Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026606.15ON26126111961e-167
NDAI0I022506.15ON2711848901e-121
KAFR0A050606.15ON2691858101e-109
Suva_15.1796.15ON2591747601e-101
Kpol_1045.746.15ON2572197591e-101
KNAG0F028806.15ON2692217581e-101
Skud_15.1656.15ON2571747511e-100
Smik_15.1736.15ON2511847436e-99
KLTH0C11352g6.15ON2682307422e-98
SAKL0E01056g6.15ON2691897395e-98
YOR004W (UTP23)6.15ON2541747376e-98
ZYRO0C07920g6.15ON2931817382e-97
TDEL0G045406.15ON2451817306e-97
CAGL0E02673g6.15ON2631807265e-96
KLLA0D01023g6.15ON2682147257e-96
Kwal_56.223996.15ON2741797102e-93
ACR011C6.15ON2531797082e-93
TPHA0J002806.15ON2711857059e-93
Ecym_30196.15ON2661896552e-85
TBLA0A072906.15ON2591775865e-75
Kwal_55.200895.392ON1891461662e-13
KLTH0E02860g5.392ON1891461626e-13
Kpol_1055.185.392ON1891461627e-13
ZYRO0A06754g5.392ON1891461601e-12
TDEL0E023305.392ON1891461583e-12
NDAI0C045505.392ON1891461574e-12
NCAS0F030905.392ON1891461557e-12
AEL102W5.392ON1891461558e-12
TPHA0D023105.392ON1891461549e-12
KLLA0A07018g5.392ON1891431549e-12
SAKL0G07766g5.392ON1891461549e-12
CAGL0M01056g5.392ON1891461531e-11
Ecym_74695.392ON1891461512e-11
KAFR0D042805.392ON1891461494e-11
Skud_4.6065.392ON1891461495e-11
Smik_4.5995.392ON1891461495e-11
Suva_2.5095.392ON1891461495e-11
KNAG0C052705.392ON1891461486e-11
YDR339C (FCF1)5.392ON1891461486e-11
TBLA0H017505.392ON1891461478e-11
NDAI0A025907.234ON115855712.1
Kwal_56.235098.241ON28439665.1
Smik_2.297.422ON42153649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02660
         (261 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   465   e-167
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   347   e-121
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   316   e-109
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   297   e-101
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   296   e-101
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   296   e-101
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   293   e-100
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   290   6e-99
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   290   2e-98
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   289   5e-98
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   288   6e-98
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   288   2e-97
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   285   6e-97
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   284   5e-96
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   283   7e-96
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   278   2e-93
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   277   2e-93
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   276   9e-93
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   256   2e-85
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   230   5e-75
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    69   2e-13
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    67   6e-13
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    67   7e-13
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    66   1e-12
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    65   3e-12
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    65   4e-12
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    64   7e-12
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    64   8e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    64   9e-12
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    64   9e-12
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    64   9e-12
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    64   1e-11
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    63   2e-11
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    62   4e-11
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    62   5e-11
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    62   5e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    62   5e-11
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    62   6e-11
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    62   6e-11
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    61   8e-11
NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7....    32   2.1  
Kwal_56.23509 s56 complement(578499..579353) [855 bp, 284 aa] {O...    30   5.1  
Smik_2.29 Chr2 complement(40990..42255) [1266 bp, 421 aa] {ON} Y...    29   9.8  

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  465 bits (1196), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 234/261 (89%), Positives = 234/261 (89%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 TAAEDVKIDDXXXXXXXXXXXXXXXXLSMKKKKQEPKRNREDSTEDQESSENXXXXXXXX 240
           TAAEDVKIDD                LSMKKKKQEPKRNREDSTEDQESSEN        
Sbjct: 181 TAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNREDSTEDQESSENKKKRRRKH 240

