSKKQFVKGL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKA 191
           +DA  C+KI+PT+SKGY+R+  A  G    ++A  AYK+ L+L+  NKA
Sbjct: 61  EDANECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSNKA 109

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 7/131 (5%)

Query: 40  IRDSFDLQEEVSADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVEREN 99
           I+ + +  ++   +   A VL    N E   K  E E  +  E+A + +LEG +   + +
Sbjct: 345 IKSAINYYQKSLTEHRTAEVLTKLRNAEKLLKKQESEAYINPEKAEEARLEGKEYFTKGD 404

Query: 100 YKDAIDKYTRAIDLLKKNGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSK 158
           + +A+  YT   +++ ++  P D RGY SN++ AL+K   + EA  D    I+ DP F +
Sbjct: 405 WPNAVKAYT---EMIARD--PSDARGY-SNRAAALSKLMSFPEAITDCNTAIEKDPNFIR 458

Query: 159 GYSRLAEAKIG 169
            Y R A A+I 
Sbjct: 459 AYIRKATAQIA 469

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 13/104 (12%)

Query: 88  KLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDAL 147
           K EGNK  +   + +AI+ Y +A +L        D  YL+N+S A  + G Y+ A +   
Sbjct: 259 KAEGNKLYKAHKFDEAIEHYNKAWELHN------DITYLNNRSAAEFEKGDYQTAIETLH 312

Query: 148 ACIKIDPTF-------SKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
             ++            +K ++R+A + +  N  + A+N Y++ L
Sbjct: 313 EAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 67/109 (61%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y  AID +T+AI++   +  P    Y SN+S   T   ++ +A 
Sbjct: 5   ADEYKQQGNAAFTAKDYGKAIDLFTKAIEV---SEAPNHVLY-SNRSACYTSLKKFTDAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKA 191
           +DA  C+KI+P++SKGY+RL  A +G    +DA + YK+ L+L+  NKA
Sbjct: 61  NDATECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAANKA 109

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 7/122 (5%)

Query: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKK 116
           A +L    N E E K +E E  +  E+A + +LEG +   + ++ +A+  YT   +++K+
Sbjct: 366 ADILTKLRNAEKELKKAEAEAYINPEKAEEARLEGKEYFTKSDWPNAVKAYT---EMIKR 422

Query: 117 NGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYED 175
           +  P D RGY SN++ AL K   + EA  D    I+ DP F + Y R A A+I   ++  
Sbjct: 423 S--PEDARGY-SNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEFAG 479

Query: 176 AM 177
           A+
Sbjct: 480 AL 481

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 5/110 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y  AID +T+AI++   +  P    Y SN+S     + ++EEA 
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEV---SETPNHVLY-SNRSACYASNKKFEEAL 58

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKAT 192
            DA  C+KI P++SKGY+R+  A+ G ++ ++A  +YK+ L+L+  NKA 
Sbjct: 59  KDAEECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSNKAA 108

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 5/121 (4%)

Query: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKK 116
           A VL    + E E K +E E  +  E+A + +L+G +   + ++ +A+  YT   +++K+
Sbjct: 353 AEVLNKLRSTEKELKKAESEAYVNPEKAEEARLQGKEFFTKGDWPNAVKAYT---EMVKR 409

Query: 117 NGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
              P D    SN++ AL K   + EA +D    + IDP F + Y R A A+I   ++  A
Sbjct: 410 --APQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAA 467

Query: 177 M 177
           +
Sbjct: 468 I 468

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 4/106 (3%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   +NY  AI+ +T+AI++ +     +     SN+S   T   ++ +A 
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVL----FSNRSACYTSLKKFSDAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
           +DA  C+KI+P++SKGY+RL  A +G    ++A + YK+ L+L+ N
Sbjct: 61  NDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDAN 106

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 85/169 (50%), Gaps = 18/169 (10%)

Query: 60  LLANL-NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNG 118
           +LA L N+E E K +E E  +  ++A + +LEG +   + ++ +A+  YT  I    ++ 
Sbjct: 371 ILAKLRNVEKEQKKAEAEAYINPDKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDA 430

Query: 119 LPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMN 178
               RGY SN++ AL K   + EA  D    I+ DP F + Y R+A A+I   ++  A+ 
Sbjct: 431 ----RGY-SNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRMAAAQIAVKEFAAALE 485

Query: 179 A--YKQVLDLEGNKATDTMKRD---FEITKQKFETLNFSTHIDSGSATP 222
                +  D E NK     + D   ++ ++Q+F+        D+GS TP
Sbjct: 486 TLDVARTKDAEVNKGASAKEIDQLYYKASQQRFQP-------DTGSETP 527

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 55/121 (45%), Gaps = 14/121 (11%)

Query: 67  EPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL 126
           EPEP   E + +    +A   K EGNK  +   + +AI+ Y RA +L K      D  YL
Sbjct: 247 EPEP--MEVDEDNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELHK------DITYL 298

Query: 127 SNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
           +N++ A  + G YE           ++    KG    A+ K+    +    NAY ++ DL
Sbjct: 299 NNRAAAEYEKGDYE------TVIATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDL 352

Query: 187 E 187
           +
Sbjct: 353 K 353

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 62/106 (58%), Gaps = 4/106 (3%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   + Y +A+D +T+AI++ +    P    Y SN+S +     ++ EA 
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSE---TPNHVLY-SNRSASYASEQKFNEAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
            DAL C KI+P+++KGY+R   A  G    +DA  +YK+ L+L+ N
Sbjct: 61  KDALECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDAN 106

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 7/89 (7%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVD-RGYLSNKSLALTKSGRYE 140
           E+A + +LEG +   + ++  A+  YT   +++K+   P D RGY SN++ AL+K   + 
Sbjct: 383 EKAEEARLEGKEYFTKGDWPSAVKAYT---EMIKR--APEDARGY-SNRAAALSKLMSFP 436

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIG 169
           +A  D    I+ DP F + Y R A A+I 
Sbjct: 437 DAISDCNKAIEKDPNFVRAYIRKATAQIA 465

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 64/128 (50%), Gaps = 19/128 (14%)

Query: 67  EPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL 126
           EPE +  + +++     A + K+EGNKA +  N+ +AI  Y +A +L   N +     YL
Sbjct: 234 EPEAESMDVDQDESKVAAEEAKVEGNKAYKARNFDEAIACYNKAWEL--DNNI----TYL 287

Query: 127 SNKSLALTKSGRYEEACD----------DALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
           +N+S A  + G Y+ A +          +  A  KI    +K ++R+  A +     ++A
Sbjct: 288 NNRSAAEFEKGEYDTAINTLNEAIEKGREMRADYKI---IAKSFARIGNAYVKMGNLKEA 344

Query: 177 MNAYKQVL 184
           +N Y++ L
Sbjct: 345 INHYQKSL 352

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 63/106 (59%), Gaps = 4/106 (3%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A +LK +GN A   +++  AI+ +T AI     +  P    Y SN+S   T   +++EA 
Sbjct: 4   ADELKQKGNAAFASKDFTGAIEYFTEAI---AASTTPNHVLY-SNRSACYTSLKQFQEAL 59

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
           +DA  C+KI+P +SKGY+R+  A +G    +DA + YK+ L+L+ N
Sbjct: 60  NDAQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSN 105

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 73/156 (46%), Gaps = 10/156 (6%)

Query: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKK 116
           A +L      E E K  E E  +  E+A + +LEG +   + ++ +A+  YT  I    +
Sbjct: 363 ADILTKLRTCEKELKKQEIEEYINPEKAEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPE 422

Query: 117 NGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
           +     RGY SN++ AL K   + EA  D    I+ DP F + Y R A A+I    +  A
Sbjct: 423 DA----RGY-SNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRKATAQIAIKDFVKA 477

Query: 177 MNAYKQVLDLE-----GNKATDTMKRDFEITKQKFE 207
           +   ++    +     G  + + MK   + T+++F+
Sbjct: 478 LETLEEAKKKDDEVNNGASSNEIMKLQMKATQERFQ 513

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 66/110 (60%), Gaps = 5/110 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K EGN+A   ++Y  AI+ +T+AI++ ++     +    SN+S     +  + +A 
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQ----PNHVLFSNRSACYASNKDFVKAL 58

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKAT 192
           DDA  C+KI+P+++KGY+RL  A  G    ++A  +YK+ L+L+  NKA 
Sbjct: 59  DDANECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSANKAA 108

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 120/279 (43%), Gaps = 58/279 (20%)

Query: 40  IRDSFDLQEEVSADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVEREN 99
           ++ + D  E+   +     +L    N E E K  E E  +  E+A + +L+G +   + +
Sbjct: 345 LKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEARLQGKEYFTKAD 404

Query: 100 YKDAIDKYTRAIDLLKKNGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSK 158
           +  A++ YT   +++K+N  P D RGY SN++ AL+K   + +A  D    I+ DP F +
Sbjct: 405 WPKAVEAYT---EMIKRN--PNDARGY-SNRAAALSKLMSFADAIRDCDKAIEKDPNFVR 458

