Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026506.18ON95095047950.0
NDAI0I022606.18ON96795429740.0
TDEL0G045106.18ON96995727150.0
ZYRO0C07854g6.18ON94494227050.0
KAFR0A050506.18ON94894525820.0
Suva_15.1806.18ON94894425580.0
YOR005C (DNL4)6.18ON94494025500.0
Kpol_1032.76.18ON96595325100.0
Smik_15.1746.18ON94594325000.0
KNAG0F028706.18ON95495124820.0
Skud_15.1666.18ON94795324750.0
CAGL0E02695g6.18ON94693524710.0
TPHA0M002606.18ON96696023420.0
Kwal_56.224146.18ON96396223250.0
TBLA0G010406.18ON97298322900.0
KLTH0C11286g6.18ON95194921730.0
KLLA0D01089g6.18ON90795220150.0
ACR008W6.18ON98194420200.0
NDAI0A019407.343ON7652452811e-24
Kpol_2001.717.343ON7262502683e-23
Kwal_56.246167.343ON7154402612e-22
TPHA0D045707.343ON7362542612e-22
CAGL0I03410g7.343ON7242702603e-22
SAKL0F10912g7.343ON6932752584e-22
Smik_4.747.343ON8452462533e-21
KLTH0H01408g7.343ON7232452487e-21
YDL164C (CDC9)7.343ON7552412461e-20
ACL155W7.343ON6972402442e-20
Suva_4.827.343ON7553942433e-20
Skud_4.937.343ON7552782434e-20
TBLA0E020507.343ON7202462407e-20
TDEL0C020407.343ON7052982318e-19
KLLA0D12496g7.343ON7002492319e-19
NCAS0A141107.343ON7532782273e-18
KNAG0C037407.343ON7272402246e-18
ZYRO0F11572g7.343ON7312392211e-17
KAFR0B008307.343ON7102472131e-16
KAFR0D039701.79ON1233173890.085
KAFR0C051907.46ON896157880.089
Suva_8.4007.46ON985118870.11
ADL185W3.24ON47769850.18
NDAI0E039307.46ON1028150840.27
ZYRO0G15180g1.276ON68831790.92
AFR095C1.276ON67089790.93
AFL107W6.228ON463105752.6
CAGL0E05588g7.46ON88764762.7
TPHA0D030203.447ON58899744.1
YOR346W (REV1)7.46ON985153744.6
Kwal_26.69487.46ON96489744.7
SAKL0E13860g2.29ON636102735.0
CAGL0D06050g1.495ON52485735.2
TDEL0D014401.276ON60360735.3
Suva_6.1641.276ON75952728.0
KLLA0F14300g1.276ON66944718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02650
         (950 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...  1851   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...  1150   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...  1050   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...  1046   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   999   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   989   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   986   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   971   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   967   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   960   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   957   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   956   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   906   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   900   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   886   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   841   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   780   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   782   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   112   1e-24
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   107   3e-23
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   105   2e-22
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   105   2e-22
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   104   3e-22
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   103   4e-22
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   102   3e-21
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   100   7e-21
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    99   1e-20
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...    99   2e-20
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...    98   3e-20
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    98   4e-20
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...    97   7e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    94   8e-19
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...    94   9e-19
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    92   3e-18
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    91   6e-18
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    90   1e-17
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    87   1e-16
KAFR0D03970 Chr4 complement(778963..782664) [3702 bp, 1233 aa] {...    39   0.085
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    39   0.089
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    38   0.11 
ADL185W Chr4 (373877..375310) [1434 bp, 477 aa] {ON} Syntenic ho...    37   0.18 
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    37   0.27 
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    35   0.92 
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    35   0.93 
AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic ho...    33   2.6  
CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} simila...    34   2.7  
TPHA0D03020 Chr4 (629502..631268) [1767 bp, 588 aa] {ON} Anc_3.4...    33   4.1  
YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}  REV1Deoxy...    33   4.6  
Kwal_26.6948 s26 complement(137749..140643) [2895 bp, 964 aa] {O...    33   4.7  
SAKL0E13860g Chr5 complement(1141665..1143575) [1911 bp, 636 aa]...    33   5.0  
CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} simila...    33   5.2  
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    33   5.3  
Suva_6.164 Chr6 (286935..289214) [2280 bp, 759 aa] {ON} YJL090C ...    32   8.0  
KLLA0F14300g Chr6 complement(1325862..1327871) [2010 bp, 669 aa]...    32   8.3  

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 1851 bits (4795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/950 (95%), Positives = 907/950 (95%)

Query: 1   MSQQIQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEV 60
           MSQQIQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEV
Sbjct: 1   MSQQIQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEV 60

Query: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120
           INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL
Sbjct: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120

Query: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLA 180
           SWKARAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLA
Sbjct: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLA 180

Query: 181 DSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTT 240
           DSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTT
Sbjct: 181 DSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTT 240

Query: 241 RLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHY 300
           RLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHY
Sbjct: 241 RLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHY 300

Query: 301 QDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMIL 360
           QDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMIL
Sbjct: 301 QDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMIL 360

Query: 361 PFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP 420
           PFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP
Sbjct: 361 PFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP 420

Query: 421 HIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQ 480
           HIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQ
Sbjct: 421 HIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQ 480

Query: 481 FGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTI 540
           FGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKA                  APVEQERTI
Sbjct: 481 FGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTI 540

Query: 541 HKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVV 600
           HKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVV
Sbjct: 541 HKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVV 600

Query: 601 IEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGS 660
           IEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGS
Sbjct: 601 IEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGS 660

Query: 661 DQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKER 720
           DQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKER
Sbjct: 661 DQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKER 720

Query: 721 MYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSK 780
           MYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSK
Sbjct: 721 MYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSK 780

Query: 781 SLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTP 840
           SLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPI             NLVRVQGLVTP
Sbjct: 781 SLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTP 840

Query: 841 YADEELIKIPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNX 900
           YADEELIKIPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGN 
Sbjct: 841 YADEELIKIPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNQ 900

Query: 901 XXXXXXXXXXXKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                      KNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI
Sbjct: 901 QLLQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/954 (59%), Positives = 698/954 (73%), Gaps = 23/954 (2%)

Query: 16  TPCNFSPSPAFQWLCDELFVKLEDIQ---SKRDPKNIGKPVTVRYYEVINHFIALWRKTV 72
           TP NF+PSP+F+WLCDELFVKLE IQ   + +  K   KP+ V+YYEVI HFI LWRKTV
Sbjct: 18  TPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYEVIQHFINLWRKTV 77

Query: 73  GNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKL 132
           GNDI+PALILILPYRDRR++N+RDYTLIKAIC+YLKLP+NSFTEKRLLSWK RAG+ V+L
Sbjct: 78  GNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRLLSWKQRAGRSVRL 137

Query: 133 SQFCVNEIKKRKSEPK--DKIEITIDRLNECLDKLAEERNSKGR-GFKKLADSPTFKFCL 189
           S F V+EIKKRKSEP+   + EITID+LN+CLD L+EERNSKG  G++ L+DSPTF FCL
Sbjct: 138 SSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGYRGLSDSPTFVFCL 197

Query: 190 ENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRL 249
           ENM+F+ELQFFFDI+LK+RVIGG EHKFLN WHPDAQDYLSVVSDL+TV  +LWDP + L
Sbjct: 198 ENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHL 257

Query: 250 QNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKF 309
           +N+DL IN G  FAPQ AKKLSISYEKIC KLK+DF IEEKMDGERIQLHYQDYG KL F
Sbjct: 258 KNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSF 317

Query: 310 FSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369
            SRRGTDYTYLYGESI DG + K+L L+ +V++C+LDGEM+T+DK +N +LPFGLVKSSA
Sbjct: 318 LSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSA 377

Query: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429
           RS++T++G+ NEGY+PL MVFDL+++NG SL NIPL  RK YL  IFTPE HI+ELL S 
Sbjct: 378 RSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSK 437

Query: 430 HRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 489
              +E SI+ +LE AIS+GSEG+VLK Y+SRYTVASRNDDWIKVKPEYLEQFGENMDLIV
Sbjct: 438 RCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 497

Query: 490 IGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXA-------PVEQERTIHK 542
           IG+DPGKKDSLMCGLAVVEEDE                             +E+E+TI +
Sbjct: 498 IGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGEDKEGNEIEREKTIKR 557

Query: 543 FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE 602
           FVSFC IANG+SQEEFK I R T+G W +SDEIPPP  LL+FG+R+P EWIDPK S+VIE
Sbjct: 558 FVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSRVPAEWIDPKDSIVIE 617

Query: 603 VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVK--SRRNGS 660
           VKARS++  E   +KF TG TLYGGYCR IREDKDW+TCYTLSE  R K  K  S +  +
Sbjct: 618 VKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSELRRMKRFKLGSNKRAN 677

Query: 661 DQVIHGV---KRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIE 717
           +   H +   KR+K  R  Y  ++  E+    L  +  F  LYFYVISDV  D  G+R+ 
Sbjct: 678 NDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFYVISDVV-DATGSRVS 736

Query: 718 KERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCV 777
           +E +Y  I   GG ++HN+I+K  G    RI+ GK T EC +LI+RGYD+I PQW++DC+
Sbjct: 737 REELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLIDRGYDIIEPQWVLDCI 796

Query: 778 QSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGL 837
           +   LLKLEPKYCFNVS EL K+ ++RVD FGDS+E  I               VR    
Sbjct: 797 KDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFSRLIERN---VRSLRN 853

Query: 838 VTPYADEELI-KIPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILP 896
             P    +++  +PLFLF  R +L    +    + L+ +I+LYGGK T D+  CNL+++ 
Sbjct: 854 APPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTKLKVQIRLYGGKTTGDLASCNLVVIQ 913

Query: 897 NGNXXXXXXXXXXXXKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                          K   ++ + P +PYIV P WI+ SI E  QVPEED+PV+
Sbjct: 914 QNEIAVAKDVRSSLLKLTSDTDKPPVLPYIVTPEWIDSSISEGCQVPEEDHPVV 967

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/957 (54%), Positives = 669/957 (69%), Gaps = 15/957 (1%)

Query: 1   MSQQIQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEV 60
           +SQ++Q S+       P NF+PSP F WLC+ELFVKLED+Q +       KP++VRYYEV
Sbjct: 13  VSQELQESESTEK--APPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEV 70

Query: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120
           I+HFI LWRKTVGN+IFPAL+L LPYRDRR++NI+DYTL+KAIC+YL LP+ S TEKRLL
Sbjct: 71  ISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLL 130

Query: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLA 180
            WK RA +GV+LS FCV EI+KRKSEP     ITID+LNECLD L EERN+KG GFK L+
Sbjct: 131 KWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG-GFKGLS 189

Query: 181 DSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTT 240
           DSPTF FCL+NMSFIEL+FFFDI+LKNRVIGGQEHK LN WHPDA DYLSVVSDL TV +
Sbjct: 190 DSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVAS 249

Query: 241 RLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHY 300
           RLWDPE RL+ +DL IN G+AF PQLAKK++ISYEKIC KL NDF+IEEKMDGERIQ+HY
Sbjct: 250 RLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHY 309

Query: 301 QDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMIL 360
            DYG K++F SRRG DYT LYGE++  G +  +L  + +V+DC+LDGEMIT+D  +N++L
Sbjct: 310 MDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVL 369

Query: 361 PFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP 420
           PFG+VKSSAR  L+ +GI ++G++P+ MV DL+++NG SL  +PL  RKE+LN +  P P
Sbjct: 370 PFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCP 429

Query: 421 HIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQ 480
           H +E+L         +IRKSLE +ISMGSEGIVLK Y +RY + +RND WIKVKPEYLEQ
Sbjct: 430 HAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQ 489

Query: 481 FGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQ---E 537
           FGEN+DL++IGR PGKKDSLMCGLAV E +E                      ++    +
Sbjct: 490 FGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELDDTDGK 549

Query: 538 RTIHKFVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKK 597
           + I  F+SFCVIANG+SQ+EFK+IDRKTRG W +SD+  P   LL+FG+++P EWIDPK 
Sbjct: 550 KIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKN 609

