Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026402.532ON26026013410.0
NDAI0I022702.532ON2772736391e-82
KAFR0A018502.532ON2562655328e-67
CAGL0K02981g2.532ON2782654895e-60
TPHA0C041802.532ON2642524538e-55
Kpol_1018.342.532ON2922704411e-52
SAKL0A09460g2.532ON2402484171e-49
TDEL0A030602.532ON2442233901e-45
KNAG0C058202.532ON2711983763e-43
YMR069W (NAT4)2.532ON2852653425e-38
Smik_13.2482.532ON2552653397e-38
Skud_13.2252.532ON2542643301e-36
ZYRO0B01980g2.532ON1881983242e-36
TBLA0G022202.532ON2782553069e-33
Suva_13.2442.532ON2572713041e-32
KLTH0D06820g2.532ON2601953013e-32
Kwal_26.80162.532ON2402012506e-25
Ecym_72562.532ON2432061101e-05
KLLA0E18569g2.532ON215164984e-04
TDEL0C058801.113ON15978760.20
KLLA0A12089gsingletonON181122750.32
KLTH0H16060g4.4ON59496731.0
KNAG0D025908.82ON57790711.8
KLTH0F09570g2.334ON59756711.8
KNAG0J015008.638ON914145712.0
KNAG0L011607.186ON117065712.0
Kwal_33.13421singletonOFF6350632.7
Suva_12.1797.463ON143381693.6
Kpol_541.38.811ON143182684.7
Suva_13.148.867ON509150675.5
ADR225W5.685ON23665665.6
YNL144C2.113ON740109675.9
KLLA0D01155g6.21ON33571666.5
TPHA0L004907.85ON29050658.1
Smik_15.783.124ON307693668.5
YLL040C (VPS13)4.14ON314442668.5
YEL056W (HAT2)6.9ON40184659.1
NOTE: 1 genes in the same pillar as NCAS0D02640 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532

BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NCAS0D02640
         (783 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   521   0.0  
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   250   1e-82
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   209   8e-67
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   192   5e-60
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   179   8e-55
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   174   1e-52
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   165   1e-49
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   154   1e-45
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   149   3e-43
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   136   5e-38
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   135   7e-38
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   131   1e-36
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   129   2e-36
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   122   9e-33
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   121   1e-32
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   120   3e-32
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...   100   6e-25
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    47   1e-05
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    42   4e-04
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    34   0.20 
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    33   0.32 
KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weak...    33   1.0  
KNAG0D02590 Chr4 complement(456578..458311) [1734 bp, 577 aa] {O...    32   1.8  
KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {...    32   1.8  
KNAG0J01500 Chr10 complement(275375..278119) [2745 bp, 914 aa] {...    32   2.0  
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    32   2.0  
Kwal_33.13421 s33 complement(215424..215615) [192 bp, 63 aa] {OF...    29   2.7  
Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR09...    31   3.6  
Kpol_541.3 s541 complement(7377..11672) [4296 bp, 1431 aa] {ON} ...    31   4.7  
Suva_13.14 Chr13 complement(14928..16457) [1530 bp, 509 aa] {ON}...    30   5.5  
ADR225W Chr4 (1097826..1098536) [711 bp, 236 aa] {ON} Syntenic h...    30   5.6  
YNL144C Chr14 complement(352820..355042) [2223 bp, 740 aa] {ON} ...    30   5.9  
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    30   6.5  
TPHA0L00490 Chr12 complement(82007..82879) [873 bp, 290 aa] {ON}       30   8.1  
Smik_15.78 Chr15 (135387..144617) [9231 bp, 3076 aa] {ON} YOL081...    30   8.5  
YLL040C Chr12 complement(54211..63645) [9435 bp, 3144 aa] {ON}  ...    30   8.5  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    30   9.1  

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  521 bits (1341), Expect = 0.0
 Identities = 260/260 (100%), Positives = 260/260 (100%)
 Frame = +1

Query: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ 180
           MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ
Sbjct: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ 60

Query: 181 GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP 360
           GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP
Sbjct: 61  GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP 120

Query: 361 MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 540
           MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN
Sbjct: 121 MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 180

Query: 541 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS 720
           GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS
Sbjct: 181 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS 240

Query: 721 VGRTIVQKPIYYLFYLPLSI 780
           VGRTIVQKPIYYLFYLPLSI
Sbjct: 241 VGRTIVQKPIYYLFYLPLSI 260

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  250 bits (639), Expect = 1e-82
 Identities = 138/273 (50%), Positives = 185/273 (67%), Gaps = 17/273 (6%)
 Frame = +1

Query: 13  EAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSG--KNSQDVVYMKCSTDQGD 186
           +A  +++ EEFP  L+    + +   +R+I      +  S   ++S +V  +     Q  
Sbjct: 7   DALLNIVCEEFPTILQSA--DGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRS 64

Query: 187 KMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPML 366
            +L++FL+ILDVNLG KYTKVSK IYEN + WK NKLEEM SPGL+YVSYWDE+  EP+L
Sbjct: 65  DVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLL 124

Query: 367 FLSFMLTEEDGF-----------TEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQD 513
           FLSFMLTE DGF             +D+L+SV+YLYEIQILP LR + +GT+LL+ HL  
Sbjct: 125 FLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184