Query: 159 GYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSG 218
            Y R A  +I    Y  A+    + LD    K                        ++SG
Sbjct: 459 AYIRKATGQIAIKDYAGAI----ETLDSARTK---------------------DAEVNSG 493

Query: 219 SATPISEAANKYPPKDEEIRTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNG 278
           + T           + +++  ++S  + + PA    T EE     T  P           
Sbjct: 494 ANT----------REIDQLYIKASQARFE-PANANETPEEAYARATKDPE---------- 532

Query: 279 IGTILNNPQVQLALSHFAQRNPDAARKVQEISNNP-MFK 316
           + +IL +P +Q  LS  AQ+NP A   +QE   NP +FK
Sbjct: 533 VASILQDPVMQSILSQ-AQQNPAA---LQEHMRNPDVFK 567

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 18/127 (14%)

Query: 67  EPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL 126
           EPEP   + ++     +A   K EGNK  ++  + +AI+KY  A +         D  YL
Sbjct: 242 EPEPMEVDDDKS----KAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHN------DITYL 291

Query: 127 SNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
           +N++ A  + G YE A +     ++      +G    A+ K+    +    N+Y ++ DL
Sbjct: 292 NNRAAAEYEKGDYEAAIETLTKAVE------QGRELRADYKVISKSFARMGNSYHKLGDL 345

Query: 187 EGNKATD 193
           +  KA D
Sbjct: 346 K--KAID 350

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 64.7 bits (156), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 65/109 (59%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y  AI+ +T+AI++ K    P    Y SN+S       ++ +A 
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSK---TPNHVLY-SNRSACYASLKKFSDAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKA 191
           +DA  CI I+P++SKGY+RL  A +G    ++A N YK+ L+L+  NKA
Sbjct: 61  NDAKECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASNKA 109

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKK 116
           A +L    N E E K +E E  +  E+A + +LEG     + ++ +A+  YT   +++K+
Sbjct: 369 ADILTKLRNAEKELKKAEAEAYINPEKAEEARLEGKDYFTKSDWPNAVKAYT---EMIKR 425

Query: 117 NGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYED 175
              P D RGY SN++ AL K   + EA  D    I+ DP F + Y R A A+I   +Y  
Sbjct: 426 --APEDARGY-SNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEYAA 482

Query: 176 AM 177
           A+
Sbjct: 483 AL 484

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 67/109 (61%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y  AI+ +T+AI++   +  P    Y SN+S   T   ++ +A 
Sbjct: 5   ADEYKQQGNAAFTAKDYDKAIELFTKAIEV---SETPNHVLY-SNRSACYTSLKKFSDAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKA 191
           +DA  C+KI+P++SKGY+RL  A +G    ++A + YK+ L+L+  NKA
Sbjct: 61  NDANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASNKA 109

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 80/157 (50%), Gaps = 12/157 (7%)

Query: 57  ATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKK 116
           A +L    N E E K +E E  +  E+A + +LEG +   + ++ +A+  YT   +++K+
Sbjct: 369 ADILTKLRNAEKELKKAEAEAYVNPEKAEEARLEGKEYFTKSDWPNAVKAYT---EMIKR 425

Query: 117 NGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYED 175
              P D RGY SN++ AL K   + EA  D    I+ DP F + Y R A A+I   +Y  
Sbjct: 426 --APEDARGY-SNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRKATAQIAVKEYAS 482

Query: 176 AMNAY--KQVLDLEGNKATDTMKRD---FEITKQKFE 207
           A+      +  D E N  +   + D   ++ ++Q+F+
Sbjct: 483 ALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQ 519

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A K K EGNK  +   + +AI+ Y +A +L K      D  YL+N++ A  + G YE A
Sbjct: 261 EADKEKAEGNKFYKARQFDEAIEHYNKAWELHK------DITYLNNRAAAEYEKGEYETA 314

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
                    ++    +G    A+ K+    +    NAY ++ DL
Sbjct: 315 IS------TLNDAVEQGREMRADYKVISKSFARIGNAYHKLGDL 352

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 64/110 (58%), Gaps = 5/110 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y+ A + + +AID+ ++     +    SN+S   T   ++ E  
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQ----PNHVLYSNRSACYTSLKKFAEGL 59

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKAT 192
            DA  C+KI+P +SKGY+R+  A+ G N  EDA  +Y++ L+L+  NKA 
Sbjct: 60  KDAEECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSANKAA 109

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 69/133 (51%), Gaps = 12/133 (9%)

Query: 46  LQEEVSADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAID 105
           L E  SAD     VL    N E E K  E E  +  E+A + +LEG +   + ++ +A+ 
Sbjct: 349 LTEHRSAD-----VLNKLRNAEKELKKQEAEEYVDPEKAEEARLEGKEYFSKADWPNAVK 403

Query: 106 KYTRAIDLLKKNGLPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164
            YT   +++K++  P D RGY SN++ AL K   + EA  D    I+ DP F + Y R A
Sbjct: 404 AYT---EMIKRS--PQDARGY-SNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRKA 457

Query: 165 EAKIGQNKYEDAM 177
            A+I   ++  A+
Sbjct: 458 SAQIAVKEFAAAV 470

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 59/125 (47%), Gaps = 20/125 (16%)

Query: 65  NLEPEP-KLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDR 123
           N EPEP ++ EK  ++  E+    K EGNK  +   + +AI+ Y +A +L K      D 
Sbjct: 231 NNEPEPMEVDEKGPQVAAEEE---KAEGNKFYKARKFDEAIEHYNKAWELHK------DI 281

Query: 124 GYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAE--AKIGQNKYEDAMNAYK 181
            YL+N++ A  + G YE A       +         Y  +A+  A+IG        NAY 
Sbjct: 282 TYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIG--------NAYH 333

Query: 182 QVLDL 186
           ++ DL
Sbjct: 334 KLGDL 338

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y  AID +++AID+ ++     +    SN+S   T   ++  A 
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQ----PNHVLYSNRSACYTSLKKFVNAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKA 191
            DA  C+KI+P++SKGY+R+  A  G    ++A   YK+ L+L+  NKA
Sbjct: 61  KDAEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKA 109

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 10/146 (6%)

Query: 67  EPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYL 126
           E + K+ E E  +  E+A + +LEG     + ++ +A+  YT  I    ++     RGY 
Sbjct: 380 EKQVKIQEAEDYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDA----RGY- 434

Query: 127 SNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL-- 184
           SN++  L+K   + EA DD    I+ DP F + Y R A A+I   ++  A+         
Sbjct: 435 SNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALETLDAARSK 494

Query: 185 DLEGNKATDTMKRD---FEITKQKFE 207
           D E NK+ +T + D    + ++Q+F+
Sbjct: 495 DAEVNKSANTREIDQLYIKASQQRFQ 520

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 65/109 (59%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++++ AI+ +T+AI++ +K     +    SN+S   T + ++ +A 
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEK----PNHVLYSNRSACYTSTKQFNKAL 58

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKA 191
           +DA  C+ I+P +SKGY+R+  A  G    ++A   YK+ L+L+  NKA
Sbjct: 59  EDAKQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSANKA 107

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 59  VLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNG 118
           +L    N E E K  E E  +  E+A + +L+G +   + ++ +A+  YT  I    ++ 
Sbjct: 368 ILTKLRNCEKELKKQETEAYIDPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDA 427

Query: 119 LPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIG 169
               RGY SN++ AL+K   + EA  D    I  DP F + Y R A A+I 
Sbjct: 428 ----RGY-SNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRKATAQIA 473

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 88  KLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE------- 140
           K EGNK  +   + +AI+ Y++A +L K      D  YL+N++ A  + G YE       
Sbjct: 263 KAEGNKFYKARKFDEAIEHYSKAWELHK------DITYLNNRAAAEYEKGEYETAIKTLT 316

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
           EA +            SK ++R+  +    N+ + A+  Y++ L
Sbjct: 317 EAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 4/106 (3%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   + Y+ A+D +++AI++  +     +    SN+S   T   ++ +A 
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSPE----PNHVLYSNRSACYTSLKKFTDAL 60

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
           +DA  C KI+PT+SKGY+R+  A  G    ++A  +YK+ L+L+ +
Sbjct: 61  NDANECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDAS 106

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 63/129 (48%), Gaps = 9/129 (6%)

Query: 65  NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRG 124
           +LE + K+ E E  +  E+A + +++G     +  + DA+  YT  I        P D  
Sbjct: 373 SLEKKIKVQEAEAYINPEKAEEARIQGKDFFNKGQWPDAVKAYTEMI-----ARAPDDAR 427

Query: 125 YLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
             SN++ AL+K   + EA  D    ++ DP F K Y R A A+I   +Y  A+    + L
Sbjct: 428 AYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQIAIKEYSSAL----ETL 483