Query: 598 SVVIEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRR 657
           S+++EVKARS+D  ES+ +KFA GCTL+GGYCR IR+DKDW  CY+ SE  + +  KS  
Sbjct: 610 SIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERLHKSST 669

Query: 658 N-GSDQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRI 716
             GS    +  K + K R+         ++  +  +T  F+ L FYV+SD  D     RI
Sbjct: 670 GVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNVRI 729

Query: 717 EKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC 776
            K      I +  G L+ N+ISK       RIISGK T EC ALIERGYD+++PQWI+DC
Sbjct: 730 TKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWILDC 789

Query: 777 VQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQG 836
           ++++ ++KLEP++CFNVS+EL  +   RVD +GDS+  PI             N+ + + 
Sbjct: 790 IRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPI--TEQQLDNLIDTNMKQTEP 847

Query: 837 LVTPYADEELIKIPLFLFQDRIMLFPNTESKTISF--LQEKIKLYGGKLTTDIGKCNLII 894
            +   A+ EL  +PLFLF  R +  P      +    L  K KL+GG + +DI  CNLII
Sbjct: 848 NLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDIPSCNLII 907

Query: 895 LPNGNXXXXXXXXXXXXKNIMNS----GEVPTIPYIVNPLWIERSIEENSQVPEEDY 947
           +PN N            ++++ +       P+IPYIV P W+E+SIEEN QVPEED+
Sbjct: 908 MPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVPEEDF 964

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/942 (54%), Positives = 673/942 (71%), Gaps = 16/942 (1%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NF+PSP F+WLCDELFVK++++Q +       K +TV+Y+E+I+ F+ LWRKTVG++I
Sbjct: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           +PALILILPYRDRR+FNI+DYTLIKAIC++L+LP NS TEKRLL WK RAG+G+KLS FC
Sbjct: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130

Query: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196
           V EI++R+SEP +   ITID+LNECLD+LAEERN+KGRGFK LADS  FK+CLENMSF E
Sbjct: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190

Query: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256
           ++++FDI+LK+RVIGGQEHKFLN WHPDA+DYLSVVSDL+TV  +LWDP  RL+N+DL +
Sbjct: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250

Query: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316
           N G  FAP LAK+L ISY+K+ ++LK+DF IEEKMDGERIQLHY DYG KLK+FSRRG D
Sbjct: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310

Query: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376
           YTYLYGE I  G + K+L+L+  V++C+LDGEMI++D  +N +LPFGLVKSSAR  LT +
Sbjct: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436
           GI+ +GY+PL+MV D +++NG SL N+PLN RK+YL+ I  P PH +E++ S H +++ S
Sbjct: 371 GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTS 430

Query: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
           I+ SLE AI MGSEGI+LK + S+Y + +R D+WIK+KPEYLEQFGEN+DL+VIGRDPGK
Sbjct: 431 IKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDPGK 490

Query: 497 KDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGLSQE 556
           KDSLMCGLAV+E DE+                      E  + + KF+SFC IANG+SQE
Sbjct: 491 KDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEE----EPRKAVKKFISFCTIANGISQE 546

Query: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616
           EFKQI+RKT G W  +++  PP  +L+FG++LP EWI P+ SVV+EVKARS+D  ES+GR
Sbjct: 547 EFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSGR 605

Query: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFL--RTKNVKSRRNGSDQVIHGVKRQKKNR 674
           KF  GCTL+GGYCR IREDK+W  CYTL E    R K V    + ++Q     K+ ++ R
Sbjct: 606 KFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKSKKIRRPR 665

Query: 675 RKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIH 734
               L+Q+L  +    K ++ F  L FYVISD        RI KE++   I   GG L  
Sbjct: 666 IVSRLNQTLSCDDE-AKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGKLTF 724

Query: 735 NIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVS 794
           N+IS       LRIISGK T EC ALIERGYD+++PQW++DCV +  L+ +EP++CF+VS
Sbjct: 725 NVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPRHCFSVS 784

Query: 795 TELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXX-NLVRVQGLVTPYADEELIKIPLFL 853
            +++K+   RVD FGDSY+V I              +     G +   +D E   IPLFL
Sbjct: 785 EDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVE--DIPLFL 842

Query: 854 FQDRIMLFPNTESK-TISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXXXXXXXXK 912
           F  RI+  P   S      L+ K++LYGG+LT ++ +CNLII+P+G             +
Sbjct: 843 FSRRIVFIPEGFSYLDTQLLKHKVRLYGGQLTDNVNQCNLIIVPDGKINLRGRIISDLRR 902

Query: 913 NIMNSGEV----PTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
            +     +    P IP+IV P WI+RSIEEN QVPEED+  +
Sbjct: 903 LLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/945 (52%), Positives = 668/945 (70%), Gaps = 14/945 (1%)

Query: 12  PPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKT 71
           P V  P NF+PSP F+WLC+ELF KLE++ ++R      K +T+RYYE+I +F+ LWR T
Sbjct: 6   PEVEVPRNFAPSPQFKWLCEELFSKLEEVPNQRHLTT--KRITLRYYEIITNFVNLWRTT 63

Query: 72  VGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVK 131
           VG+DI+PALIL LPYRDRR++N++DYTLIKAIC YLKLP+NSFTEKRLL+WK RA + VK
Sbjct: 64  VGDDIYPALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVK 123

Query: 132 LSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLEN 191
           LS  CVNE++KRKSEP +K  IT+D LN  LD L+++RN KGRG+K L++S  F +C+E 
Sbjct: 124 LSVSCVNEMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEK 183

Query: 192 MSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQN 251
           MSF+EL++FFDI+LK RVIG  EHK LNAWHPDA+DYLSVVSDL+TV TRLW+P IRL++
Sbjct: 184 MSFMELRYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRH 243

Query: 252 NDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFS 311
           ++L IN G+AFAP LAKKLSISY+KIC KLKNDF IEEKMDGERIQ+HY DYG  +KF S
Sbjct: 244 DELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLS 303

Query: 312 RRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARS 371
           RRG DYTYLYGE++  G I  +LKLN+DVK+C+LDGEM+TYD+ Q+++LPFG+VKS+A +
Sbjct: 304 RRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMN 363

Query: 372 MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHR 431
            LTK+ I  + Y PL MVFDL+F+NG+SL   PL  RK+YL  +  P    +++++    
Sbjct: 364 ALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRC 423

Query: 432 FNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
            NE+ IRKSLE AIS+GSEGIVLK Y+SRY + SRND WIK+KPEYLEQFGENMDLIVIG
Sbjct: 424 SNENIIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIG 483

Query: 492 RDPGKKDSLMCGLAVVEEDEKAXXXXXXX-XXXXXXXXXXXAPVEQERTIHKFVSFCVIA 550
           RD  KKDS  CGL V++E+E+                       E  R I K VSFC+IA
Sbjct: 484 RDSAKKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIA 543

Query: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610
           NG+SQ E+K+I RKTRG W +++E+PPP  L++FGT++P+EWI+P+ SVV+E+KARS+D 
Sbjct: 544 NGISQNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDN 603

Query: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQ 670
            ES+ ++F  GCTLYGGYCR IR+D DW++ ++L+E  R + +K     S++      ++
Sbjct: 604 TESSCKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKK 663

Query: 671 KKNRRKYI-LDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGG 729
           ++ ++    L+Q+L     +   +  F  L+FY++SD FD     RI K+ + K + E G
Sbjct: 664 RRKKQLLTPLNQNLNPR-DIQTTSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENG 722

Query: 730 GTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKY 789
           G + HNI+SK+    NLRI+ GK T EC+ LI+RGYD+++PQW++DCV++K ++K+EP +
Sbjct: 723 GKISHNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSH 782

Query: 790 CFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPY-ADEELIK 848
           CF+VS +L  L  +RVD +GDSYE  +             ++     L++P     +  K
Sbjct: 783 CFSVSDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDI--SPDLLSPANMSLDFEK 840

Query: 849 IPLFLFQDR--IMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXXX 906
           +P FLF  R   ++  N +  +I     KI+LYGGK+  +I +CN++I P          
Sbjct: 841 VPYFLFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES 900

Query: 907 XX----XXXKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDY 947
                    K +  S E+P +P IV+  WI+ SIE+N QVPEEDY
Sbjct: 901 MKFIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  989 bits (2558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/944 (51%), Positives = 649/944 (68%), Gaps = 20/944 (2%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NF+PSP F+WLC+ELF K+E++         GK V+ RYYE+I++F  LWRKTVGN+I
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEVLIN-GTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           +PALIL LPYRDRR++NI+DY LI+ +C+YLKLP+NS TE+RL  WK R GKG  LS   
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129

Query: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196
           V EI KR++EP  K  IT+D +N  LD+L++E N+ GRGFK L  S  F  CLENM+F+E
Sbjct: 130 VEEISKRRTEPTRK-SITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVE 188

Query: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256
           L+FFFDILLKNRVIGGQEHK LN WHPDAQDYLSVVSDLR VT++L+DP+IRL+N+DL I
Sbjct: 189 LKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSI 248

Query: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316
             GFAFAPQLAKK+++SYEKIC  L+NDF +EEKMDGERIQ+HY +YG+ +KFFSRRG D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGID 308

Query: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376
           YTYLYG ++  G I ++LK +  VK+C+LDGEM+T+D  + +ILPFGLVK SA+  L+ +
Sbjct: 309 YTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFN 368

Query: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436
            I N  + PL+MVFDL+++NGTSL  +PL  RKEYL+ I  P   ++E++     ++ +S
Sbjct: 369 DINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAES 428

Query: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
           ++KSLE+AIS+GSEG+VLK Y S Y VASRN++WIKVKPEYLE+FGEN+DLI+IGRD GK
Sbjct: 429 VKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSGK 488

Query: 497 KDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGLSQE 556
           KDS M GL VV+E E                         ++ + K +SFC IANG+SQE
Sbjct: 489 KDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQE 548

Query: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616
           EFK+IDRKTRG W ++  + PP ++L+FG++LP EWI+P +S+V+E+K+RS+D  E+N +
Sbjct: 549 EFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNMQ 608

Query: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIH-GVKRQKKNRR 675
           K+AT CTLYGGYCR IR DKDW  CYTL E    +  KS  N S QV +  ++   K R+
Sbjct: 609 KYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKS--NPSHQVENLQLQLVPKKRK 666

Query: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735
           + ++    ++       +  F  L+FYV+SD  + V G RI +  +   I + GG LIHN
Sbjct: 667 RALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIHN 726

Query: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795
           +I K+    ++R+I  KLT EC ALI+RGYD+++P+WI+DC     LL +EP YCF+VS 
Sbjct: 727 VILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVSG 786

Query: 796 ELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADE--ELIKIPLFL 853
           +L+ +  +RVD FGDS+E  I             +L     L T  AD+  EL  IPLFL
Sbjct: 787 KLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDL-----LSTRQADKSFELQIIPLFL 841

Query: 854 FQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILP------NGNXXXXXX 905
           F +RI+  P ++   K    L+ KI+L+GGK+T      NLII+P       G+      
Sbjct: 842 FSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVH 901

Query: 906 XXXXXXKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPV 949
                     NS  VP IP IV P W++ SI EN QVPEED+PV
Sbjct: 902 SQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDFPV 945

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/940 (51%), Positives = 654/940 (69%), Gaps = 14/940 (1%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NF+PSP F+WLC+ELFVK+ ++Q        GK  + +YYE+I++F+ +WRKTVGN+I
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEVQIN-GTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           +PAL+L LPYRDRR++NI+DY LI+ IC+YLKLP+NS TE+RL  WK R GKG  LS   
Sbjct: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129

Query: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196
           V EI KR++EP  K  ITID +N  LD L+ +R + GRGFK L  S  F  C+ENMSF+E
Sbjct: 130 VEEIAKRRAEPSSK-AITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVE 188

Query: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256
           L++FFDI+LKNRVIGGQEHK LN WHPDAQDYLSV+SDL+ VT++L+DP++RL+++DL I
Sbjct: 189 LKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSI 248

Query: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316
             GFAFAPQLAKK+++SYEKIC  L +DF++EEKMDGERIQ+HY +YGE +KFFSRRG D
Sbjct: 249 KVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGID 308