Query: 241 XXXTEADTVTEPAASDSLGQQ 261
              TEADTVTEPAASDSLGQQ
Sbjct: 241 KPKTEADTVTEPAASDSLGQQ 261

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  347 bits (890), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 159/184 (86%), Positives = 173/184 (94%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVYNHTF+FR PYQ+LVDNQIV DCS SNYDL KGL  TLQ+EVKVM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE N+Q+AIELARRFERRRCNHNPK+PKT IECIESVVNINGQNKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD+A RRKLRQVPGVPL+HISRAVMIMEPLSD SA+VS+RKENEKLYKGLNDPK+TGVK
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 TAAE 184
           +A +
Sbjct: 181 SAVD 184

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  316 bits (810), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 165/185 (89%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDN+IVT  S SN+DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE  DQNAI++A+ FERRRCNH PK+PKTPIEC+ SVVN+NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD+ IRR+LR+VPGVPLVHISR+VMIMEPLSD SAK+S R E EKLYKGLNDPKY G+K
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 TAAED 185
              E+
Sbjct: 181 LDEEE 185

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  297 bits (760), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 157/174 (90%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN+DL  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVVN+NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDP 174
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK S+  E +KLYKGLNDP
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP 174

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 171/219 (78%), Gaps = 1/219 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQ+RAKSYRKQ+LVYNHTF+FREPYQ +VD+Q+V DC  S +D+ KGL RTLQAEVKVM
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY+ ++Q AI +A+ FERRRCNH PKDPK+P+ECIES+V+I G NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD+ IRRKLR++PGVP+VH+SRAVMI+EPLSDAS K+S+R E +KLYKGLND K+T   
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 181 TAAEDVKIDDXXXXXXXXXXXXXXXXLSMKKKKQEPKRN 219
              +  K  +                LSMKK+K +P  N
Sbjct: 181 DEPKSEK-SEKTSESKKNKGPKQPNPLSMKKRKSKPASN 218

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  296 bits (758), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 174/221 (78%), Gaps = 7/221 (3%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVYNHTFRFREPYQ+++D++IV   + S +DL K L RT+QAEVK+M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY  N++ AI++A+R+ERRRCNH PKDPK+P ECIESVV+I G+NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
            Q++ +RRKLR+VPGVPL+H+SRAVMIMEPLSDASA++SKR E +KL+ GLND K  G+K
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 TAAEDVKIDDXXXXXXXXXXXXXXXX------LSMKKKKQE 215
            AAE  K++D                      LSMKKKK++
Sbjct: 181 -AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKKKD 220

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  293 bits (751), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 158/174 (90%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V++CS SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P ECIESVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDP 174
           +QD+ +RRKLR VPGVPL+H++R+VMIMEPLS ASAK SK+ E +KL+KGLNDP
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP 174

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  290 bits (743), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 159/184 (86%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V +C+ SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  ++ AI+LA++FERRRCNH+ KDPK+P +CIESVV+ING NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD+ +RRKLR VPGVPL+H++R+VM+MEPLS ASAK SK  E  KLYKGLNDP    V+
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 TAAE 184
             +E
Sbjct: 181 EISE 184

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  290 bits (742), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 172/230 (74%), Gaps = 1/230 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQ+LVD+QIV D   +++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QA+YE  +Q+AIELA+ FERRRCNH PK+ K PIEC++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD +IR+KLRQVPGVPL++++R+VM+MEPLS AS   S+ +E EKL+KGLNDPKY G+ 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 TAAEDVKIDDXXXXXXXX-XXXXXXXXLSMKKKKQEPKRNREDSTEDQES 229
              E  K D+                 LS+KKKK  P    E    D+ S
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKIS 230

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  289 bits (739), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 132/189 (69%), Positives = 160/189 (84%), Gaps = 3/189 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQ+LVYNHTF+FREPYQ+LVD+QIV     S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY   DQ AIE+A+ +ERRRCNH PK+ KT +ECIESVVN NG+NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
            QD+ IRRKLR+VPGVPL++++R+VM+MEPLS+AS ++SK +E EKL+KGLNDPK+ G+ 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGL- 179