Query: 185 DLEGNKATD 193
           D+  +K T+
Sbjct: 484 DIARSKDTE 492

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 20/128 (15%)

Query: 67  EPEPKLSEKERELVNEQAIKLKL------EGNKAVERENYKDAIDKYTRAIDLLKKNGLP 120
           E EP  +  E   V++  ++ KL      EGNK  +   + +AI+ Y +A +L       
Sbjct: 235 EKEPVAANPENMEVDDADVQKKLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHN----- 289

Query: 121 VDRGYLSNKSLALTKSGRYEEACDDALACIK-IDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
            D  YL+NK+ A  + G YE         IK ++    KG    A+ KI    +    NA
Sbjct: 290 -DITYLNNKAAAQYEKGDYE-------TTIKTLEDAIEKGRELRADYKIIAKAFTRMGNA 341

Query: 180 YKQVLDLE 187
           Y+++ DL+
Sbjct: 342 YEKLNDLK 349

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 5/110 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++Y+ A + +T+AI+    +  P    Y SN+S   T   ++ EA 
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEA---SEAPNHVLY-SNRSACFTSLKKFNEAL 58

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKAT 192
           +DA  C+KI+P +SKGY+R+  A  G  K ++A   YK+ L+++  NKA 
Sbjct: 59  NDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSNKAA 108

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 108/257 (42%), Gaps = 59/257 (22%)

Query: 59  VLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNG 118
           +L    N E E K+ E +  +  E+A + +L+G +   + ++ +A+  YT   ++ K+  
Sbjct: 376 ILTKLRNCEKEQKVREAQAYIDPEKAEEARLQGKEYFTKGDWPNAVKAYT---EMTKR-- 430

Query: 119 LPVD-RGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
            P D RGY SN++ AL K   + EA  D    I  DP F + Y R A A+I   ++  A+
Sbjct: 431 APEDARGY-SNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAI 489

Query: 178 NAYKQVLDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEI 237
                   L+  +A DT              LN   ++       I  +  ++ P+D   
Sbjct: 490 ET------LDAARAKDT-------------ELNNGANVREIDQLYIKASQQRFQPQD--- 527

Query: 238 RTRSSLVKVDVPAEQTNTNEEHSTPNTNTPRFNIAQLIGNG-IGTILNNPQVQLALSHFA 296
                                   PN  TP    A+ + +  + +I+ +P +Q  LS  A
Sbjct: 528 ------------------------PN-ETPEQAYARALKDPEVASIMQDPVMQSILSQ-A 561

Query: 297 QRNPDAARKVQEISNNP 313
           Q+NP A   +QE   NP
Sbjct: 562 QQNPAA---LQEHMKNP 575

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 13/104 (12%)

Query: 88  KLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDAL 147
           K EGNK  +   + +AI+ Y +A DL K      D  YL+N+S A  + G YE+A     
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDLHK------DVTYLNNRSAAEYEKGDYEQAIKTLT 324

Query: 148 ACIKID-------PTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
             ++            SK ++R+  A +    ++ A+  Y++ L
Sbjct: 325 EAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 66/110 (60%), Gaps = 5/110 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K +GN A   ++++ A + +++AI+    +  P    Y SN+S   T   +++EA 
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIE---SSETPNHVLY-SNRSACYTSLKKFKEAL 58

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKAT 192
           +DA  C+KI+PT+SKGY+R+  A+ G    +DA   YK+ L+++  NKA 
Sbjct: 59  EDAEECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSNKAA 108

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 7/138 (5%)

Query: 59  VLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNG 118
           +L    N E E KL E +  +  E+A + +L+G +   + ++  A+  YT  I    ++ 
Sbjct: 376 ILTKLRNTEKELKLREAKSYIDPEKAEEARLQGKEFFTKGDWPSAVSAYTEMIKRAPEDA 435

Query: 119 LPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMN 178
               RGY SN++  L K   + +A  D    I  DP F + Y R A A+I   ++  AM 
Sbjct: 436 ----RGY-SNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRKASAQIAVREFAPAME 490

Query: 179 AY--KQVLDLEGNKATDT 194
                +  DLE NK  + 
Sbjct: 491 TLDAARAKDLEINKGANA 508

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 64/143 (44%), Gaps = 25/143 (17%)

Query: 49  EVSADSDLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYT 108
           ++SAD+D   V       EPEP+   K +      A   K EGNK  +   + +AI+ Y 
Sbjct: 244 DLSADADKMEVD------EPEPEQDSKAK------ADAEKAEGNKYYKARKFDEAIEHYN 291

Query: 109 RAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE-------EACDDALACIKIDPTFSKGYS 161
           +A DL +      D  YL+N+S A  + G YE       EA D            SK ++
Sbjct: 292 KAWDLHR------DVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFA 345

Query: 162 RLAEAKIGQNKYEDAMNAYKQVL 184
           R+  A +  +  + A+  Y++ L
Sbjct: 346 RIGNAYLKMDDLKKAIEFYQRSL 368

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K EGN A   ++++ AI+ + +AI++ ++   P    Y SN+S       ++ EA 
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQ---PNHVLY-SNRSACYASMRKFREAL 59

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE-GNKATDTMKRDFEIT 202
            DA  C++I P +SKG++RL  A  G    ++A  +YK+ L+L+  NKA        + T
Sbjct: 60  ADAQECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQAT 119

Query: 203 KQK 205
           +Q+
Sbjct: 120 QQQ 122

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 77/152 (50%), Gaps = 12/152 (7%)

Query: 65  NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVD-R 123
           +LE E K  E E  +  E+A + +L+G +     ++ +A+  YT   +++K+   P D R
Sbjct: 369 SLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYT---EMIKR--APEDAR 423

Query: 124 GYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQV 183
           GY SN++ AL K   + +A  D    I+ DP F + Y R A A+I   +Y  A+      
Sbjct: 424 GY-SNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTA 482

Query: 184 L--DLEGNKATDTMKRD---FEITKQKFETLN 210
              D E N  ++T + D    + T+Q+F+  N
Sbjct: 483 REKDAEVNNGSNTREIDQLYIKATQQRFQPAN 514

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 5/116 (4%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A+KLK EGN  ++++++  AID YT+AI L     +     Y SN++LA  K   ++ +
Sbjct: 11  EALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSI-----YFSNRALAHLKLDNFQSS 65

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRD 198
            +D    +K+DP  +K Y R   + IG  +++ A N  + VL  +   AT +   D
Sbjct: 66  LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDATASRALD 121

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           +QAI LK EGNK ++ + Y  A++ YT+AI+L     +     + SN++LA  K   ++ 
Sbjct: 11  QQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSI-----FFSNRALAQLKLDNFQS 65

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
             DD  + +++DP   K Y R   +++G   ++ A N    VL  + + AT
Sbjct: 66  CLDDCNSALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDAT 116

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A + K EGN A   +++K A++ +T AI   +++  P    Y SN+S A     +++EA 
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAI---QESEEPNHVLY-SNRSGAYASLKKFDEAL 59

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKA 191
            DA  C+KI   +SKG++RL  A  G    ++A  +YK+ L+L+  NKA
Sbjct: 60  SDATECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATNKA 108

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 112/259 (43%), Gaps = 68/259 (26%)

Query: 65  NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVD-R 123
           NLE E K  E E  +  E+A K +L+G +   + ++  A+  Y+  I        P D R
Sbjct: 373 NLEREIKKREAEAYIDPEKAEKARLDGKEYFTKGDWPSAVKAYSEMI-----MRAPHDAR 427

Query: 124 GYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQV 183
           GY SN++ AL+K   + +A  D    I+IDP+F + Y R A A+I   +Y  A+      
Sbjct: 428 GY-SNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRKATAQIAVQEYSAAI------ 480

Query: 184 LDLEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSL 243
                                  ETL+ +                    KD E+   SS+
Sbjct: 481 -----------------------ETLDVART------------------KDAEVNNGSSI 499

Query: 244 VKVD---VPAEQTNTNEEHSTPNTN-TPRFNIAQLIGNG-IGTILNNPQVQLALSHFAQR 298
            ++D   V A    T +     NTN +P    A+ + +  + +IL +P +Q  L+  AQ+
Sbjct: 500 REIDQLYVKA----TQQRFQPANTNESPEETYARAVKDPEVASILQDPVMQSILAQ-AQQ 554

Query: 299 NPDAARKVQEISNNP-MFK 316
           NP A   +QE   NP +FK
Sbjct: 555 NPAA---LQEHMKNPEVFK 570

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 17/124 (13%)

Query: 68  PEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLS 127
           PEP     E +L  E A K K EGN+  ++  + +AI KY  A +L K      D  YL+
Sbjct: 246 PEPM----EVDLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQK------DITYLN 295