Query: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376
           YTYLYG S+  G I +HL+    VK+C+LDGEM+T+D  + +ILPFGLVK SA+  L+ +
Sbjct: 309 YTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFN 368

Query: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436
            I N  + PL+MVFDL+++NGTSL  +PL+ RK+YLN I +P  +I+E++ S   +  +S
Sbjct: 369 SINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVES 428

Query: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
           I+KSLE+AIS+GSEG+VLK Y+S Y VASRN++WIKVKPEYLE+FGEN+DLIVIGRD GK
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSGK 488

Query: 497 KDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGLSQE 556
           KDS M GL V++E+E                          R + K +SFC IANG+SQE
Sbjct: 489 KDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQ-NSRRRVKKILSFCSIANGISQE 547

Query: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616
           EFK+IDRKTRG W R+ E+ PP ++L+FG+++P EWIDP +S+V+E+K+RS+D  E+N +
Sbjct: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607

Query: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRN-GSDQVIHGVKRQKKNRR 675
           K+AT CTLYGGYC+ IR DK+W  CYTL++   ++ VKS  +  +++   G+ R+K  R+
Sbjct: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKK--RK 665

Query: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735
           + ++  S  +    L  +  F  L FYV+SD   +  G RI +  + K I E GG LI+N
Sbjct: 666 RVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGKLIYN 725

Query: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795
           +I K+    ++R+IS K T EC ALI+RGYD+++P W++DC+  K L+ +EP YCFNVS 
Sbjct: 726 VILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCFNVSQ 785

Query: 796 ELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADEELIKIPLFLFQ 855
           +++ + EKRVD  GDS+E  I             +L  +  L     D E+ + PLFLF 
Sbjct: 786 KMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEI---DSEVRRFPLFLFS 842

Query: 856 DRIMLFPNTE-SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGN----XXXXXXXXXXX 910
           +RI   P  + S     ++ KIKL+GGK+T     CNLII+P  +               
Sbjct: 843 NRIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNEVHEKI 902

Query: 911 XKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
            + I  S  +P I  +V P W++ SI EN QVPEED+PV+
Sbjct: 903 KEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/953 (50%), Positives = 653/953 (68%), Gaps = 37/953 (3%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NFSPSP F+WLCDELFVKL+ IQ +    N  KP  + YY++IN+FI +WR+TVGNDI
Sbjct: 31  PHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGNDI 90

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           +PALIL +PYRDRR++NI++  LI+ +C YLKLP+NS TE+RL+ WK RA + V+LS FC
Sbjct: 91  YPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLSTFC 150

Query: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196
           V EIKKRK EP++KI+ITID+LNECLD L  ER  KG   +K+++S TFKFC ENM+++E
Sbjct: 151 VEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMTYVE 210

Query: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256
           L++FFDILLK++++GG EHKFLN WHPDAQDYLSVVSDL+ V+++LW+PE RL+ +DL I
Sbjct: 211 LKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDLTI 270

Query: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316
           N   AF P+ AK+L+ SY+ I  +LKNDF IEEKMDGERIQLHY +YG KLKF SRRG D
Sbjct: 271 NIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLD 330

Query: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376
           Y+YLYG++ ++G IG++L  +KDVK+CILDGEM+TYD  +N ILPFGLVKSSA   L+  
Sbjct: 331 YSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVS 390

Query: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436
            I  +GY PL+M FDL+++NG+SL+ +PL+ RK YL+ +  P P  +E+L + H  +   
Sbjct: 391 DIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSL 450

Query: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
           I+ SLE AI +GSEGI+LKR+DS+Y VA R+DDWIK+KPEYLEQFGENMDLIVIGRDPGK
Sbjct: 451 IKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGRDPGK 510

Query: 497 KDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTI-----HKFVSFCVIAN 551
           KDSLMCGL +  ++E                     P +   +       K +SFC IAN
Sbjct: 511 KDSLMCGLILTGDNEPEEITSLDSN-----------PTDTAESFLKPDKRKIISFCNIAN 559

Query: 552 GLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAA 611
           G+SQ+EF+ IDR T G W + D+  PP  L +FGT+ PIEWI P+ SVV+E+KARS++  
Sbjct: 560 GISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETN 619

Query: 612 ESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSR--RNGSDQVIHGVKR 669
           ES   K+ TG TL+GGYCR IR DKDW +C+T +EF+ ++N+K+       ++ + G K+
Sbjct: 620 ESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKK 679

Query: 670 QKKNRRKYILDQSLEE-EGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEG 728
           + K R    L +  E  +    ++   FR L+FYVISD  D+  G+R+ K  +   + E 
Sbjct: 680 RPKKRMFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEH 739

Query: 729 GGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPK 788
            G L+HN IS+      LRIIS K T E ++LIERGYD+I+PQWI+DC+ ++ L++L P 
Sbjct: 740 NGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPS 799

Query: 789 YCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYAD----- 843
           +CFNVS+ L ++T+ RVD +GDSYE  +              L+  Q L +  AD     
Sbjct: 800 HCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEI-------LINRQVLKSESADKRITE 852

Query: 844 -EELIKIPLFLFQDRIMLFPNT-ESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXX 901
            E  +KIP+ LF +R    P T  S  I  L+ K++LYGGKL   I  CN+I+  N +  
Sbjct: 853 GENHLKIPILLFCNRRFFIPETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTHTE 912

Query: 902 XXXXXXXXXXKNIM----NSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                     + ++    NS +VP +P IV+  WI+  I E  QVPEEDYP +
Sbjct: 913 NRKEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/943 (49%), Positives = 650/943 (68%), Gaps = 13/943 (1%)

Query: 14  VMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVG 73
           V  P NF+PSP F+WLC+ELF K++++Q K      GK  + +YYEV+++F+ +WRKTVG
Sbjct: 8   VPEPQNFAPSPDFKWLCEELFSKIDEVQVK-GTIGTGKSRSFKYYEVLSNFVEMWRKTVG 66

Query: 74  NDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLS 133
           N+I+PALIL LPYRDRR++NI+DY LI+ IC+YLKLP+NS TE RL  WK R GKG  LS
Sbjct: 67  NNIYPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLS 126

Query: 134 QFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMS 193
              V EI KR+SEP  K  ITID +N  LD+L+++R++ GRGFK L  S  F  CLE+MS
Sbjct: 127 SLLVEEIAKRRSEPNGK-AITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMS 185

Query: 194 FIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNND 253
           F+EL++FFDILLK+RVIGGQEHKFL+ WHPDAQDYLSVVSDL+ V ++L+DP +RL+N+D
Sbjct: 186 FVELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDD 245

Query: 254 LVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRR 313
           L I  GFAFAPQLAKK+++ YEKIC  L NDF++EEKMDGERIQ+HY +YG+ ++F+SRR
Sbjct: 246 LTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRR 305

Query: 314 GTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML 373
           G DYTYLYG S+  G I  HL    +V++C+LDGEM+T+D  + +ILPFGLVK SA+  L
Sbjct: 306 GIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDAL 365

Query: 374 TKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
           + + I N  + PL++VFDL+++NGTSL  +PL+ RKEYL  I TP  +++E++ +   +N
Sbjct: 366 SFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425

Query: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493
            +SI+KSLE+AIS+GSEG+VLK Y+S Y VASRN++WIKVKPEYLE+FGEN+DL++IGRD
Sbjct: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRD 485

Query: 494 PGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGL 553
           PGKKDS M GL ++ E E                        Q++ + K +SFC +ANG+
Sbjct: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKK-VKKILSFCSVANGI 544

Query: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613
           SQEEFK+IDRKTRG W ++ E+ PP ++ +FG+++P EWI+P +S+V+E+K+RS+D  E+
Sbjct: 545 SQEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTET 604

Query: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQKKN 673
           N +K+AT CTLYGGYC+ IR DKDW  C+TL+E   +++ +   +   +  H +K  +K 
Sbjct: 605 NMQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSH-LKLVRKK 663

Query: 674 RRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLI 733
           RR+ +   + +++   +  +  F  LYFYV+SD   +    RI +  +   I   GG LI
Sbjct: 664 RREVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLI 723

Query: 734 HNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNV 793
           +NII K+    ++R+IS K T EC ALI RGYD+++P W++DCV  K L+ +EP YCFNV
Sbjct: 724 YNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNV 783

Query: 794 STELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADEELIKIPLFL 853
           S +++ + EKRVD  GDS+E  I             NL   + +     D E+   PLFL
Sbjct: 784 SQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEV---ERDAEVQVFPLFL 840

Query: 854 FQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXXXXXXXX 911
           F +RI+  P  +   K    L+ KI+L+GGK+T     CNL+I+P G+            
Sbjct: 841 FSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVN 900

Query: 912 KNIMNS----GEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
           + I         +P IP IV P W++ SI  N QVPEED+PV+
Sbjct: 901 EQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/951 (51%), Positives = 646/951 (67%), Gaps = 23/951 (2%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NF+PSP FQWLCDELFVK  D+ + +D +   KP+TVRYYEV+++F+ LWRKTVGN+ 
Sbjct: 9   PTNFAPSPDFQWLCDELFVKF-DLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNF 67

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           +P LIL LPYRDRR +NI+D TLIKAIC YL LP+ S TEK+LL+WK RA +  +LS FC
Sbjct: 68  YPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFC 127

Query: 137 VNEIKKRKS--EPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSF 194
           V EI+KRKS  +P  +  IT+D+LN  LD LA  ++S+G+G + LADS  FKFCLENMSF
Sbjct: 128 VAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSRTLADSSHFKFCLENMSF 187

Query: 195 IELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDL 254
           IEL++FFDILLK R+IGG EHK LNAWHPDA DY SVVSDL +VT +L++P +RL+N DL
Sbjct: 188 IELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDL 247

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
            +  G AFAP LAK+L+ISYEKI  KL +DF IEEKMDGERIQ+HY DYG ++KF SRRG
Sbjct: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
           TDYTYLYG     G I  +LKLN++VK+CILDGEM+TYD+ + MILPFGLVKSSA++ L+
Sbjct: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367

Query: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434
           K+ I N  Y PLFM FDL+++NGTSL ++PL  RK+YL+ I T     ++++S     N 
Sbjct: 368 KESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCNNL 427

Query: 435 DSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDP 494
           +SI KSL  AIS+GSEGI+LK+ +SRY VASRND WIK+KP+YL+QFGENMDLI+IGRDP
Sbjct: 428 ESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGRDP 487

Query: 495 GKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAP-VEQERTIHKFVSFCVIANGL 553
           GKKD+ MC L V  +D +                    P   +   I KFVSFC IANG+
Sbjct: 488 GKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTIANGI 547

Query: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613
           S  EFK+ID+KTRGLW R D++ PP   LQFGT+ P+EWIDPK+S+V+EVK+RS+D  ES
Sbjct: 548 SNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLDNTES 607

Query: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVK-SRRNGSDQVIHGVKRQKK 672
           N +K+  G TL+GGYCR +R DKDW TCYT+SEF R +  K  + N  + +    K +KK
Sbjct: 608 NVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSNKGRKK 667

Query: 673 NRRKYILD-----QSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQE 727
                IL      +    EG   +++  F+NL+F V+SD  D   G RI++  + + I +
Sbjct: 668 RNTTSILGVISPRKKRTPEG---EHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLIID 724

Query: 728 GGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEP 787
            GG +I+N+++K+     LRII      EC+ALI+RGYD+++P W++DC++S  LLKLE 
Sbjct: 725 YGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKLER 784

Query: 788 KYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADEELI 847
            +CFNVS EL +L+  RVD + DS+E  I             + +          D EL 
Sbjct: 785 NHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFELR 844

Query: 848 KIPLFLFQDRIMLFPNTE--SKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXX 905
            +P  LF DR +    T+   +  + +  + KL+GG++T  I  CNLII+PN +      
Sbjct: 845 GLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDEDKIQ 904

Query: 906 XXXXXXKNI------MNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                   +      +NS E   IP IV+  W+ +SI+EN QVPEE+Y V+
Sbjct: 905 VLQKIRGKLASMIQKLNSTE--RIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/953 (49%), Positives = 655/953 (68%), Gaps = 18/953 (1%)