Query: 181 TAAEDVKID 189
             A D  +D
Sbjct: 180 --AHDESVD 186

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  288 bits (737), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 154/174 (88%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVY+HTF+FREPYQ+LVDNQ+V +C+ SN++L  GL RTLQA+VKVM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QALYE  +  AI LA++FERRRCNH+ KDPK+P ECIESVVNI+G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDP 174
           +QD+ +RRKLR VPGVPL+H++R+VM+MEPLS ASAK SK  E +KLYKGLNDP
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDP 174

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  288 bits (738), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (86%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSY+KQ+LVYN+ FRFREPYQ+L+D+Q+V+DC  S+YDL  GL RTLQAEVK M
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALY   +Q+AIEL + FERRRCNH PK+ K P ECI+SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QDV +RRKLR+VPGVPL+H+SR+VM+MEPLS+AS++V++  E EKL KGLNDPK  G+K
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 181 T 181
           T
Sbjct: 181 T 181

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  285 bits (730), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAK+YRKQ+LVYNHTF+FREPYQ+LVDNQIV DC  SN+DL KGL RTLQAEVKVM
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE N Q AIELA+ FERRRCNH PK+PK PIEC+ES+V +NG NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
           +QD+  RR LR+ PGVPLVH  R+VM+MEPLSDASAKVS   E EKL+KGLNDP+  G+K
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 T 181
           T
Sbjct: 181 T 181

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  284 bits (726), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (85%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQLLVYNHTF+FREPYQ+L+D+QIV D +TS YDL K L RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQALYE  +++AI+L + FERRRC H P +  +P ECI +VV++ G+NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
            QDV IRR LR+VPGVPL+HISR+VMIMEPLSDASAKVS+ +E  KL++GLNDPKY G+K
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGLK 180

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  283 bits (725), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 170/214 (79%), Gaps = 1/214 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQ+LVYNHTF+FR+PYQ+LVD+Q+V +   S++D  KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQ+LY+ N+Q AI+  ++FERRRCNH+PK+PK+ +EC+ SVV++NG+NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV- 179
            QDV IRR+LR++PGVPLV+++R+VM+MEPLS+AS KVS+  E +KLYKGLNDPK+ G+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 180 KTAAEDVKIDDXXXXXXXXXXXXXXXXLSMKKKK 213
           +   ++   ++                LSMKKKK
Sbjct: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKK 214

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  278 bits (710), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 151/179 (84%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQ+LVD+QIV D   + +DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+QA+YE NDQ AIELA+ FERRRCNH PK+ K P+EC++SVVN+NG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179
            Q+  IR  LR+VPGVPLV ++R+VM+MEPLS AS  VS+ +E EKL+KGLNDPK+ G+
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGL 179

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  277 bits (708), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 123/179 (68%), Positives = 155/179 (86%), Gaps = 1/179 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAK+Y+KQ+LVYNHTF+FREPYQ+LVD+QIV + + S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCCMQ LY+  +Q+AI   + +ERRRCNH  K+PK PIEC++SVV +NGQN+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179
           +QD+AIRR LR+VPGVPLV+I+RAVM+MEPLS  S +VS+  E +KL+KGLNDPKYTG+
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI 178

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  276 bits (705), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 125/185 (67%), Positives = 157/185 (84%), Gaps = 1/185 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAE-VKV 59
           MRQKRAKSY+KQ++VYNHTF+FREPYQILVD QIV D   SNY+L + L +TLQAE +KV
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVV 119
           MITQCCMQ LY  ++Q  I+ A+RFERRRCNH+ KDPK P+ECIES+VNI+GQNKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 AAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV 179
           A Q++ +RRKLR+VPGVP++H+SR+VMIMEP+SD+S +++++ E  KLYKGLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 KTAAE 184
            T  E
Sbjct: 181 PTPKE 185