Query: 128 NKSLALTKSGRY-------EEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY 180
           N++ A  + G Y        EA +            +K ++RL  A    ++ + A+  Y
Sbjct: 296 NRAAAEYEKGDYNSAIKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYY 355

Query: 181 KQVL 184
           ++ L
Sbjct: 356 EKSL 359

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           EQA+  K EGN  ++ +NY  AI+ Y++AI+L      P    + SN++LA  K   ++ 
Sbjct: 10  EQAVAFKNEGNTYIKEQNYMKAIELYSQAIEL-----DPTQSIFFSNRALAQLKLDNFQS 64

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
             +D    +++DP   K Y R   + +G  + + A N  + VL  +   AT
Sbjct: 65  CMNDCDVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 9/112 (8%)

Query: 69  EPKLSEKER---ELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           +P LS+K+    E V++ A+ LK +GN+  + ++++ AI+ YT AI L +      D  +
Sbjct: 86  QPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKE------DPVF 139

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
            SN+S A      +E+  +D  A +K+ P +SK + R A A     ++ DAM
Sbjct: 140 YSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           E A+K K EGN  ++ ++Y+ AI+ YT+AI+L   + +     + SN++LA  K   ++ 
Sbjct: 10  EAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSI-----FYSNRALAHLKLDNFQS 64

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEI 201
           A  D    IK+D    K Y R   A +G  ++  A N    +L  + N A  T KR  E+
Sbjct: 65  ALHDCNDAIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDA--TAKRGLEM 122

Query: 202 TK 203
            +
Sbjct: 123 CE 124

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K +GNK V  ++Y  AI+ YT+AI+L     +     + SN++LA  K  R++ A
Sbjct: 8   EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSI-----FFSNRALANLKLDRFQSA 62

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
            +D+   I++D +  KGY R   A  G   +  A    + VL ++  +AT
Sbjct: 63  LEDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVKPGEAT 112

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 51/100 (51%), Gaps = 4/100 (4%)

Query: 87  LKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDA 146
           LK  GNK  + + Y+ A+  +T A+     N   +     SN++ A      Y EA +D 
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHIL----YSNRAAAHIGLKHYAEALEDG 66

Query: 147 LACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
             C+++ P + KGYSR+  A +G  K ++A   +K+ L L
Sbjct: 67  KNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQL 106

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 67/156 (42%), Gaps = 29/156 (18%)

Query: 70  PKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNK 129
           P+ +EK+R    E+ I     GN   ++ N+K+AI  YT+A +  +      D  YL+N 
Sbjct: 286 PEETEKKRRADEEKRI-----GNDLYKKRNFKEAIIHYTKAWNTFQ------DITYLNNI 334

Query: 130 SLALTKSGRYEEACDDALACI----KIDP---TFSKGYSRLAEAKIGQNKYEDAMNAYKQ 182
             A  + G Y          +      +P     +K Y R+  A      +E A+ AY+ 
Sbjct: 335 GAAQFERGDYGNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEY 394

Query: 183 VLDLEGN----KATDTMKRDFEITK-------QKFE 207
            L L GN    K   +++ +FE  K       QKFE
Sbjct: 395 GLMLNGNEEHKKKLASLRVEFEKVKKGEFIDLQKFE 430

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 55/121 (45%), Gaps = 9/121 (7%)

Query: 61  LANLNLEPEPKLSEKERELVNEQAIK-LKLEGNKAVERENYKDAIDKYTRAIDLLKKNGL 119
           LA+L +E E     K+ E ++ Q  +  ++EG +      Y  A+  YT   +++K N  
Sbjct: 408 LASLRVEFE---KVKKGEFIDLQKFEEARIEGKQHFLNREYFKAMKCYT---EMIKTN-- 459

Query: 120 PVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
           P       N++    K     +  DD    I +DP++ K Y R   A+I +   ++A+  
Sbjct: 460 PTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYVRKGFAQITERDLDEALET 519

Query: 180 Y 180
           +
Sbjct: 520 W 520

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K  GN A++ ++Y  AI+ YT AI L     +     Y SN+++   K   ++  
Sbjct: 11  KALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSI-----YFSNRAMGHLKMDNFQSG 65

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEIT 202
            +D    ++IDP   K Y R   + IG  ++++A    K VL  + N A  T KR  ++ 
Sbjct: 66  INDCDKALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDA--TAKRGLDVC 123

Query: 203 KQ 204
           ++
Sbjct: 124 EK 125

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 13/141 (9%)

Query: 72  LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSL 131
           +S    E VN +A++ K +GN  ++ +N+  A + Y++AI+L     +     Y SN++ 
Sbjct: 1   MSSASDEDVN-KALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSI-----YFSNRAF 54

Query: 132 ALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN-- 189
           A  K   ++ A +D    I++DP   K Y R   + IG  ++  A    K VL  + N  
Sbjct: 55  AHLKLDNFQTALNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIVLRAKPNEP 114

Query: 190 ---KATDTMKRDFEITKQKFE 207
              +A D  +R   I K+KFE
Sbjct: 115 VATRALDVCER--VIRKEKFE 133

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 5/110 (4%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K EGN  ++ +NY  AI+ YT+AI+L      P    + SN++LA  K   ++ A
Sbjct: 11  KAVEFKNEGNVFIKEQNYSKAIELYTKAIEL-----DPNQSIFYSNRALAQLKLDNFQSA 65

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
            +D    + +D    K Y R   A +G  +++ A N    VL  + + AT
Sbjct: 66  YNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDAT 115

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K EGN  V+ +++  AI+KYT AIDL     +     Y SN++ A  K   ++ A
Sbjct: 11  KALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSI-----YFSNRAFAHFKVDNFQSA 65

Query: 143 CDDALACIKIDPTFSKGYSRLA 164
            +D    IK+DP   K Y R A
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRA 87

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K EGN  V+ +++  AI+KYT AIDL     +     Y SN++ A  K   ++ A
Sbjct: 11  KALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSI-----YFSNRAFAHFKVDNFQSA 65

Query: 143 CDDALACIKIDPTFSKGYSRLA 164
            +D    IK+DP   K Y R A
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRA 87

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 73/152 (48%), Gaps = 7/152 (4%)

Query: 72  LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSL 131
           ++E+ +    E+A++LK EGNK V+ + Y  A + YT+AI+   +N +       SN++ 
Sbjct: 1   MTEEVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTI-----LYSNRAF 55

Query: 132 ALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKA 191
              K   ++ + DDA   I++D    K Y R A + IG  ++  A      VL  + N+ 
Sbjct: 56  TNLKLDNFQSSLDDAKRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIVLKFKPNEL 115

Query: 192 TDTMKRDFEITKQKFETLNFSTHIDSGSATPI 223
             T K    I  +  +  NF   I  G ++ +
Sbjct: 116 --TAKNALAICDKVIQKENFEKAISGGDSSKV 145

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 11/113 (9%)

Query: 69  EPKLSEKERELVNEQ----AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRG 124
           EPKL + + +L +EQ    A+ LK +GN+  + + + DAI  Y  A++L K    PV   
Sbjct: 84  EPKLDDID-QLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKD---PV--- 136

Query: 125 YLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           + SN+S      G+ E+  +D  A +K+   +SK   R A A      Y DAM
Sbjct: 137 FYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAM 189

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 45/81 (55%), Gaps = 5/81 (6%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A++ K EGN  ++ +++  AI+KYT+AIDL     +     Y SN++ A  K   ++ A 
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSI-----YFSNRAFAHFKVDNFQSAL 66

Query: 144 DDALACIKIDPTFSKGYSRLA 164
           +D    +K+DP   K Y R A
Sbjct: 67  NDCDEALKLDPKNIKAYHRRA 87

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 13/142 (9%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           ++A++ K EGN  V+ ++Y  AI+KY +AI+L     +     Y SN++L   K   ++ 
Sbjct: 7   DKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSV-----YFSNRALCHLKLDNFQC 61

Query: 142 A---CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRD 198
           A   CD ALA   +DP   K Y R   A +G  +++ A      VL  + + A    KR 
Sbjct: 62  ASQDCDKALA---LDPKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDA--AAKRA 116

Query: 199 FEITKQKFETLNFSTHIDSGSA 220
            +I ++      F   I  G +
Sbjct: 117 LDICEKVIREERFRKAIGGGDS 138

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (50%), Gaps = 11/118 (9%)

Query: 64  LNLEPEPKLSEKERELVNEQ----AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGL 119
           +N + EP LS    EL +EQ    A+ LK +GN+  + + Y +AI  Y+ AI++ +    
Sbjct: 72  VNEKGEPDLSNL-AELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKE---- 126

Query: 120 PVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
             D  + SN+S      G+ E+  +D  A +K+ P +SK   R A A      + DAM
Sbjct: 127 --DPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM 182

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A + K EGN  V+ +++  AI+KYT AIDL     +     Y SN++L+  K   ++ A
Sbjct: 11  KAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTI-----YFSNRALSHFKVDNFQSA 65