Query: 7   LSQEPPPVMTPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIA 66
           ++  P  +  P NF+PSP F+WLC+ELFV++++++        GK  + +YYE+I++F+ 
Sbjct: 1   MTPAPEFIPEPQNFAPSPDFKWLCEELFVRIDNVRIN-GTAGTGKSASFKYYEIISNFVE 59

Query: 67  LWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARA 126
            WRK VGN+I+PAL+L LPYRDRR++NI+DY LI+ IC+YLKLPRNS TE+RL SWK R 
Sbjct: 60  SWRKGVGNNIYPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRV 119

Query: 127 GKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFK 186
            +   LS   V EI KR+ EP  K  ITID +N+ LD+L++ER+  GRGFK L +S  F 
Sbjct: 120 SRARNLSSLLVEEIAKRRPEPNGK-SITIDGVNDYLDELSKERSISGRGFKDLVNSKPFL 178

Query: 187 FCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPE 246
            CLE+MSF+EL++FFDI+LKNRVIGGQEH+FLN WHPDAQDYLSVVSDL+ VT++L+DP 
Sbjct: 179 SCLESMSFVELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPR 238

Query: 247 IRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEK 306
           +RL+N+DL I  GFAFAPQLAKK+S+ YEKIC  L NDF+IEEKMDGERIQ+HY +YG+ 
Sbjct: 239 VRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKS 298

Query: 307 LKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVK 366
           +KFFSRRG DYTYLYG S+  G I ++LKL   VK+C+LDGEM+T+D T+ +ILPFGLVK
Sbjct: 299 IKFFSRRGIDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVK 358

Query: 367 SSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELL 426
            SA+ +L+   I N  ++PL+MVFDL+++N  SLA +PL+ RK+YL+ I TP  +++E++
Sbjct: 359 GSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIV 418

Query: 427 SSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMD 486
            S   ++  S++ SLE+AIS+GSEG+VLK Y+S Y +ASRN +WIKVKPEYLE+FGEN+D
Sbjct: 419 QSTRCYDVQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLD 478

Query: 487 LIVIGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPV-EQERTIHKFVS 545
           LI+IGRD GKKDS M GL V++E E                      V   ++ + K +S
Sbjct: 479 LIIIGRDSGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLS 538

Query: 546 FCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKA 605
           FC +ANG+S EEFK+I+R+TRG W R+ +  PP ++LQFG+R+P EWI+P  S+V+E+K+
Sbjct: 539 FCSVANGISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKS 597

Query: 606 RSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIH 665
           RS+D  E++ R++AT CTLYGGYCR IR DKDW  CYTL++    + +KS+ N  D+   
Sbjct: 598 RSLDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQ 657

Query: 666 GVKRQKKNRRKYILD--QSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYK 723
                KK +R  I D    + E+  +   ++ F  L+FYV+SD      G RI +  +  
Sbjct: 658 LQLAHKKRKRALISDPFHQIREQKLI---SSIFAGLFFYVLSDYVTKDTGVRITRAGLED 714

Query: 724 YIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLL 783
            I + GG LIHN+I K+    ++R+IS K T EC  LI+RGYD+++P W++DC+  K L+
Sbjct: 715 AIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774

Query: 784 KLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYAD 843
            +EP YCF+VS +L+++ EKRVD  GDS+E  I             +L  +  +     D
Sbjct: 775 FIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGI---D 831

Query: 844 EELIKIPLFLFQDRIMLFPNTES--KTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXX 901
            E   IPLFLF +RI+  P T++  +    L+ KI+L+GG++T     CNLII+P  +  
Sbjct: 832 SEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSS 891

Query: 902 XXXXXXXXXXKNIMN----SGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                     + I      S  VP +  IV+P W++ SI EN QVPEED+PV+
Sbjct: 892 RRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/935 (50%), Positives = 641/935 (68%), Gaps = 21/935 (2%)

Query: 19  NFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDIFP 78
           NF+PSP F WLC++LF K++ +Q +R    + KPVT RYYEVI++F  LWR TVGN+I+P
Sbjct: 24  NFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTLWRTTVGNNIYP 83

Query: 79  ALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFCVN 138
           AL LILPYRDRR+FNI+DYTLIKAICA+LKLP++S TEK+L++WK  AG+ V+LS+FCV 
Sbjct: 84  ALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAGRSVRLSKFCVE 143

Query: 139 EIKKRKSEPK-DKIE-ITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFIE 196
           EIKKR+SEP+ D+ E ITID LN  LD+LA ER  +GR FK LA+S     CL +M+F+E
Sbjct: 144 EIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFKNLANSDIMNKCLTSMTFLE 203

Query: 197 LQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVI 256
           +Q+FFDILLKNR +GG EHK LN WHPDAQDYLSVVSDL TV  RLWDP  RL N DL I
Sbjct: 204 MQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWDPSQRLGNQDLKI 263

Query: 257 NPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTD 316
           N G AFAPQLA KL +SY+KI  KL  DF IEEKMDGERIQ+HY ++G  +KF+SRR TD
Sbjct: 264 NIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATD 323

Query: 317 YTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD 376
           YTYLYG ++  G +   + LNK+VKDC+LD E++T+D    ++LPFG+VKSSA++ML++D
Sbjct: 324 YTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQD 383

Query: 377 GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDS 436
           GI  +G+ PL MVFD++++NG +L ++P   R+EYL  I TP  H IE++ S    +E  
Sbjct: 384 GIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQM 443

Query: 437 IRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
           I+KSLE A+S+GSEGI+LKRYDSRY +ASR+DDWIK+KPEYLEQFGENMDL+++GRDP K
Sbjct: 444 IKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLMGRDPSK 503

Query: 497 KDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGLSQE 556
           KDSLM GL   EE                      +  E  +    FVS C+IANG+S E
Sbjct: 504 KDSLMLGLLDYEE----------VIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNE 553

Query: 557 EFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAESNGR 616
           E+K+IDRKT+GLWN S++IPP +  ++FG+++P +WIDPKKS+++E+KARS+D   S+ R
Sbjct: 554 EYKEIDRKTKGLWNDSEKIPPLE-YMKFGSKVPRQWIDPKKSLILEIKARSLDNTRSSER 612

Query: 617 KFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKS-RRNGSDQVIHGVKRQKKNRR 675
           KFA GCTL+GGYCR IREDK+W+TCYTL EF R K+  + R+ GS +    + ++++   
Sbjct: 613 KFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVISKKRRYNI 672

Query: 676 KYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHN 735
              ++++LE+   L   +  F  +YFYV+SD FD V   RI+K  + K I   GG L+ N
Sbjct: 673 ISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIVANGGQLVQN 732

Query: 736 IISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVST 795
           +I++ +   +LRIIS + T EC++LI RGYD+I+P+W+ DC+ S  ++KLEP +CFN S 
Sbjct: 733 VITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLEPSHCFNFSK 792

Query: 796 ELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADEELIKIPLFLFQ 855
           +L     KR+D +GD YE  I                  Q     + D  L+ +P FLF 
Sbjct: 793 QLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKICTTAKQQPDVQF-DNSLMDVPHFLFH 851

Query: 856 DRI--MLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNG-NXXXXXXXXXXXXK 912
            RI  +L  N   +  SF+   +  YGGK+T ++   NL+I+                  
Sbjct: 852 GRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRRINDIRKQISS 908

Query: 913 NIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDY 947
            ++     P IP +V+  W+   I++N+QV E++Y
Sbjct: 909 EVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/960 (50%), Positives = 640/960 (66%), Gaps = 36/960 (3%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIG-KPVTVRYYEVINHFIALWRKTVGND 75
           P NFSPSP F+WLC+ELFVKL++++ K  PK++  +P  ++Y  VIN+FI LWR TVGND
Sbjct: 16  PRNFSPSPDFKWLCNELFVKLDEVRLK--PKSVDTRPKNIQYDIVINNFIHLWRVTVGND 73

Query: 76  IFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQF 135
           I+PAL LILPYRDRR + IR++TLI+ +C YLKL +NS TE+RL  WK +A + + LS F
Sbjct: 74  IYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLSSF 133

Query: 136 CVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSK----GRGFKKLADSPTFKFCLEN 191
           C+ EIKKR SEP  K +ITID+LN  LD L+ ER+S     G   KKL+   + K+C EN
Sbjct: 134 CIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCFEN 193

Query: 192 MSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQN 251
           MSFIEL++FFDIL+K R+IGG EHKFLNAWHPDA DYLSVVS+L  VT +LW+P  RL +
Sbjct: 194 MSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRLNS 253

Query: 252 NDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFS 311
            DL I    AF PQLAKK+++SYE +  ++ N F IEEKMDGERIQ+HY DYG ++K+FS
Sbjct: 254 KDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFS 313

Query: 312 RRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARS 371
           RRG DYTYLYG+      I K+L+LN+DVK+CILDGEM++YDK++N ILPFG+VKS A +
Sbjct: 314 RRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAAN 373

Query: 372 MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHR 431
            L  DG+ N+   PLF+VFD++F+NG+ L N+PL  RKEYL+ I TP+   IE+L     
Sbjct: 374 SLKIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIA 433

Query: 432 FNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
            + +SIR +L+ AIS+GSEGIVLK+YDS Y+V  RN+DWIKVKPEYLEQFGEN+DLIVIG
Sbjct: 434 HDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIG 493

Query: 492 RDPGKKDSLMCGLAVVEEDE-------KAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFV 544
           RDPGKKDSLMCG+AV+E +E       +                    P+  +R I KF+
Sbjct: 494 RDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKR-ITKFI 552

Query: 545 SFCVIANGLSQEEFKQIDRKTRGLWNR-SDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEV 603
           SFCVIANG+S EEFK+IDRKT G W + SDE PP D  L+FGTRLP+EWI+P  SVV+EV
Sbjct: 553 SFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTD-YLEFGTRLPVEWINPHDSVVLEV 611

Query: 604 KARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSD-- 661
           KARS++  E+   KF TG TLYG YCR IR DKD+  CYT S+ +   N K  R+ S+  
Sbjct: 612 KARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYTFSDLVIATNKK--RSSSELY 669

Query: 662 -QVIHGVKRQKKNRRKYILDQSL---EEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIE 717
               H  K++ +  +  +L+Q+L   +++ G    +  F  L F+VISD  D     R+ 
Sbjct: 670 GNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGF--TSKIFDGLSFFVISDYVDSNSSFRLR 727

Query: 718 KERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCV 777
            + +   I+  GG LI N++S+    + +RI+S K T EC+ LI+RGYD+I+P+WI+DC+
Sbjct: 728 IDELINIIKVNGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWILDCI 787

Query: 778 QSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGL 837
            +  LL  EP +CFNVS  L  ++++RVD  GDSY+  I                + Q  
Sbjct: 788 ANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELLISSKT--PKEQLY 845

Query: 838 VTPYA-DEELIKIPLFLFQDRIMLFPNT--ESKTISFLQEKIKLYGGKLTTDIGKCNLII 894
             P   D+++ KIP+FLF ++    P      K +      IKLYGG    +I  CN+II
Sbjct: 846 SNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCNVII 905

Query: 895 LPNGNXXXXXXXXXXXXKNI----MNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
           + + +            K +    ++S  V  IP IV+  WIE+SI + +QV EED+P+I
Sbjct: 906 IGDEHSKSSNEKISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEEDFPII 965

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/962 (47%), Positives = 636/962 (66%), Gaps = 44/962 (4%)

Query: 7   LSQEPPPVMT--PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHF 64
           L+Q+P  V    P NF+PSP F+WLCDELF KLE+I   R  + +GK VTV+  EVI +F
Sbjct: 24  LAQQPGEVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDR--QKLGKAVTVKRVEVIMYF 81

Query: 65  IALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKA 124
           I LWR TVG++I+P L LILPYRD R +NI+DYTL+KA+C  L LP++S TEKRLL+WK 
Sbjct: 82  IKLWRTTVGDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQ 141

Query: 125 RAGKGVKLSQFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPT 184
            A +G  LS+FCV EI KR+ EP+    +TID LN+CLD+L++E ++K  GF  L+ SP+
Sbjct: 142 YAPRGTSLSKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPS 201

Query: 185 FKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWD 244
           F+ CL+NMSF E ++FFDI+LK RVIGG EHKFLN WHPDAQDYL VVSDL+ ++  LW+
Sbjct: 202 FQNCLQNMSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWN 261