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  256 bits (655), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 155/189 (82%), Gaps = 1/189 (0%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60
           MRQKRAK+Y+KQ+LVYNHTF+FR+PYQ+LVD+Q+V + + S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120
           ITQCC+Q LYE+ +Q AI  A+ +ERRRCNH  K+PK P ECI SVV+ING+N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHY-KEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180
            QD+ IRR LR+VPGVPL++++R+VM+MEPLS  S +VS++ ENEKL KGLNDPKY G  
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 TAAEDVKID 189
              ED  +D
Sbjct: 180 NNTEDASVD 188

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  230 bits (586), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 141/177 (79%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAE--VK 58
           MRQKRAKSY+KQL+VYNHTF+FREPYQ+++D+ +V +   + Y+L KGL+  L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  VMITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYV 118
            MITQCC+ ALY++ DQ +I + + FERRRCNH+ K+P +P EC+ S+V++NG+NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VAAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPK 175
           VA QD+ +RRKLR++PGVPL+H  R+VM+MEPLSDAS + ++  E++KL  GLN  K
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        DL +G+  TL A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D A+++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+  TL A+   MIT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A+ LAR  R +R  C+H         +CI     +N   +H+ Y+VA  DV +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    R PYQ+L+D   +        D+ KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C H         +C+     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        DL +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +      +E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        DL +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        DL KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A+ LAR  R +R  C+H         +CI     +N   +H+ ++VA  D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        DL +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (48%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L +      R PYQ+L+D   +        D+ KG+   L A+   +IT C M  L +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A+ LAR  R +R  C+H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 73/143 (51%), Gaps = 13/143 (9%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ KG+   L A+  ++IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +CI     ++   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPL 151
           ++R+VPG+PL+ +     ++E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A+ LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D A+++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ KG+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R+VPG+PL+ +     ++E L D 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     ++   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     ++   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     ++   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C M  L +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +C+     ++   +H+ Y+VA  D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 73/146 (50%), Gaps = 13/146 (8%)

Query: 14  LVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVMITQCCMQALYEAN 73
           L + +    + PYQ+L+D   +        D+ +G+   L A+   +IT C +  L +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 74  DQN--AIELAR--RFERRRCNHNPKDPKTPIECIESVVNINGQNKHR-YVVAAQDVAIRR 128
            +   A++LAR  R +R  C+H         +CI     +N   +H+ Y+VA  D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLVHISRAVMIMEPLSDA 154
           ++R++PG+PL+ +     ++E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>NDAI0A02590 Chr1 (576657..580133) [3477 bp, 1158 aa] {ON} Anc_7.234
          Length = 1158

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 136 VPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVKTAAEDVKIDD 190
           VPL  +    M+ E + D   +   ++ N +LY+ L+ PK      A++D+K+ D
Sbjct: 230 VPLAFVLTVNMMKEAMDDIQRRRRDKESNNELYEALSQPKL----VASKDLKVGD 280

>Kwal_56.23509 s56 complement(578499..579353) [855 bp, 284 aa] {ON}
           YER175C (TMT1) - 1:1 [contig 176] FULL
          Length = 284

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%)

Query: 70  YEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVN 108
           + A++    ++ ++F RR   H  +DP TP++   S VN
Sbjct: 240 WRAHNPKKQDICKKFMRRVSGHTRQDPNTPLKVAWSTVN 278

>Smik_2.29 Chr2 complement(40990..42255) [1266 bp, 421 aa] {ON}
           YBL091C (REAL)
          Length = 421

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 138 LVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVKTAAEDVKIDD 190
           ++ +   V I   + D++  VS   + + L   + D  YTG+K A  DV++ D
Sbjct: 190 VMKVDYGVQINGNIIDSAFTVSFDPQYDNLLAAVKDATYTGIKEAGIDVRLTD 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,530,108
Number of extensions: 866452
Number of successful extensions: 2460
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2455
Number of HSP's successfully gapped: 51
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)