Query: 143 CDDALACIKIDPTFSKGYSRLA 164
            +D    IK+DP   K Y R A
Sbjct: 66  LNDCDEAIKLDPKNIKAYHRRA 87

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A+  K +GN+ +++ +Y  AI+ Y++AI L     +     Y SN++LA  K   +  A 
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSI-----YFSNRALAHLKQDNFYSAV 66

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
            D    +K+DP   K Y R   + +G  ++  A N    VL  + N  T
Sbjct: 67  VDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDIT 115

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 69  EPKLSEKE---RELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EP LS+ +    E  NE A+ LK +GN+  +   ++DAI  Y  A+ L        D  Y
Sbjct: 92  EPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKD------DPIY 145

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
            SN S       +YE+  + A   +K+ PTFSK   R A A      + DAM
Sbjct: 146 YSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAM 197

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 6/107 (5%)

Query: 71  KLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKS 130
           K+ E   E  ++ A+ LK +GN+  + + ++DA+  Y+ AI++ +    PV   + SN+S
Sbjct: 83  KVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKED---PV---FYSNRS 136

Query: 131 LALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
                 G+ E+  +D  A +K+ P +SK   R A A     K+ DAM
Sbjct: 137 ACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAM 183

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 7/132 (5%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A+  K EGN+ V+ ++Y  A++ YTRAI+      +     + SN++LA  K  R++ A 
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSI-----FFSNRALANLKLDRFQSAL 92

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITK 203
           +D+   I++D    K Y R   A  G  ++  A    + V  +      + ++R  E+ +
Sbjct: 93  EDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEVV--VRAKPGDEAVRRALEVCE 150

Query: 204 QKFETLNFSTHI 215
           +      F   I
Sbjct: 151 RMLRRERFERAI 162

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 5/108 (4%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           E A   K EGNK +++++++ A + YT+AI+       P    + SN++LA  K   +  
Sbjct: 7   ELATSYKDEGNKFLKQQDFQRANELYTKAIETD-----PTQSIFYSNRALANLKLDNFMN 61

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGN 189
           A +D    I+++ +  K Y R   A IG   ++ A N +  VL  + N
Sbjct: 62  ALNDCTNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPN 109

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 62/139 (44%), Gaps = 8/139 (5%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           E A++LK +GN     +N+ DAI  Y  AI+L      P D  + SN S     +G   +
Sbjct: 123 EYAVQLKDKGNHFFTSKNFDDAIKYYQHAIEL-----DPNDPVFYSNMSACYISTGDLNK 177

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE- 200
             +     ++I P  SK   R A A      + DAM     VL L G+    +++   E 
Sbjct: 178 VVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGDFDGASIEPMLER 236

Query: 201 -ITKQKFETLNFSTHIDSG 218
            + KQ  + LN +   +SG
Sbjct: 237 NLNKQAMKVLNANLSKNSG 255

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 9/129 (6%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           +++LK +GNK  + ++Y +AI  Y  A+DL K      D  + SN S      G+ ++  
Sbjct: 122 SMQLKDKGNKYFKAKDYTNAIKYYNLALDLNK------DPIFYSNISACYVSLGQLDKVI 175

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201
           + +   ++++P +SK   R A A      Y DA+     VL L G+ +  +++   E  +
Sbjct: 176 ESSTKALELNPNYSKALLRRASANESLENYSDALFDL-SVLSLNGDYSGASIEPILERNL 234

Query: 202 TKQKFETLN 210
            KQ  + LN
Sbjct: 235 NKQAIKVLN 243

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 2/125 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN     + YKDA + Y R ID+ K +   V+    SN++    +   Y 
Sbjct: 75  HEVAENFKNQGNDLYRAKRYKDAREIYNRGIDI-KCDDSKVNESLFSNRAACELELKNYR 133

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG-NKATDTMKRDF 199
              +D    ++ +    K Y R+A+A +  NK EDA  A +  L L+  N+A + ++++ 
Sbjct: 134 RCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAEFGLKLDPENQALNALRQNV 193

Query: 200 EITKQ 204
           +  KQ
Sbjct: 194 DKKKQ 198

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 71/161 (44%), Gaps = 15/161 (9%)

Query: 69  EPKLSEKERELVNEQ---AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EP  S K      E+   A+ LK +GN+    + Y DAI  Y  A++L +      D  +
Sbjct: 81  EPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKE------DPVF 134

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
            SN S      G  ++  + +   +++ P +SK   R A A  G  K+ DAM     VL 
Sbjct: 135 YSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDL-SVLS 193

Query: 186 LEG--NKATDTMKRDFEITKQKFETL--NFSTHIDSGSATP 222
           L G  N A+     +  + KQ    L   F   ID+ +ATP
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSKLKEKFG-DIDTATATP 233

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 17/173 (9%)

Query: 69  EPKLSEKERELVNEQ---AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EP  S+K      E+   A+ LK +GN+    + Y DAI  Y  A++L +      D  +
Sbjct: 81  EPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE------DPVF 134

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
            SN S      G  ++  + +   ++I P +SK   R A A  G   + DAM     VL 
Sbjct: 135 YSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDL-SVLS 193

Query: 186 LEG--NKATDTMKRDFEITKQKFETL--NFSTHIDSGSATPISEAANKYPPKD 234
           L G  N A+     +  + KQ    L   F   +D+ +ATP   +    PPK+
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFG-DVDAATATPTELSTQ--PPKE 243

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 43/73 (58%), Gaps = 9/73 (12%)

Query: 86  KLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA--- 142
           +LK +GN + +  +Y +AI  Y R I +   N  P+  GY SNK++AL K+ R++EA   
Sbjct: 5   ELKAKGNISFKNGSYSEAISWYNRCISIDPSN--PI--GY-SNKAMALLKADRFDEAITT 59

Query: 143 CDDALACI-KIDP 154
           C+  L  I K DP
Sbjct: 60  CEKGLQLISKEDP 72

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
           K+G Y EA      CI IDP+   GYS  A A +  +++++A+   ++ L L
Sbjct: 15  KNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 60/114 (52%), Gaps = 11/114 (9%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRY-- 139
           +QA++ K +GN  V+ + Y++A++ Y++AI+L     +     Y SN++ +  +   +  
Sbjct: 8   QQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSI-----YFSNRAFSRLRLDNFLT 62

Query: 140 -EEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
            +E CD A+A   +DP   K   R   + +G  ++  A    + VL ++ N+ +
Sbjct: 63  AQEDCDKAIA---LDPKNIKAIHRRGLSYVGLLEFFKARKDLRVVLQVKPNEQS 113

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 6/94 (6%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A+ LK +GN+  + + Y++AI  Y  A+ L +      D  + SN+S       + E+  
Sbjct: 95  AMALKDKGNECFKDQRYEEAIKFYDCALKLKE------DPVFYSNRSACYVPLNKLEKVV 148

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           +D  A +K+ P +SK   R A A      Y DAM
Sbjct: 149 EDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 79/180 (43%), Gaps = 17/180 (9%)

Query: 69  EPKLSEKERELVNEQ---AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EP  S+K      E+   A+ LK +GN+    + Y DAI  Y  A++L +      D  +
Sbjct: 81  EPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKE------DPVF 134

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
            SN S      G  ++  + +   +++ P +SK   R A A  G   + DAM     VL 
Sbjct: 135 YSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLS 193

Query: 186 LEG--NKATDTMKRDFEITKQKFETL--NFSTHIDSGSATPISEAANKYPPKDEEIRTRS 241
           L G  N A+     +  + KQ    L   F   ID+ +ATP   +    PPK+ + +  S
Sbjct: 194 LNGDFNDASIEPMLERNLNKQAMSRLKEKFG-DIDAATATPTELSTQ--PPKERKDKQES 250

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 82  EQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE 141
           ++A++ K +GN  ++ + Y +A++ Y++AI+L     +     + SN++ +  K   +  
Sbjct: 10  QKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSI-----FFSNRAFSRLKLDNFLT 64

Query: 142 ACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKAT 192
           A +D    I++DP   K   R   + +G  ++  A    K +L ++ N+ +
Sbjct: 65  ALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQS 115

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (57%), Gaps = 8/64 (12%)

Query: 87  LKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA---C 143
            K EGN+  +  NY  AI  Y + I++  +N  P+  GY SNK++AL K+ + +EA   C
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPEN--PI--GY-SNKAMALIKANKNQEAVRTC 60

Query: 144 DDAL 147
            D L
Sbjct: 61  QDGL 64

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD-LEGNKAT- 192
           K G Y  A      CI+I+P    GYS  A A I  NK ++A+   +  L  +  N AT 
Sbjct: 15  KEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLKRVSKNDATH 74

Query: 193 DTMKRDFE 200
           +T+++  E
Sbjct: 75  ETIQKKLE 82

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 1/111 (0%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+  + + YKDA + Y + I++ K +   ++    SN++    +   Y 
Sbjct: 75  HEVAENFKNQGNELYKVKRYKDAREIYNKGIEI-KCDSNKINESLFSNRAACELELKNYR 133