Query: 245 PEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYG 304
           P +RL  N+L IN G AFAP LAK+L +SYE++C KLK DFIIEEKMDGERIQLHY + G
Sbjct: 262 PTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERG 321

Query: 305 EKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGL 364
            K++F SRRGTD+T+LYG+S+  G I +HLK   DV+DC+LDGEM+++DK +N++LPFG+
Sbjct: 322 AKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGI 381

Query: 365 VKSSARS--MLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHI 422
           VKS+A    M +   +  +GY+PL+M+FDL+++NG SL  +PL++RK YL  I +P  +I
Sbjct: 382 VKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANI 441

Query: 423 IELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFG 482
           +E+LS       ++I+ SLE AI MGSEGI+LK++ S Y + +RND WIK+KPEY E+ G
Sbjct: 442 VEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELG 501

Query: 483 ENMDLIVIGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHK 542
           E MDL+VIGRDPGKKDSLMCGL + +E + +                   P+  ++   K
Sbjct: 502 ETMDLVVIGRDPGKKDSLMCGLILADETDGSSVNLASQDD----------PLRPKQRNPK 551

Query: 543 FVSFCVIANGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIE 602
            +SFC IANG+S  EFK+I+RKTRGLWN +   PPP  LL+FGT+LP EWIDP+ S+V+E
Sbjct: 552 VISFCNIANGVSDAEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLE 611

Query: 603 VKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNG--- 659
           VKARS+D  E + +K+ TG TL G YCR +R +KDW TC T+ ++ + K   +   G   
Sbjct: 612 VKARSVDTDELSSKKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRK 671

Query: 660 SDQVIHGVKRQKKNRRK---YILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRI 716
           S Q+    +R+  N  +    + D S E     +  +  F+ L FY++SD  D     R 
Sbjct: 672 SHQISPRKQRKLANVSELYPLLADDSRES----IFESNIFQGLQFYILSDYIDSQ-KKRY 726

Query: 717 EKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC 776
           EK+++   +++  G ++HN   ++     LRIISGK T EC +L E+GYD+I+P WI DC
Sbjct: 727 EKDQIGTLVRKNSGHVLHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDC 786

Query: 777 VQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQG 836
           +   SL+KLEP++CF  S +L + + +RVD FGDS+  P+              LV  Q 
Sbjct: 787 LNYGSLVKLEPRHCFRTSRKLLENSRQRVDRFGDSFCRPL-------SYTEFDELVNGQS 839

Query: 837 LVTPY--ADEELIKIPLFLFQDRIMLFP--NTESKTISFLQEKIKLYGGKLTTDIGKCNL 892
           +V+P+  A EEL  IPLFLFQ+  + F     +     +L++ ++L+GG+ +  +  CNL
Sbjct: 840 VVSPHLSAPEELDGIPLFLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNL 899

Query: 893 IIL-----PNGNXXXXXXXXXXXXKNIMNSGEVPT-IPYIVNPLWIERSIEENSQVPEED 946
           +++                      +   S EV   IP++V+  W+E  I E   VPEED
Sbjct: 900 VVVRVSFKEQKKLFKLVEGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEED 959

Query: 947 YP 948
           +P
Sbjct: 960 FP 961

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/983 (47%), Positives = 632/983 (64%), Gaps = 58/983 (5%)

Query: 5   IQLSQEPPPVMTPCNFSPSPAFQWLCDELFVKL----EDIQSKRDPKNIGKPVTVRYYEV 60
           +  + +  P  TP NF+PSP F+WLCDELFVK+    E I++K       KP++ RY++ 
Sbjct: 11  VSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDT 70

Query: 61  INHFIALWRKTVGNDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLL 120
           I HFI LWR T+G+DIFPAL LILPYRDRR++NI+D TLI+AIC+YLKLP+NS  E+RL+
Sbjct: 71  ITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLI 130

Query: 121 SWKARAGKGVKLSQFCVNEIKKRKSEPK-DKIE-ITIDRLNECLDKLAEER---NSKGRG 175
            WK +A +   L+ FC++EI KRK+EP+  ++E I+ID+LNE LD L   R   N+K R 
Sbjct: 131 RWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRS 190

Query: 176 FKKLADSPTFKFCLENMSFIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDL 235
              L    TFKFCLENM+FIEL++FFDI++KN+++G  E+ FL  WHPD+++YLSVVSDL
Sbjct: 191 --NLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDL 248

Query: 236 RTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGER 295
           RT++ +LW+P I++ N+DL I  G+ FAPQLAK+L +SY+ I  +L NDF IEEKMDGER
Sbjct: 249 RTLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGER 308

Query: 296 IQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKT 355
           IQLHY +YGE +KFFSR GTDYTYLYG     G I K L+L+K+VK+C+LDGEM+T+D T
Sbjct: 309 IQLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDST 368

Query: 356 QNMILPFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGI 415
              +LPFGLVKSSA S L K  I N+ + PLFMVFD++++NG+SL ++PL  RKE+LN +
Sbjct: 369 SKKVLPFGLVKSSASSQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTV 428

Query: 416 FTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKP 475
            TP    +E+LSS    +   I+K L+ AIS+GSEGIVLK+Y S+Y   +R+++WIKVKP
Sbjct: 429 LTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKP 488

Query: 476 EYLEQFGENMDLIVIGRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVE 535
           EYLE+FGENMDLIVIGRD GKKD L+CG+ V EE ++                     ++
Sbjct: 489 EYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLD 548

Query: 536 QE--RTIHKFVSFCVIANGLSQEEFKQIDRKTRGLW-NRSDEIPPPDTLLQFGTRLPIEW 592
            +  + I K +SFC IANGLSQ E K+I+R TRG W N ++E PP D +L+FGT+ P+EW
Sbjct: 549 TKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPID-VLEFGTKKPVEW 607

Query: 593 IDPKKSVVIEVKARSIDAAESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKN 652
           I P+ SVV+E+KARS+D  +    K+ATGCTLYGGYCR IR+DKDW +CYTL        
Sbjct: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTL-------- 659

Query: 653 VKSRRNGSDQVIHGVKR-QKKNRRKYILDQSLEEE-------GGLLKN-------TAFFR 697
                   D   + +KR +KKN+ K  L +S   +        G+L N       +  F 
Sbjct: 660 -------HDLTYNEIKRHEKKNKNKQTLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFH 712

Query: 698 NLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNEC 757
            LYFY+ISD   D    RI++E +   I + GG +I+N+I+K +    LRI+S K T EC
Sbjct: 713 GLYFYIISDYIPDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIEC 772

Query: 758 SALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPIX 817
           + L+ RGYDVIN  W+ DC+Q+  +L LEP +C  VS EL  +   R+D FGDSYE  + 
Sbjct: 773 TDLVRRGYDVINLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLI 832

Query: 818 XXXXXXXXXXXXNLVRV--QGLVTPYADEELIKIPLFLFQDRIMLFPNT-----ESKTIS 870
                       N V      L+    DE +  IP+FLF +R            +  T+ 
Sbjct: 833 DSKLLKLLDSNINKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLI 892

Query: 871 FLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXX---XXXXXXKNIMNSGEVPTIPYIV 927
           F   +IKLYGG L T +  CN+I+   G+               K  +++     IP  V
Sbjct: 893 F---QIKLYGGSLVTKLEDCNIIVGVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAV 949

Query: 928 NPLWIERSIEENSQVPEEDYPVI 950
           N  WI  SI+   Q+  EDYP++
Sbjct: 950 NVSWITESIKAGYQLSPEDYPIL 972

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/949 (45%), Positives = 605/949 (63%), Gaps = 33/949 (3%)

Query: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76
           P NF+PSP F+WLC+ELF +L+ I   R  + +GK VTV+  E+I  FI LWR TVG+D 
Sbjct: 21  PHNFAPSPDFRWLCEELFHRLDAINEHR--QELGKAVTVKRVEIITCFIKLWRTTVGDDF 78

Query: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136
           FPAL L+ PYRD R ++I+D+TLIKA+C  L L R+S TE+RLL+WK  AG+G  LS+FC
Sbjct: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138

Query: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSK-GRGFKKLADSPTFKFCLENMSFI 195
           V EI KR+ EP  + ++TID LNE LD+LA+E + K   G   L++S +F+FCL+N+SF+
Sbjct: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198

Query: 196 ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV 255
           EL++FFDI+LKNRVIGG EHKFL  WHPDAQ YL VV+DL+ ++ +LW+P +RL   DL 
Sbjct: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315
           IN G AFAP LAK+L +SYE+IC KLK+DFI+EEKMDGERIQLHY + G  LKF SRRG 
Sbjct: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318

Query: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375
           D+++LYG+ +  G I ++LKL  DV+DC+LDGEM++YDK + +ILPFG+VKS+A   L  
Sbjct: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378

Query: 376 DGIMNE--GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
             + NE  GY+PL+MVFDL+++NG SL  +PL++RKEYL  I +P P ++E+L      +
Sbjct: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438

Query: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493
             +I+  ++ AI MGSEG+++K+  S Y V +RND W+K+KPEY E  GE MDL+VIGRD
Sbjct: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498

Query: 494 PGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERT---IHKFVSFCVIA 550
           PGKKDSLMCGL V + +                      P+E  +    I K VSFC +A
Sbjct: 499 PGKKDSLMCGLLVSDSEH---------------ILENFGPIEHGKEGDPIIKCVSFCNVA 543

Query: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610
           NG+S EEFK+I+RKTRG W    E PPP +LL+FG+++P+EWIDPK SVVIEVKARS++ 
Sbjct: 544 NGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVEN 603

Query: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQ 670
           +E + +++  G TL+  YCR IR DKDW TC +++++ + K   +      +V     R+
Sbjct: 604 SEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRR 663

Query: 671 KKNRRKYILDQSLEEEGGL-LKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGG 729
           K+N  +     + E +  L  + ++ F  L+FY++SD +      R E+  +   + + G
Sbjct: 664 KRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSD-YVTSQRRRYERGMVAAKVVKHG 722

Query: 730 GTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKY 789
           G ++ NI  +      LRI+SGK T EC  L+ RGYD+I+P WI DC+ +   L +EPK+
Sbjct: 723 GLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKH 782

Query: 790 CFNVSTELKKLTEKRVDTFGDSYEVPIXXXX-XXXXXXXXXNLVRVQGLVTPYADEELIK 848
           CF  S  L   + +RVD +GDS+  P+              +       ++    ++L +
Sbjct: 783 CFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDLDE 842

Query: 849 IPLFLFQ--DRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNGNXXXXXXX 906
            PLFL Q     +L  +   +  S L+ KI+LYGG ++  +   NL+++P+         
Sbjct: 843 APLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAY 902

Query: 907 XXXXXK-----NIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                +     N         IP+IV   W++    E   VPEED+  I
Sbjct: 903 YVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/952 (45%), Positives = 583/952 (61%), Gaps = 61/952 (6%)

Query: 15  MTPC-NFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVG 73
           M  C NFSPSP F+WLCDEL  K+ +  SK+    IGKPVTVRY E+I +FI LWR TVG
Sbjct: 1   MNDCENFSPSPEFKWLCDELLGKIYETSSKKHL--IGKPVTVRYLEIITNFIKLWRSTVG 58

Query: 74  NDIFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLS 133
           N I+PAL LI+P+RDRR++N+++ TLIKA+C YL+LP++S TE RLL WK RA +GVKLS
Sbjct: 59  NYIYPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLS 118

Query: 134 QFCVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMS 193
            FCV EI+KR+ + +    ITID LN  LD++++E N K  G+  L DS  F +CL +M+
Sbjct: 119 DFCVEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMT 178

Query: 194 FIELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNND 253
           F+E++FFFDI+LK RV+ G E+ FL AWHPDA DYLSVVSDL  ++ RL++P  RL+  D
Sbjct: 179 FMEMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTD 238

Query: 254 LVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRR 313
           L I    AF PQLAK+  +SYE++  KL++DFIIEEKMDGER+Q+HY +YGE++K+ SRR
Sbjct: 239 LSITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRR 298

Query: 314 GTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML 373
           G D++YLYGE+   G I   LKL+ +VKDCILDGEMITYD  ++++LPFGLVKSSA + +
Sbjct: 299 GVDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQI 358

Query: 374 TKD--GIM-NEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYH 430
             +  GI   E Y+PLF+ FDL+++NG SL N+ L  RK+YL  I TP    +E++    
Sbjct: 359 QSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMK 418

Query: 431 RFNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490
             N ++I+ SLE AISMGSEGIVLK   S+Y V SRN DWIK+KPEYLEQFGENMDL++I
Sbjct: 419 AINAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII 478

Query: 491 GRDPGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIA 550
           GR+ GKKDS  CGL++ + +E A                     E+ R    F+SFC IA
Sbjct: 479 GREQGKKDSFFCGLSISDPNEVA---------------------EKPR----FISFCTIA 513

Query: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610
           NGLS EEFK I+RKT G W+   E PP   LL FGT++P EWI P+ SVV+EVKAR+ID 
Sbjct: 514 NGLSNEEFKDIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDT 573

Query: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRN--GSDQVIHGVK 668
            ES  RK+ +GCTL+ GYC+ IR DKDW+T  + SEF   K+ ++  N   S QV  G K
Sbjct: 574 KESEKRKYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKK 633

Query: 669 RQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEG 728
           R  K  +  I++ S E    +   +  F N  F VISD FD     RI +E +   I E 
Sbjct: 634 RASKRAKIGIVNSS-EPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEH 692

Query: 729 GGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPK 788
           GG +++          NL II  KLT EC  L+     +I P WI  C++         K
Sbjct: 693 GGEIVYTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGY------K 746

Query: 789 YCFNVSTELKKLTEKRVDT---FGDSYEVPIXXXXXXXXXXXXXNLVRVQGLVTPYADEE 845
             F  S   +   E  +D    + D     +                  +G+  P +D  
Sbjct: 747 TPFTESDIFRGELESSMDCSQFYTDFNTASLNHLLETAN----------RGIKNPDSDLL 796

Query: 846 LIKIPLFLFQDRIMLFPNTES---KTISFLQEKIKLYGGKLTTDIGKCNLIILPN---GN 899
           L ++PLFLF +  +   N+E+    +I  ++  IK +GG+L   I   ++II+ N     
Sbjct: 797 LPEVPLFLFSNLKLAVLNSENVLDTSILEVEFAIKCHGGEL-VHIENASIIIVFNDFISR 855

Query: 900 XXXXXXXXXXXXKNIMNSGE-VPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                       K +  S E  P IP +V+  W   SI++N     E Y  +
Sbjct: 856 EDLFSLRQKIASKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/944 (43%), Positives = 565/944 (59%), Gaps = 21/944 (2%)

Query: 16  TPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGND 75
           +P NFSPSP F WLCDELF+KLE++  K+  K++GKP  VR  E+ ++F++LWRKTVGND
Sbjct: 50  SPINFSPSPDFCWLCDELFIKLEEVALKK--KDLGKPRKVRNLEITSNFVSLWRKTVGND 107

Query: 76  IFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQF 135
           I+PAL+L LPY DRR + ++D TL+KA+C ++KLPRNS TE+RLL WK  A +GVKLS F
Sbjct: 108 IYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTF 167

Query: 136 CVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFI 195
           CV E++KR+ EP     ++ID +N  LDKL  E N     +  LA+SP F +CLE+MS++
Sbjct: 168 CVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYV 227

Query: 196 ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV 255
           EL+FFFDI+LK  ++ G E   L+ WHPDA+ Y  VVSDLR V   L+DP  RL+ NDL 
Sbjct: 228 ELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLS 287

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315
           +  G+AFAP +A+++ I YEK+  KL NDF +EEKMDG+RIQ+HY DYG  + +FSR G 
Sbjct: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347

Query: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT- 374
           +YTYLYGE+   G I  HLK  + VK+CILDGEM++YDK    ILPFGL KS A   +  
Sbjct: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407

Query: 375 -KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
              G     Y+PL+ VFDL+++NG  L N  +  RKEYL  I  P  +++ LLS     +
Sbjct: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467

Query: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493
            ++I  +L  A++ GSEGIVLK+  S+Y+V  R+D WIK+KPEYLE FGENMDL+VIGRD
Sbjct: 468 AEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527

Query: 494 PGKKDSLMCGLAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGL 553
            G+KDS +C LAV ++ EK                    P+  +  I KF+SFC IANG+
Sbjct: 528 KGRKDSFICALAVTDDSEK---NNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANGI 584

Query: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613
           S EEFK+IDR TRG W   DE  PP   ++FGT+ P EWIDPK SVV+EVKARSID  ES
Sbjct: 585 SNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEES 644

Query: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQK-K 672
               + TG TLY  YC+ IR DK+W T  T++E+   +  +S  N S     G  R   +
Sbjct: 645 KSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPR 704

Query: 673 NRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTL 732
            RR + L   ++          F +  YFYV S  FD      I+   + + +   GGT 
Sbjct: 705 KRRTFHLVGDIDVTKP--SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTY 762

Query: 733 IHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFN 792
           IHN+  +      L I+  K T E   LIERGYD+I+P+W++DCV+  ++L++EPKY ++
Sbjct: 763 IHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYS 821

Query: 793 VSTELKKLTEKRVDTFGDSYEVPIXXXXXXXXXXXXXNLVRVQGL----VTPYADEELIK 848
            S EL K    + D +G+SY++P+                    +    V+ Y    + K
Sbjct: 822 ASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFK 881

Query: 849 IPLFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNG--NXXXXXXX 906
             LF   D         S     ++  I+  GG++T D+    +++      +       
Sbjct: 882 GWLFYILDDYAY----HSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAV 937

Query: 907 XXXXXKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950
                  I  S +V  IP IV   W+E  +E    V E++Y  I
Sbjct: 938 RNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 123/245 (50%), Gaps = 13/245 (5%)

Query: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310
           N    + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +
Sbjct: 390 NEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIY 448

Query: 311 SRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSAR 370
           SR G + T  Y E IH   IG  +K   + K  ILD E + +DK Q  ILPF ++ +  R
Sbjct: 449 SRNGENMTERYPE-IH---IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKR 504

Query: 371 -SMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429
             +L KD  +    +     FD++  N   L N  L  R+E L+ + TP P   +  +  
Sbjct: 505 KDVLAKDVKV----RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATEL 560

Query: 430 HRFNEDSIRKSLELAISMGSEGIVLKRY---DSRYTVASRNDDWIKVKPEYLEQFGENMD 486
              N D ++K L+ +++   EG+++K     +S Y  + R+ +W+K+K +YLE  G+++D
Sbjct: 561 TTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLD 620

Query: 487 LIVIG 491
           L V+G
Sbjct: 621 LCVLG 625

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 124/250 (49%), Gaps = 9/250 (3%)

Query: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310
           +N+  + PG    P LAK      E +      +F  E K DGER Q+H    GE ++ +
Sbjct: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIY 405

Query: 311 SRRGTDYTYLYGE-SIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369
           SR G + T  Y E  I D  +      +K+V   ILD E++ +D  QN ILPF ++ +  
Sbjct: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRK 464

Query: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429
           R  +    + +   +     FD+++ NG  L    L  R++ L+ +    P   +  +S 
Sbjct: 465 RKGVE---LKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521

Query: 430 HRFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMD 486
                D I+K L+ AI    EG+++K  D   SRY  + R+ +W+K+K +YL   G+++D
Sbjct: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581

Query: 487 LIVIGRDPGK 496
           L V+G   GK
Sbjct: 582 LCVMGAYYGK 591

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 181/440 (41%), Gaps = 59/440 (13%)

Query: 211 GGQE--HKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAK 268
           GG+E     ++A     +D    V +   V     +  I       V+ PG    P LAK
Sbjct: 299 GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAK 358

Query: 269 KLSISYEKICMKLKND-FIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHD 327
             S S  ++  + +   F  E K DGER Q+H    G  ++ +SR G + T  Y E    
Sbjct: 359 P-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEINIS 416

Query: 328 GFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNEGYQPLF 387
            F+        +    ILD E + +DK +N+ILPF ++ +  R  +  + +     +   
Sbjct: 417 DFVAH----PDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK---VRVCL 469

Query: 388 MVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISM 447
             FD++  N   L N  L  R+ YL  I  P P  ++L S     + D ++  L+ ++  
Sbjct: 470 FAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKD 529

Query: 448 GSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGR--DPGKKDSLMC 502
             EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL V+G     GK+     
Sbjct: 530 CCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYG 589

Query: 503 G--LAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSFCVIANGLSQEEFKQ 560
           G  L    +D                               +F + C I  G S E  + 
Sbjct: 590 GFLLGCYNQD-----------------------------TGEFETCCKIGTGFSDEMLQN 620

Query: 561 IDRKTRGLWNRSDEIPPPDTLLQFG-TRLPIEWIDPKKSVVIEVKARSIDAA---ESNGR 616
           +  K         EIP P     +  +  P  W++P  S++ EV    +  +   ++ G 
Sbjct: 621 LYEKL-----SPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGS 673

Query: 617 KFATGCTLYGGYCRGIREDK 636
            +  G +L       IR+DK
Sbjct: 674 SYGKGISLRFPRFIRIRDDK 693

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 123/254 (48%), Gaps = 16/254 (6%)

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
            + PG    P LAK      E +      +FI E K DGER Q+H  + GE ++ +SR G
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNG 410

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKD---------VKDCILDGEMITYDKTQNMILPFGLV 365
            + T  Y E     F+     +  D         VKD ILD E++ +D  Q  ILPF ++
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 366 KSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIEL 425
            +  R  +    + +   +     FDL+++N   + N  L  R+E L  +    P   + 
Sbjct: 471 TTRKRKNV---DLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQY 527

Query: 426 LSSYHRFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFG 482
            +S    + D ++  L+ A+    EG+++K  D   S Y  + R+ +W+K+K +YL+  G
Sbjct: 528 ATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVG 587

Query: 483 ENMDLIVIGRDPGK 496
           +++DL+V+G   GK
Sbjct: 588 DSLDLVVMGAYFGK 601

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 123/270 (45%), Gaps = 13/270 (4%)

Query: 226 QDYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDF 285
           +D    V +   V     D  I   +    I PG    P LAK      E +       F
Sbjct: 324 RDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTF 383

Query: 286 IIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCIL 345
             E K DGER Q+H    G  ++ +SR G + T  Y E     F+             IL
Sbjct: 384 TSEYKYDGERAQVHLLKDG-TMRIYSRNGENMTERYPEIQIKDFLADP----ASTTSLIL 438

Query: 346 DGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNE-GYQPLFMVFDLIFMNGTSLANIP 404
           D E + +DK QN ILPF ++ +  R    KD  +NE   +     FD++  N   L N P
Sbjct: 439 DCEAVAWDKEQNKILPFQVLTTRKR----KDVNINEVKVRVCLFAFDILLHNDMRLINEP 494

Query: 405 LNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKRYD---SRY 461
           L+ R+E L+ +  P     +  +     N D ++K L+ ++    EG+++K  D   S Y
Sbjct: 495 LSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYY 554

Query: 462 TVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
             + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 555 EPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 584

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 129/275 (46%), Gaps = 13/275 (4%)

Query: 226 QDYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFAFAPQLAKKLSISYEKICMKLKND- 284
           +D    V +   V     +  I   N   V+ PG    P LAK  S S  ++  +   + 
Sbjct: 293 RDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKP-SKSITEVLDRFHGEK 351

Query: 285 FIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCI 344
           F  E K DGER Q+H    G  +  +SR G + T  Y E +H   I  +L   +     I
Sbjct: 352 FTCEYKYDGERAQVHLLPDG-SMNIYSRNGENMTERYPE-LH---IRDYLADPETTHSLI 406

Query: 345 LDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIP 404
           LD E + +D  Q  ILPF ++ +  R  +    +     +     FD++  NG SL N  
Sbjct: 407 LDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVK---VRVCLFAFDMLCYNGQSLINNS 463

Query: 405 LNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGI---VLKRYDSRY 461
           L  R+EYL  +  P     +  +  +  N + ++K LE ++    EG+   VL+  +S Y
Sbjct: 464 LLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHY 523