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKA 191
              +D    ++ +PT  K + R+A A    +K EDA  A +  L L+   A
Sbjct: 134 RCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           ++ +K +GN+  + + Y++AI  Y+ A+ L K    PV   + SN+S       + E+  
Sbjct: 98  SMAMKDKGNECFKEKKYEEAIKYYSCALRLKKD---PV---FYSNRSACWVPLNKLEKVV 151

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           +D  A +++ P +SK   R A A      + DAM
Sbjct: 152 EDTTAALELKPDYSKCLLRRATANESLGNFADAM 185

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 74/162 (45%), Gaps = 15/162 (9%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A  LK +GN   + + ++DAI+ Y  AI L +      D  + SN S      G  ++  
Sbjct: 93  ATALKDKGNALFKEKRFEDAIEFYNHAIKLHE------DPVFHSNISACYVSLGDLDKVV 146

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201
           + +   +++ P +SK   R A A     +Y+DAM     VL L G+    +++   E  +
Sbjct: 147 ESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDI-SVLSLNGDFNGSSIEPMLERNL 205

Query: 202 TKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSL 243
            KQ    L     ID  ++ P +E     P + +E+ + +SL
Sbjct: 206 NKQALRVLKEDMGID--ASVPQAEQ----PRERQELPSNTSL 241

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 11/119 (9%)

Query: 86  KLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA--- 142
           + K EGN+  +  +YK A + Y + +D+  +N  P+  GY SNK++AL K GRY E    
Sbjct: 5   QYKEEGNRNFKEGSYKVAAELYQKCVDIEPEN--PI--GY-SNKAMALIKLGRYTEVVEL 59

Query: 143 CDDALACI--KIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDF 199
           C   L       D  + K   RL  A        D   + + ++++E N+  D +  +F
Sbjct: 60  CRKGLTFTPNTTDTVYKKLNYRLEMALKNMKHVNDQEQSNEHLINIEINEV-DRLPEEF 117

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 54/102 (52%), Gaps = 5/102 (4%)

Query: 83  QAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           +A++ K +GN  V+++++  A + YT+AI+L     +     + SN++LA  K   ++ +
Sbjct: 11  KALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSI-----FFSNRALAHLKQDNFQLS 65

Query: 143 CDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
            +D    +++D    K Y R   + +G  +++ A    K VL
Sbjct: 66  LNDCDKALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVL 107

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A++LK +GN     +++ DAI  Y  AI+L      P D  + SN S     +G  ++  
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIEL-----DPNDPVFYSNISACYISTGDLDKVV 185

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFE--I 201
           +     ++I P  SK   R A A      + DAM     VL L G+    +++   E  +
Sbjct: 186 EYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGDFDGTSIEPMLERNL 244

Query: 202 TKQKFETLN 210
            KQ  + LN
Sbjct: 245 NKQAMKVLN 253

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 69  EPKLSEKER---ELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EP LS K+    EL  + A+ LK +GN   +++++++A+  Y  A+ L +      D  +
Sbjct: 87  EPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALTLKQ------DPVF 140

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
            SN S      G+ E+  + +   +K+   +SK   R A A      Y DAM
Sbjct: 141 YSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAM 192

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 14/129 (10%)

Query: 65  NLEPEPK----LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLP 120
           N EP+ K     +E+++E     ++ LK +GN+  + + Y+DA+  Y  A+DL +     
Sbjct: 79  NGEPDLKDSANFTEEQKETY---SVALKDKGNQFFKEQKYEDALKYYNYALDLKQ----- 130

Query: 121 VDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAY 180
            D  + SN S      G  E+  + +   +++ P +SK   R A A      + +AM   
Sbjct: 131 -DPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDL 189

Query: 181 KQVLDLEGN 189
             VL L G+
Sbjct: 190 -SVLSLNGD 197

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 8/73 (10%)

Query: 78  ELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSG 137
           E +NE A  LK++GN   +  +Y+ AI  Y +A  L   N  P+   Y SN + AL K  
Sbjct: 35  ESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSN--PI---YFSNMATALIKLE 89

Query: 138 RYEE---ACDDAL 147
           R++E   ACD  L
Sbjct: 90  RWQEAVNACDKGL 102

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 72  LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSL 131
           + E  +EL    A  LK  GN+  ++++Y +A+  Y  A+ ++KK+  PV   + SN S 
Sbjct: 89  IEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL-VVKKD--PV---FYSNISA 142

Query: 132 ALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
                G+ ++  +++   +++ P +SK   R A A      Y DAM
Sbjct: 143 CYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAM 188

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 64/143 (44%), Gaps = 12/143 (8%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEAC 143
           A+ LK +GN+    + Y DAI  Y  A++L      PV   + SN S      G  ++  
Sbjct: 99  ALALKDKGNQFFRNKKYDDAIKYYNWALELKDD---PV---FYSNLSACYVSVGDLKKVV 152

Query: 144 DDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG--NKATDTMKRDFEI 201
           + +   +++ P +SK   R A A  G   + DAM     VL L G  N A+     +  +
Sbjct: 153 EMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDL-SVLSLNGDFNDASIEPMLERNL 211

Query: 202 TKQKFETL--NFSTHIDSGSATP 222
            KQ    L   F   ID+ +ATP
Sbjct: 212 NKQAMSKLKEKFG-DIDTATATP 233

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 65/125 (52%), Gaps = 10/125 (8%)

Query: 65  NLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRG 124
           NL+ + + +E+E+E   + +I LK +GN   + + +++AI  Y  AI+L K+N  P+   
Sbjct: 95  NLDNKDQFTEEEKE---KYSIALKDKGNSLFKADKFEEAIKYYNWAIEL-KEN--PIFYS 148

Query: 125 YLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
            LS   ++L K     + C+ AL   ++ P +SK   R A A      Y DAM     VL
Sbjct: 149 NLSACYVSLNKLEEIIKYCNKAL---ELKPDYSKVLLRRANANEKLENYADAMFDL-SVL 204

Query: 185 DLEGN 189
            L G+
Sbjct: 205 SLNGD 209

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 9/106 (8%)

Query: 72  LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSL 131
           L++K +E   E A  LK +GN   +++++++AI  YT A+ L +      D  Y SN S 
Sbjct: 86  LNDKTKE---EWAGALKEKGNALFKKKDFENAIKYYTFALSLKE------DPVYYSNISA 136

Query: 132 ALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
             +    YE+  + A   + + P +SK   R A A      + DAM
Sbjct: 137 CYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAM 182

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN   + + ++DA + Y +AID+ K +   ++    +N++    +   Y 
Sbjct: 71  HEIAGNFKNQGNDLYKVKRFRDARELYNKAIDV-KCDDDKINESLYANRAACELELKNYR 129

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
              +D    + ++P   K Y R+A+A +   K++D   A
Sbjct: 130 RCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDCKEA 168

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 5/56 (8%)

Query: 87  LKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
            K++GN A ++ N+ DA++ Y +AI     N  PV  GY SN ++AL K   Y +A
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTN--PV--GY-SNCAMALIKLNNYADA 57

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+  + + +KDA + Y + +++  ++   ++    +NK+    +   Y 
Sbjct: 80  HEIAGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKF-INESLFANKAACELELKNYR 138

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
              +D    + I+P  +K Y R ++A    NK E+A +A
Sbjct: 139 RCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEAKSA 177

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 6/97 (6%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           ++ AI+LK +GN+  + ++Y++A+  Y  A+ +LKK+  PV   + SN S         +
Sbjct: 105 DKWAIELKDKGNEYFKEKDYENALKFYDFAL-ILKKD--PV---FYSNMSACYVSLNELD 158

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           +  + +   +++ P +SK   R A A      Y DAM
Sbjct: 159 KVIEMSTKALELKPDYSKALLRRATANEQLENYSDAM 195

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 80/180 (44%), Gaps = 28/180 (15%)

Query: 69  EPKL---SEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125
           EPKL   +E   E     +  LK +GN+  ++++Y +A+  Y  A+ L K    PV   +
Sbjct: 88  EPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKD---PV---F 141

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
            SN S       + ++  +++   +++ P +SK   R A A      Y DAM     VL 
Sbjct: 142 YSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDL-SVLS 200

Query: 186 LEG---------------NKATDTMKRDFEITKQKFETLNFSTHIDS--GSATPISEAAN 228
           L G               NK   T+ +D ++ +QK + L   T + S  G  TP +E AN
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKD-KLGQQKNQLLPSDTALASFFGIFTPETEFAN 259

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 43/96 (44%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN   + + +KDA D Y + I +     + +     +NK+    +   + 
Sbjct: 73  HEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFR 132