Query: 462 TVASRNDDWIKVKPEYLEQFGENMDLIVIGRDPGK 496
             + R+ +W+K+K +YL+  G+++DL V+G   G+
Sbjct: 524 EPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGR 558

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 13/246 (5%)

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
            + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
            + T  Y E     FI + L + K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 533 ENMTERYPEIKITDFI-QDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKR---- 584

Query: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
           KD  +N+   +     FD++  N   L N+ L  R+EYL  +    P   +  +     N
Sbjct: 585 KDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNN 644

Query: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490
            D ++K L+ +++   EG+++K  D   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 645 LDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704

Query: 491 GRDPGK 496
           G   G+
Sbjct: 705 GAYYGR 710

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 118/245 (48%), Gaps = 13/245 (5%)

Query: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKND-FIIEEKMDGERIQLHYQDYGEKLKF 309
           +   V+ PG    P LAK  S S  ++  + +   F  E K DGER Q+H    G  ++ 
Sbjct: 349 DKHCVLTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRI 406

Query: 310 FSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369
           +SR G + T  Y E     FI    + +  + DC    E + +DK +N ILPF ++ +  
Sbjct: 407 YSRNGENMTERYPEIRISDFIADPARTHTLILDC----EAVAWDKEKNTILPFQVLSTRK 462

Query: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429
           R  +  + +     +     FD++  N   L   PL  R+  L     P P  ++L S  
Sbjct: 463 RKGVAVEDVK---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEV 519

Query: 430 HRFNEDSIRKSLELAISMGSEGI---VLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMD 486
              + D ++  L+ A+    EG+   +L+  +S Y  + R+ +W+K+K +YL+  G+++D
Sbjct: 520 TTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLD 579

Query: 487 LIVIG 491
           L V+G
Sbjct: 580 LCVLG 584

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 119/241 (49%), Gaps = 13/241 (5%)

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
            + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
            + T  Y E     FI + L   K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 443 ENMTERYPEINITDFI-QDLDTTKNL---ILDCEAVAWDKDQGKILPFQVLSTRKR---- 494

Query: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
           KD  +N+   +     FD++  N   L N  L  R+EYL  +    P   +  +     N
Sbjct: 495 KDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNN 554

Query: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490
            D ++K L+ +++   EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 555 LDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 491 G 491
           G
Sbjct: 615 G 615

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 115/240 (47%), Gaps = 11/240 (4%)

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
           V+ PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR  
Sbjct: 326 VLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNS 384

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
            + T  Y E     F+       +  +  I+D E + +D  +  ILPF ++ +  R  + 
Sbjct: 385 ENMTERYPEIQFHQFLAN----PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE 440

Query: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434
              + +   +     FDL+++NG SL    L  R+++L  +    P  ++  +       
Sbjct: 441 ---LKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMEL 497

Query: 435 DSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
             ++  LE ++S   EG+++K  D   S+Y  + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 498 SELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLG 557

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 104/394 (26%), Positives = 168/394 (42%), Gaps = 57/394 (14%)

Query: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
            + PG    P LAK      E +       F  E K DGER Q+H  D G  ++ +SR G
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
            + T  Y E     FI + L   K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 443 ENMTERYPEIKITDFI-QDLDATKNL---ILDCEAVAWDKEQGKILPFQVLSTRKR---- 494

Query: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
           KD  +++   +     FD++  NG  L N  L  R+E L  +    P   +  +     N
Sbjct: 495 KDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDN 554

Query: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490
            D ++K L+ +++   EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 555 LDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 614

Query: 491 GR--DPGKKDSLMCG--LAVVEEDEKAXXXXXXXXXXXXXXXXXXAPVEQERTIHKFVSF 546
           G     GK+     G  L    +D                               +F + 
Sbjct: 615 GAYYGRGKRTGTYGGFLLGCYNQD-----------------------------TGEFETC 645

Query: 547 CVIANGLSQEEFKQI-DRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKA 605
           C I  G S E  +Q+ +R T  + +      P  T +   +  P  W +P  + + EV  
Sbjct: 646 CKIGTGFSDESLQQLHERLTPTIID-----GPKATFVFDSSAEPDVWFEP--TTLFEVLT 698

Query: 606 RSIDAA---ESNGRKFATGCTLYGGYCRGIREDK 636
             +  +   ++    FA G +L       IREDK
Sbjct: 699 ADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDK 732

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 130/278 (46%), Gaps = 30/278 (10%)

Query: 235 LRTVTTRLWDPEIRLQNNDLVIN-----------------PGFAFAPQLAKKLSISYEKI 277
           L +   R+ D   ++ N ++VIN                 PG    P LAK      E +
Sbjct: 347 LESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVL 406

Query: 278 CMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLN 337
                  F  E K DGER Q+H  + G  ++ +SR G + T  Y E     FI     LN
Sbjct: 407 DRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERYPEIKITDFIQD---LN 462

Query: 338 KDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMNE-GYQPLFMVFDLIFMN 396
              K+ ILD E + +DK Q  ILPF ++ +  R    KD  +++   +     FD++  N
Sbjct: 463 -STKNLILDCEAVAWDKEQKKILPFQILSTRKR----KDVELHDVKVKVCLFAFDILCYN 517

Query: 397 GTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKR 456
              L N  L  R+E+L  +    P   +  +     N D ++K L+ +++   EG+++K 
Sbjct: 518 DERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKM 577

Query: 457 YD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
            D   S Y  + R+ +W+K+K +YLE  G+++DL V+G
Sbjct: 578 LDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLG 615

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 117/246 (47%), Gaps = 15/246 (6%)

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKN-DFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
           + PG    P LAK  + S  ++    +N  F  E K DGER Q+H    G  ++ +SR G
Sbjct: 350 LTPGIPLKPMLAKP-TKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRNG 407

Query: 315 TDYTYLYGE-SIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSML 373
            D T  Y E +I D  +      +      ILD E + +D     ILPF ++ +  R  +
Sbjct: 408 EDMTQRYPELNIQDYLVD-----STTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSV 462

Query: 374 TKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433
               I     +     FD++  N  SL N  L  R++ L+ I  P P   +  +     N
Sbjct: 463 DLKDI---KVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSN 519

Query: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490
            D ++  L+ AI    EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 520 LDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVL 579

Query: 491 GRDPGK 496
           G   G+
Sbjct: 580 GAYYGR 585

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 134/298 (44%), Gaps = 23/298 (7%)

Query: 204 LLKNRVIGGQEHKFLNAWHPDAQ--DYLSVVSDLRTVTTRLWDPEIRLQNNDLVINPGFA 261
           LL N    G+E         +A+  D    V +   V     D  I   +    + PG  
Sbjct: 282 LLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIP 341

Query: 262 FAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLY 321
             P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G + T  Y
Sbjct: 342 LKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGENMTERY 400

Query: 322 GE-SIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKDGIMN 380
            E SI D F+       +  K  ILD E + +DK Q  ILPF ++ +  R  +    +  
Sbjct: 401 PEISIRD-FVADL----EHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVK- 454

Query: 381 EGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEP----HIIELLSSYHRFNEDS 436
              +     FD+I  NG    N  L  R+E L  +  P      + +EL +S    + + 
Sbjct: 455 --VRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTS----SVEE 508

Query: 437 IRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
           ++K L+ ++    EG+++K  D   S Y  + R+ +W+K+K +YL+  G+++DL V+G
Sbjct: 509 LQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLG 566

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 117/249 (46%), Gaps = 11/249 (4%)

Query: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310
           N  + + PG    P LAK      E +       F  E K DGER Q+H    G  +K +
Sbjct: 326 NQHIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGS-MKIY 384

Query: 311 SRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSAR 370
           SR G D T  Y E      +  ++K     K  I+D E + +D+ Q  ILPF ++ +  R
Sbjct: 385 SRNGEDMTERYPEID----VKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKR 440

Query: 371 SMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYH 430
             +    + +   +     FD++ +N   L N   + R++ L   F       +  +   
Sbjct: 441 KGVE---LKDVKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELT 497

Query: 431 RFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDL 487
             N D ++K L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YLE  G+++DL
Sbjct: 498 TTNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDL 557

Query: 488 IVIGRDPGK 496
           +V+G   G+
Sbjct: 558 VVLGAYYGR 566

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 123/278 (44%), Gaps = 30/278 (10%)

Query: 235 LRTVTTRLWDPEIRLQNNDLVIN-----------------PGFAFAPQLAKKLSISYEKI 277
           L T   ++ D   ++ N ++VIN                 PG    P LAK      E +
Sbjct: 346 LETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEIL 405

Query: 278 CMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGTDYTYLYGESIHDGFIGKHLKLN 337
                  F  E K DGER Q+H    G  ++ +SR G + T  Y E     FI   L  +
Sbjct: 406 DRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNGENMTERYPEIHIRDFIADPLVTS 464

Query: 338 KDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTKD-GIMNEGYQPLFMVFDLIFMN 396
             + DC    E + +D  QN ILPF ++ +  R    KD  + +   +     FD++  N
Sbjct: 465 TLILDC----EAVAWDNEQNKILPFQVLSTRKR----KDVDLKDVKVKVCLFAFDILCHN 516

Query: 397 GTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNEDSIRKSLELAISMGSEGIVLKR 456
              L N  L  R++ L  +        +  +     N D ++K L+ ++    EG+++K 
Sbjct: 517 DEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKM 576

Query: 457 YD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
            D   S Y  + R+ +W+K+K +YLE  G+++DL VIG
Sbjct: 577 LDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIG 614

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 112/240 (46%), Gaps = 13/240 (5%)

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315
           + P     P LAK      E         F  E K DGER Q+H  + G  ++ +SR G 
Sbjct: 357 LRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNGE 415

Query: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375
           + T  Y E IH   I   +      K  ILD E + +DK QN ILPF ++ +  R    K
Sbjct: 416 NMTERYPE-IH---IRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKR----K 467

Query: 376 DGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434
           D  +NE   +     FD++  N   L N  L  R++ L+ I        +  +     N 
Sbjct: 468 DVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNL 527

Query: 435 DSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
           + ++  L+ ++    EG+++K  +   S Y  + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 528 EELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLG 587

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 109/239 (45%), Gaps = 12/239 (5%)

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315
           + PG    P LAK      E +       F+ E K DGER QLH    G  ++ +SR G 
Sbjct: 363 LTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGE 421

Query: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375
           + T  Y E     F+      +   +  ILD E + +DK Q  ILPF ++ +  R  +  
Sbjct: 422 NMTERYPEIDIRDFLS-----DPSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDA 476

Query: 376 DGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNED 435
             +     +     FDL+  NG  L N  L  R++ L  +  P        +     N +
Sbjct: 477 KDVK---VRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIE 533

Query: 436 SIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVIG 491
            ++  L+ ++    EG+++K  D   S Y  + R+ +W+K+K +YL   G+++DL V+G
Sbjct: 534 ELQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLG 592

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 120/247 (48%), Gaps = 17/247 (6%)

Query: 256 INPGFAFAPQLAKKLSISYEKICMKLKN-DFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314
           + PG    P LAK      E +  + +N  F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 340 LRPGIPLKPMLAKPTKTIME-VFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397

Query: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374
            + T  Y E     FI K L L K +   I+D E + +D+ +  ILPF ++ +  R    
Sbjct: 398 ENMTERYPEINVTDFI-KDLNLTKSL---IIDCEAVAWDREEKKILPFQVLSTRKR---- 449

Query: 375 KD-GIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPH-IIELLSSYHRF 432
           KD  I +   +     FD++  N   L N  L  R+E L+ + T E H            
Sbjct: 450 KDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSV-TREVHGEFTYAKELSTN 508

Query: 433 NEDSIRKSLELAISMGSEGI---VLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIV 489
           N D ++  L+ ++    EG+   VL   DS Y  + R+ +W+K+K +YL+  G+++DL V
Sbjct: 509 NLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCV 568

Query: 490 IGRDPGK 496
           +G   G+
Sbjct: 569 LGAFYGR 575

>KAFR0D03970 Chr4 complement(778963..782664) [3702 bp, 1233 aa] {ON}
            Anc_1.79 YNL273W
          Length = 1233

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 8/173 (4%)