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
              +D    ++++P   K Y R+  A    +K E+A
Sbjct: 133 RCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 33.5 bits (75), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 86  KLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE---A 142
           +LK +GN   ++++Y  A+  Y + ++    N  P+     SN+++ L K  R +E   A
Sbjct: 6   RLKAQGNSCYQQQDYAGALRWYDQCLEADATN--PIAH---SNRAMCLIKLNRSQEAQKA 60

Query: 143 CDDALACIKIDP 154
           C   LA ++  P
Sbjct: 61  CQAGLALLRTSP 72

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 86  KLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE---EA 142
           K K +GN   ++  Y +A+D Y R I    +N  PV  GY SNK++AL K G +    +A
Sbjct: 10  KDKQQGNALFKQGLYLEAVDSYDRLIAAQPQN--PV--GY-SNKAMALIKLGEHAQAIQA 64

Query: 143 CDDAL 147
           C   L
Sbjct: 65  CQQGL 69

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 7/92 (7%)

Query: 132 ALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKA 191
           AL K G Y EA D     I   P    GYS  A A I   ++  A+ A +Q L      A
Sbjct: 17  ALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGL----QHA 72

Query: 192 TDTMKRDFEITKQKFETLNFSTHIDSGSATPI 223
           + T   D    + K   L +   +   +A P+
Sbjct: 73  STTTTPDHVTIRAK---LQYRLELSQAAAAPV 101

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 46/231 (19%), Positives = 93/231 (40%), Gaps = 33/231 (14%)

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
           L N++ +  K G+ ++A  DA   I+++P   K Y R  +     NK ++A + Y Q L 
Sbjct: 74  LDNRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNYSQGL- 132

Query: 186 LEGNKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSLVK 245
                         ++ K+ ++T         G + P  +  N    + + I+ R    +
Sbjct: 133 --------------KMAKEGYQTY--------GISVP-QKFINIIQTQKQSIKKRHGREQ 169

Query: 246 VDVPAEQTNTNEEHSTPNTNTPRF-----NIAQLIGNGIGTILNNPQVQLALSHFAQRNP 300
           ++ P  + +    +  P  ++P        + + +G    ++L    V L LSH   +  
Sbjct: 170 IEKP--EISLKRRYIEPAVDSPVMVKTMKKVTKHMGLDFISMLPQELVALVLSHLDAKQI 227

Query: 301 DAARKVQEISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFIPGAL 351
            +   V +  +N ++  +L QL    +     + K  KF+  VN+     L
Sbjct: 228 ISCSMVSKSWHNRIY--SLPQLFRDIDLDSSTYRKVSKFQTFVNTLCHSYL 276

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
           L N++    K G  E+A  DA     I+P   K + R  +     +K +DA N YK  L 
Sbjct: 97  LDNRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR 156

Query: 186 LEGNKATDTMK 196
              N ATD++K
Sbjct: 157 -NANFATDSLK 166

>ZYRO0C02970g Chr3 (230414..233104) [2691 bp, 896 aa] {ON} similar
           to uniprot|P42842 Saccharomyces cerevisiae YNL313C
           Protein required for cell viability
          Length = 896

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNK 190
           +SG+ E A +    C+ +DPT    +S L+ A +  +K ++A +  KQ +  +  K
Sbjct: 643 ESGKMELAAEAFSRCVSLDPTHGAAWSNLSAAYVELDKLKEAFSCLKQAVSTDARK 698

>Ecym_5187 Chr5 complement(393102..394199) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACR245C
          Length = 365

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 239 TRSSL---VKVDVPAEQTNTNEEHSTPNTNTP--RFNIAQLIGNGIGTILNNPQVQLAL 292
            RSSL   +  DVP     T   +ST N N P  ++ + Q +G+ + TI+N+P+  ++L
Sbjct: 280 VRSSLKNRLSEDVPQSGNETIGNYSTTNPNIPIFQYQLMQCMGDLLTTIVNDPKATISL 338

>TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}
           Anc_3.32 YNL313C
          Length = 903

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 30/50 (60%)

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVL 184
           + G++E A +    C+ +D T +  +S L+ A + QNK ++A++  K+ +
Sbjct: 647 ECGKFELAAEAFSRCVALDSTHAMAWSNLSAAFVEQNKLKEALSCLKRAV 696

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 5/126 (3%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN   + + ++DA + Y++ ID +K     ++    +N++    +   Y 
Sbjct: 78  HEIAENFKKQGNDLYKVKRFRDARELYSKGID-VKCQVNTINESLYANRAACELEIKNYR 136

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA--YKQVLDLEGNKATDTMKRD 198
              +D    ++++P   K Y R+A+A     + ++A+ +  + + +D   NK+  T+K  
Sbjct: 137 RCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALESIEFGEKID-NTNKSLKTLKLH 195

Query: 199 FEITKQ 204
            E TKQ
Sbjct: 196 IE-TKQ 200

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 31.6 bits (70), Expect = 0.98,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 88  KLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE---EACD 144
           K EGN+  ++  Y+DAI  Y R I    +N  PV     SNK++AL K G +    EAC 
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQN--PVGH---SNKAMALIKLGEHAQAIEACQ 62

Query: 145 DAL 147
             L
Sbjct: 63  QGL 65

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 31.6 bits (70), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 19/77 (24%)

Query: 74  EKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLAL 133
           EKE+EL           GN   ++  Y++A+D Y + I    +N  PV  GY SNK++AL
Sbjct: 9   EKEKEL-----------GNALFKQGLYREAVDSYDQLITAQPQN--PV--GY-SNKAMAL 52

Query: 134 TKSGRYEEA---CDDAL 147
            K   Y  A   C + L
Sbjct: 53  IKLAEYTHAIQTCQEGL 69

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N +     +  +  +   +  +Y +A D     I+++P  
Sbjct: 309 RTDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 363

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 364 SEVWYDLGTLYETCNNQLSDALDAYKQAARLDVN 397

>KNAG0L01630 Chr12 (289600..292020) [2421 bp, 806 aa] {ON} Anc_7.258
           YIL068C
          Length = 806

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 172 KYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207
           ++ DA+N +      +GNK  D+MKRDFE+    FE
Sbjct: 664 RFVDALN-FGHSFKTKGNKFLDSMKRDFEVFYSTFE 698

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N +     +  +  +   +  +Y +A D     I+++P  
Sbjct: 313 RTDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 367

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 368 SEVWYDLGTLYETCNNQLSDALDAYKQAARLDVN 401

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N +     +  +  +   +  +Y +A D     I+++P  
Sbjct: 311 RTDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 365

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 366 SEVWYDLGTLYETCNNQLSDALDAYKQAARLDVN 399

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N +     +  +  +   +  +Y +A D     I+++P  
Sbjct: 303 RTDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 357

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 358 SEVWYDLGTLYETCNNQLSDALDAYKQAARLDVN 391

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+  + + +KDA + YT+ I +  ++   ++    +N++    +   Y 
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGIAVECEDK-SINESLFANRAACELELKNYR 138

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
              +D    + I+P   K Y R ++A    +K E+A +A
Sbjct: 139 RCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEAKSA 177

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 61/130 (46%), Gaps = 10/130 (7%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN   + + +KDA   Y +A+D +K + L ++     N +    +   Y 
Sbjct: 67  HEIATNFKNQGNDLYKGKRFKDARAMYLKALD-VKCDVLSINESLYLNLAACELEIKNYR 125

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLE---------GNKA 191
              +     +K++    K + R+ +A +   ++ED++ A +  L ++          +KA
Sbjct: 126 SCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKA 185

Query: 192 TDTMKRDFEI 201
           T+ +KR  E+
Sbjct: 186 TEKLKRKKEL 195

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 63/128 (49%), Gaps = 19/128 (14%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVD--------------RGYLSNK 129
           A+ +K  G + ++R+++++A  KY ++++ + +    VD              + YL N 
Sbjct: 231 AVLIKESGTQLLKRKDFQNAFFKYRKSLNYVNEYIPDVDIDAEQFEKFNVLKQKLYL-NM 289

Query: 130 SLALTKSGRYEEACDDALACIKID--PT--FSKGYSRLAEAKIGQNKYEDAMNAYKQVLD 185
           +LAL   G Y+ A       +++D  P+   +K Y R     + +N  E+A++ YK+  +
Sbjct: 290 TLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYKRCKE 349

Query: 186 LEGNKATD 193
              ++A D
Sbjct: 350 HNSDEAVD 357

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N       +  +  +   +  +Y +A D     I+++P  
Sbjct: 371 RNDYTSAYDAFQQAVNRDSRNPT-----FWCSIGVLYYQIAQYRDALDAYTRAIRLNPYI 425

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 426 SEVWYDLGTLYETCNNQVNDALDAYKQAARLDPN 459

>SAKL0B00858g Chr2 (80047..82332) [2286 bp, 761 aa] {ON} highly
           similar to uniprot|P25039 Saccharomyces cerevisiae
           YLR069C MEF1 mitochondrial elongation factor G- like
           protein
          Length = 761

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 8/70 (11%)