Query: 643  TLSEFLRTKNVKSRRNGSDQVIHGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFY 702
            T+ E LR + V      S +V H  KR KKN  K+ ++Q++EE+     + A     Y  
Sbjct: 985  TMDEKLRGRKVTKGLATSKKVKHNKKRPKKNLPKHDIEQNIEEQSKKKSHQAVSSREYIS 1044

Query: 703  VISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFG--TRNLRIISGKLTNECSAL 760
               D  D +     E E   +++ +     + + + K FG  T       G +T++ SAL
Sbjct: 1045 DSDDEDDAMTSIFFENENYMRWLLDRHNGQLTDEMFKLFGKFTAERMQNHGSVTSDFSAL 1104

Query: 761  IERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFGDSYE 813
             +       P   +D ++  ++  L PK   + S ++ +  +   +T   S E
Sbjct: 1105 FQ------GPVPSIDAIKVSTVDSLAPKTLIDFSYKVTETNDNANETEHSSEE 1151

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 628 YCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQKKNRRKYILDQSLEEEG 687
           Y   + +  D     + SE  R ++V+ ++N         K  K+++   +L +  E  G
Sbjct: 44  YINKVSQQLDSTKPQSGSEDERNESVEPQKNYGRDTYFQEKALKQSKEDELLKRRYESIG 103

Query: 688 GLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTRNLR 747
               N   F++L  Y+          TR  + ++++ I   GG  +H++ +K+  T    
Sbjct: 104 KATSN--LFKDLTVYING-------YTRPSRFQLHEMIVLNGGKFLHHLSAKRSVTH--- 151

Query: 748 IISGKLTNECSALIE-RGYDVINPQWIVDCVQSKSLL 783
           II+  LT      IE   Y V+ P+W+VD ++ K LL
Sbjct: 152 IIASTLT--LKKKIEFANYKVVKPEWLVDSIKVKKLL 186

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 670 QKKNRRKYILDQSLEEE-GGLL--KNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQ 726
           Q K + + + DQ L+ +  GL+  +N   F+N   Y+          T+  + ++++ I 
Sbjct: 138 QDKAQGQSVQDQILKNQYKGLISSQNGNLFKNCVIYING-------YTKPGRLQLHEMIV 190

Query: 727 EGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIE-RGYDVINPQWIVDCVQSKSLL 783
             GG  +H++ +K+   R   I++  L       IE   Y V+NP WI DC++ + LL
Sbjct: 191 LHGGKFLHHLSAKK---RVTHIVASNLP--LKKRIEFANYKVVNPDWITDCIKERRLL 243

>ADL185W Chr4 (373877..375310) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL137W
          Length = 477

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 831 LVRVQGLVTPYADEELIKIPLFLFQDRIM---LFPNTESKTISFLQEKIKLYGGKLTTDI 887
           L    G V P+     + + LFLF   I    LFPN    T+  L ++++L G  +   +
Sbjct: 370 LFMATGFVAPHGTRYFVVMALFLFLAGIFIGPLFPNCCVVTLQLLPKRLQLNGVSVAVAL 429

Query: 888 GKCNLIILP 896
           G     ILP
Sbjct: 430 GSIGGAILP 438

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 73/150 (48%), Gaps = 27/150 (18%)

Query: 673 NRRKYILDQSL--EEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKE----------- 719
           +R  Y  D+ L  +++   L+N   +RNLY    +D  ++ L  +I K+           
Sbjct: 137 SREDYFHDKKLRQDQQDEHLRNQ--YRNLYLNG-TDHINEGLPPQIFKDCIIYINGYTIP 193

Query: 720 ---RMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDC 776
              ++++ I   GG  IH++ +K+  T    II+  LT +     E+ Y V+ P WIV  
Sbjct: 194 GRLQLHESIVLHGGKFIHHLSAKKKITH---IIASNLTLKKKLEFEK-YKVVKPDWIVKS 249

Query: 777 VQSKSLLKLEPKYCFNVSTELKKLTEKRVD 806
           ++SK LL   P   F + T L +  +KR+D
Sbjct: 250 IESKKLL---PWQDFALLTHLDE-QQKRLD 275

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 35.0 bits (79), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 759 ALIERGYDVINPQWIVDCVQSKSLLKLEPKY 789
           A +E G  +I+P+W++DC +  +LL+ +P Y
Sbjct: 167 AAMELGIPIIHPKWVLDCHKRNALLEFDPYY 197

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 701 FYVISDVFDDVLGTRIEKERMYKYIQEGGGTLI---HNIISKQFGTRNLRIISGKLTNEC 757
           FYV       V G R+    + +  + GG   +   H +       R++ +         
Sbjct: 114 FYVF---IGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTDCAEGARA 170

Query: 758 SALIERGYDVINPQWIVDCVQSKSLLKLE 786
           +A  E+G  V++P+W+ DCV+  +++++E
Sbjct: 171 AAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL130W (CEG1)
          Length = 463

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 387 FMVFDLIFMNGTSLANIPLNVRKEYLNGIFT----------PE-----PHIIELLSSYHR 431
           +++FD + +NG +L   P + R  +L   F           P+     P  + +      
Sbjct: 144 YLMFDCLAINGRALVQSPTSSRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFS 203

Query: 432 FNEDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPE 476
           F+ D +  SL+  +   S+G++    D+ YTV  ++   +K KPE
Sbjct: 204 FDLDRVAGSLD-KLPHVSDGLIFTAVDTPYTVGGKDSTLLKWKPE 247

>CAGL0E05588g Chr5 (551061..553724) [2664 bp, 887 aa] {ON} similar
           to uniprot|P12689 Saccharomyces cerevisiae YOR346w REV1
           DNA repair protein
          Length = 887

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%)

Query: 721 MYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIE-RGYDVINPQWIVDCVQS 779
           +++ I   GG  +H++ +K+  T    II+  L       IE   Y V+ P WIVD +Q 
Sbjct: 103 LHQMIVVHGGKFLHHMSAKRSVTH---IIASNLP--LKKRIEFANYKVVKPNWIVDSIQQ 157

Query: 780 KSLL 783
           K LL
Sbjct: 158 KKLL 161

>TPHA0D03020 Chr4 (629502..631268) [1767 bp, 588 aa] {ON} Anc_3.447
           YGR103W
          Length = 588

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 39/99 (39%), Gaps = 22/99 (22%)

Query: 693 TAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGK 752
              F +  FYV  +V  D++            I   GG++I      Q   ++L      
Sbjct: 346 ATLFSDFVFYVGREVPIDIVEF---------LILSSGGSVISEAALDQVDAKDL-----D 391

Query: 753 LTNECSALIER--------GYDVINPQWIVDCVQSKSLL 783
            +N    +++R        G   + PQWI DC+  KSL+
Sbjct: 392 FSNVTHQIVDRPVLNNKVPGRTYVQPQWIFDCINKKSLV 430

>YOR346W Chr15 (981828..984785) [2958 bp, 985 aa] {ON}
           REV1Deoxycytidyl transferase; involved in repair of
           abasic sites and adducted guanines in damaged DNA by
           translesion synthesis (TLS); forms a complex with the
           subunits of DNA polymerase zeta, Rev3p and Rev7p;
          Length = 985

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 67/153 (43%), Gaps = 23/153 (15%)

Query: 665 HGVKRQKKNRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKY 724
           HG   Q +  +    DQ   +   + KN   + N Y             T+  + ++++ 
Sbjct: 141 HGQTLQDQILKDQYKDQISSQSSKIFKNCVIYINGY-------------TKPGRLQLHEM 187

Query: 725 IQEGGGTLIHNIISKQFGTRNLRIISGKLTNECSALIE-RGYDVINPQWIVDCVQSKSLL 783
           I   GG  +H + SK+  T    I++  L       IE   Y V++P WIVD V+   LL
Sbjct: 188 IVLHGGKFLHYLSSKKTVTH---IVASNLP--LKKRIEFANYKVVSPDWIVDSVKEARLL 242

Query: 784 KLEPKYCFNVSTELKKLTEKRVDTFGDSYEVPI 816
              P   ++++++L +  +K++D       +P+
Sbjct: 243 ---PWQNYSLTSKLDE-QQKKLDNCKTVNSIPL 271

>Kwal_26.6948 s26 complement(137749..140643) [2895 bp, 964 aa] {ON}
           YOR346W (REV1) - deoxycytidyl transferase [contig 46]
           FULL
          Length = 964

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 695 FFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTRNLRIISGKLT 754
            F+N   Y+    F D L       ++++ +   GG+ +H +  K   T+   I++  LT
Sbjct: 165 IFQNCIIYINGRTFPDRL-------QLHQKVILYGGSFMHYLSGK---TKVTHIVASNLT 214

Query: 755 NECSALIERGYDVINPQWIVDCVQSKSLL 783
            +     ++ Y V+ P WIVD + ++  L
Sbjct: 215 AKKRLEFQK-YKVVTPAWIVDSITAEKRL 242

>SAKL0E13860g Chr5 complement(1141665..1143575) [1911 bp, 636 aa]
           {ON} some similarities with uniprot|P11938 Saccharomyces
           cerevisiae YNL216W RAP1 DNA-binding protein involved in
           either activation or repression of transcription
           depending on binding site context also binds telomere
           sequences and plays a role in telomeric position effect
           (silencing) and telomere structure
          Length = 636

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 19/102 (18%)

Query: 685 EEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTLIHNIISKQFGTR 744
           E+  L K    F +L FY+  D           K+ + + IQ+ GG ++  + +   GT+
Sbjct: 25  EKHDLKKGDGIFHHLKFYIAQDE---------NKQELTELIQKNGGEVLSELPTAD-GTK 74

Query: 745 NLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLE 786
           +L +     TN            + P++I  C ++  L+KL+
Sbjct: 75  SLVVSPFNTTN---------LPTVTPKYIKTCCENNVLMKLQ 107

>CAGL0D06050g Chr4 (573888..575462) [1575 bp, 524 aa] {ON} similar
           to uniprot|P47114 Saccharomyces cerevisiae YJR054w
          Length = 524

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 319 YLYGESIHDGFIGKHLKLNKD---VKDCILDGEMITYDKTQNMILPFG-LVKSSARSMLT 374
           +L   SI DG   +  +L  +   V++ ++DG  +  D   N    F    +++AR+   
Sbjct: 326 HLVNSSIEDGSTSEEYELMYEEPMVRNSVIDGNDLLLDSKFNAKRDFNQYYQNAARNQSN 385

Query: 375 KDGIMNEGYQPLFMVFDLIFMNGTS 399
              ++ E Y+P F V D  + NG++
Sbjct: 386 SQDVIKEEYEPNFDVMDYAYSNGSN 410

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 759 ALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFN---VSTELKKLTEKRVDTFGDSYEVP 815
           A IE+G  +++ +WI+DC +  + L+ +P Y  +    +T  +K+  +  + +GD    P
Sbjct: 178 AAIEQGIPIVHYKWILDCQRRNATLEYDPYYLVSNIPENTPFEKIGRESCECWGDLINPP 237

>Suva_6.164 Chr6 (286935..289214) [2280 bp, 759 aa] {ON} YJL090C
           (REAL)
          Length = 759

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 758 SALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVSTELKKLTEKRVDTFG 809
           SA I +   +I+ +WI+DC +  +LL  +P Y       L KL E   D+ G
Sbjct: 187 SAAIAQNLPIIHFKWILDCQRRNALLPYDPYYL------LPKLKELAYDSIG 232

>KLLA0F14300g Chr6 complement(1325862..1327871) [2010 bp, 669 aa]
           {ON} similar to uniprot|P47027 Saccharomyces cerevisiae
           YJL090C DPB11 Essential BRCT repeat protein required on
           the prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 669

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 21/44 (47%)

Query: 755 NECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFNVSTELK 798
           N   A +E    V++P+WI+DC+     L  +  Y      EL+
Sbjct: 168 NRVQAALEENVPVVHPKWIIDCMDRSGTLDFQSFYLLKNCHELE 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,062,470
Number of extensions: 4590789
Number of successful extensions: 12248
Number of sequences better than 10.0: 61
Number of HSP's gapped: 12328
Number of HSP's successfully gapped: 62
Length of query: 950
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 831
Effective length of database: 39,836,145
Effective search space: 33103836495
Effective search space used: 33103836495
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)