Query: 152 IDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFETLNF 211
           + PT S G++R     + +  YE+     K +LD     A +  ++D E T +K   +  
Sbjct: 25  LKPTVSNGFTRNFHNTLAKRSYEEE----KVILD---EIAPNLTEKDLE-TSRKLRNIGI 76

Query: 212 STHIDSGSAT 221
           S HIDSG  T
Sbjct: 77  SAHIDSGKTT 86

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 78  ELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGL---PVDRGYLSNKSLALT 134
           E + ++   +  + N A         + +Y RA+DLL ++GL    V   YL+  +L L 
Sbjct: 166 EYIGDKVYSMTHDPNDAFWLAQVYYNMGQYIRAVDLLSRDGLDASSVMCRYLA--ALCLV 223

Query: 135 KSGRYEEACD 144
           K  RYE+A D
Sbjct: 224 KMERYEDALD 233

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 26/135 (19%)

Query: 80  VNEQAIKLKLE-GNKAVERENYKDAIDKYTRAIDLLK------------KNGLPV----- 121
           ++E  I   LE G +  + E+YK A + +++++ L +            K GLP      
Sbjct: 1   MSEDIIDRSLELGIQCFQGEDYKGAAELFSKSLQLARSYTDRSLEGIREKVGLPKRCLHD 60

Query: 122 -DRGY-------LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKY 173
             R Y       L N++    K  + + A  DA   I +D    KGY R  +      +Y
Sbjct: 61  PSRVYHPRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRY 120

Query: 174 EDAMNAYKQVLDLEG 188
           E+A+  Y+  L   G
Sbjct: 121 EEALQVYENGLKQAG 135

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 52/114 (45%), Gaps = 6/114 (5%)

Query: 75  KERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALT 134
           K  E+ ++ A      G   + R +Y  A D + +A++   +N +     +  +  +   
Sbjct: 302 KSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYY 356

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLE 187
           +  +Y +A D     I+++P  S+ +  L    +   N+  DA++AYKQ   L+
Sbjct: 357 QISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 410

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 6/97 (6%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           NE A +LK  GN   + ++Y++AI+ Y  A+ L  KN  PV    ++   ++L  +    
Sbjct: 83  NEYASELKKRGNAYFKVKDYENAINYYKFALQL--KND-PVFYSNMAACYISLEHNKEAI 139

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177
           EAC  AL   +++P +SK   + A       K+ DA+
Sbjct: 140 EACSKAL---ELNPDYSKVLLKRAAVYENIGKFADAL 173

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 45/94 (47%), Gaps = 6/94 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N       +  +  +   +  +Y +A D     I+++P  
Sbjct: 325 RNDYTAAYDAFQQAVNRDSRNPT-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 379

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           S+ +  L    +   N+  DA++AYKQ + L+ N
Sbjct: 380 SEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPN 413

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN   + + ++DA + YT+ I+ +K +   ++    +N++    +   + 
Sbjct: 75  HEIAENFKNQGNDLYKVKRFRDAREIYTKGIE-MKCDVAKINESLYANRAACQLELKNFR 133

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
               D    +  +P   K Y R+ +A    NK+E A
Sbjct: 134 SCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 91  GNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACI 150
           G   + R +Y  A D + +A++   +N       +  +  +   +  +Y +A D     I
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPT-----FWCSIGVLYYQISQYRDALDAYTRAI 439

Query: 151 KIDPTFSKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLEGN 189
           +++P  S+ +  L    +   N+  DA++AYKQ   L+ N
Sbjct: 440 RLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPN 479

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 97  RENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTF 156
           R +Y  A D + +A++   +N +     +  +  +   +  +Y +A D     I+++P  
Sbjct: 317 RSDYTAAYDAFQQAVNRDSRNPI-----FWCSIGVLYYQISQYRDALDAYTRAIRLNPYI 371

Query: 157 SKGYSRLAEA-KIGQNKYEDAMNAYKQVLDLE 187
           S+ +  L    +   N+  DA++AYKQ   L+
Sbjct: 372 SEVWYDLGTLYETCNNQLTDALDAYKQAARLD 403

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 8/72 (11%)

Query: 87  LKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEE---AC 143
           L+ +GN    +  Y+ A+  Y  A   L +   PV   +L+N S+AL K  R+E+   AC
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNAS--LAEPSNPV---HLANMSMALLKLERWEDALSAC 65

Query: 144 DDALACIKIDPT 155
           D AL  +K  P 
Sbjct: 66  DRALEIMKKGPV 77

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+A + + Y++A   Y R I++   N   ++     NK+    +   Y 
Sbjct: 71  HEIAENFKKQGNEAYKLKQYRNARVLYERGIEV-NCNNDKINELLFVNKAACELEMKNYR 129

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDA 176
              +D    +  +P   K Y R+A+A     KY+++
Sbjct: 130 SCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDES 165

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+  + + +KDA + YT+ + +  ++   ++    +N++    +   Y 
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYTKGVAVECEDK-SINESLFANRAACELELKNYR 138

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
           +  +D    + I+P   K Y R++++     K E+A +A
Sbjct: 139 KCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEAKSA 177

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 29.6 bits (65), Expect = 4.3,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 86  KLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEA 142
           K K +GN   ++  Y++A+  Y + I    +N  PV  GY SNK++AL K G Y +A
Sbjct: 6   KQKEQGNSLFKQGLYREAVHCYDQLITAQPQN--PV--GY-SNKAMALIKLGEYTQA 57

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 135 KSGRYEEACDDALACIKIDPTFSKGYSRLAEAKI 168
           K G Y+ A +    CI ++PT + GYS LA A +
Sbjct: 47  KKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYL 80

>Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa]
           {ON} YGL137W (REAL)
          Length = 887

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 63/133 (47%), Gaps = 20/133 (15%)

Query: 77  RELVNEQAIKLKLE--GNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKS--LA 132
           R+L+ +++ +++    G+ +++R N+K AI+ +T+A DL     L +     +NK   +A
Sbjct: 666 RDLLTDESAEMRWRSLGDASLQRFNFKLAIEAFTKAHDL---ESLFLLHSSFNNKEGLVA 722

Query: 133 LTK----SGRYEEACDDALACIKIDPT---------FSKGYSRLAEAKIGQNKYEDAMNA 179
           L K    +G++  A +       I+           FS+     +   +G N+ +D +  
Sbjct: 723 LAKDAETAGKFNLAFNAYWVAGDIEGAKDLLVKSERFSEAAFLGSTYGLGDNEVDDVVKK 782

Query: 180 YKQVLDLEGNKAT 192
           +KQ L L   KA 
Sbjct: 783 WKQYLILHNKKAV 795

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 49/99 (49%), Gaps = 1/99 (1%)

Query: 81  NEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYE 140
           +E A   K +GN+  + + +KDA + Y++ + +  ++   ++    +N++    +   Y 
Sbjct: 80  HEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDK-SINESLYANRAACELELKNYR 138

Query: 141 EACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNA 179
              +D    + I+P   K Y R ++A    NK E+A +A
Sbjct: 139 RCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSA 177

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 140 EEACDDALAC----IKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDL 186
           E+  D  + C    +KI+P     ++RL  +    NK EDA+ AY + L+L
Sbjct: 444 EDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNL 494

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 19/118 (16%)

Query: 84  AIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKN--GLPVD------------RGYLSNK 129
           A K+K  G +  ++++++DA  KY +A+  + +    + VD            + YL N 
Sbjct: 279 ANKIKESGTQLFKKKDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYL-NI 337

Query: 130 SLALTKSGRYEEACDDALACIKID--PTF--SKGYSRLAEAKIGQNKYEDAMNAYKQV 183
           SL L    +Y+ A   A   ++++  PT   +K Y R     + +N+ E+A+  YK  
Sbjct: 338 SLVLFNLKKYDSAITHATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYKNC 395

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
           {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
           YKL012w PRP40 splicing factor
          Length = 590

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 18/85 (21%)

Query: 72  LSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSL 131
           L EK+ +LV +QAI +K +  K +E+ N        TR    +KKN L      L +++ 
Sbjct: 480 LDEKDTQLVVKQAIAVKYDTVKEIEQRNL-----NMTR----IKKNNLVA----LFHRTF 526

Query: 132 ALTKSGRYEEACDDALACIKIDPTF 156
            +TK GR+E    DA+A I+  P +
Sbjct: 527 -VTKPGRFE----DAVAIIQNKPEY 546

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 149 CIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQ 182
           C+ +DPT +  +S L+ A +  NK ++A +  K+
Sbjct: 670 CVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKR 703

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,680,101
Number of extensions: 1722620
Number of successful extensions: 7193
Number of sequences better than 10.0: 258
Number of HSP's gapped: 7280
Number of HSP's successfully gapped: 309
Length of query: 351
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 241
Effective length of database: 40,868,139
Effective search space: 9849221499
Effective search space used: 9849221499
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)