Query: 514 ACSRLRSENG-ELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT 690
            CS L ++ G + L YPL+GIELTVFSDN  AI FYKSIGM+LTPDSP D V  +E+R+T
Sbjct: 185 CCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQT 244

Query: 691 RGMAQ--NIST-SVGRTIVQKPIYYLFYLPLSI 780
           R + +  N  T  V + I++KP+YYL+YLP+ +
Sbjct: 245 RNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL 277

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  209 bits (532), Expect = 8e-67
 Identities = 126/265 (47%), Positives = 166/265 (62%), Gaps = 10/265 (3%)
 Frame = +1

Query: 10  FEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVV-----YMKCST 174
           F  F  ++ +EFP  L    Q     LKRKIL I  ++    K S  V+       K + 
Sbjct: 7   FNGFLKIVSDEFPKELRTKGQN----LKRKILYIASED-EENKESDSVINEQDDLTKFTE 61

Query: 175 DQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESD 354
             G K+LD FL+ILD NLG KY K+S++IY+N   WK NKL EM+SPGL+YVSYW EE++
Sbjct: 62  GIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKEEAE 121

Query: 355 EP--MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRL 528
           +    LFLSFMLTEED   +D +  SV+YLYEIQ++   R  +LGTRL+ + L + C   
Sbjct: 122 KKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLI-KGLSNVCQIA 180

Query: 529 RSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQN 708
           + +      +PLIGI+LTVFSDN+ AIKFY+ IGM+ T  SP+D V  +E R+TR     
Sbjct: 181 QVKIRP--AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTR----- 233

Query: 709 ISTSVGR---TIVQKPIYYLFYLPL 774
             TSV R    +V+KPIYYL YLP+
Sbjct: 234 --TSVNRKTLKVVRKPIYYLLYLPV 256

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  192 bits (489), Expect = 5e-60
 Identities = 109/265 (41%), Positives = 164/265 (61%), Gaps = 11/265 (4%)
 Frame = +1

Query: 13  EAFSHMILEEFP--LTLEVTLQEQLKC--LKRKILIIEPDN-CTSGKN-SQDVVYMKCST 174
           ++F H +L+ FP  +T +  L + ++   L+RK+L+I+ D+ C + K  + +VV      
Sbjct: 13  DSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHI 72

Query: 175 DQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESD 354
            +   +L   L++LD NLG+KY   SK++Y N +PWK NK+EEM + G++YVSYW +  D
Sbjct: 73  KESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDD 132

Query: 355 E---PMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 525
           E   P+LFLSFMLTEE+  T +D + SV++LYEIQI   LR + LG   L+  L     R
Sbjct: 133 EHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKR 192

Query: 526 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLE-RRRTRGMA 702
           L   +   LE+P  GIELTVF+DN  AI  Y+ +GM  TP+SP+D +     RRRTR   
Sbjct: 193 LLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSR 252

Query: 703 Q-NISTSVGRTIVQKPIYYLFYLPL 774
           + N      R +++KP+YY+++ P+
Sbjct: 253 KINNKNESPRILIKKPLYYMYWKPI 277

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  179 bits (453), Expect = 8e-55
 Identities = 105/252 (41%), Positives = 163/252 (64%), Gaps = 13/252 (5%)
 Frame = +1

Query: 58  EVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVV---YMKCSTDQGDKMLD--QFLDILDV 222
           E+ + + L  L +KI++++ +     KNS ++    Y+  S ++ +  ++  + L ILD 
Sbjct: 18  EIYVNKNLTKLVKKIIVVDSET-EDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDN 76

Query: 223 NLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW-DEESDEPMLFLSFMLTEEDG 399
           NLG+ YT  +KK+Y N++PWK NK++EM++ GL+YV Y  ++E     L+LSF LT+E G
Sbjct: 77  NLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESG 136

Query: 400 FTEDDKLLS-VVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIE 576
           F  D  + S V+YLYEIQ+ P +RN  LGT+L+A +L+D    +     E +   +IGIE
Sbjct: 137 FLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVH----ENIHKDIIGIE 192

Query: 577 LTVFSDNENAIKFYKSIGMELTPDSPRDRV---AHLERRRTRGMAQNISTS---VGRTIV 738
           LTVFSDN NAI+FY++IGM+LTPDSP D+     H  + R++  ++  S+S      ++V
Sbjct: 193 LTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSDKPTSLSVV 252

Query: 739 QKPIYYLFYLPL 774
           +KP YYL+YLPL
Sbjct: 253 KKPDYYLYYLPL 264

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  174 bits (441), Expect = 1e-52
 Identities = 108/270 (40%), Positives = 160/270 (59%), Gaps = 26/270 (9%)
 Frame = +1

Query: 43  FPLTLEV-----TLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFL 207
           FP TLE+     +   Q K L R+++ I+  N      +  + Y K +  + D +L++ L
Sbjct: 15  FPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNV-KCDVVLNKLL 73

Query: 208 DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLT 387
           DILD NLG  Y + S KIY N +PWK NK+ EM+S GL+YV Y D+ + EP+LF+SFM+T
Sbjct: 74  DILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMIT 133

Query: 388 EEDGF---TEDD------KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 540
           ++      T++D         +V+YLYEIQ+L  +RN+KLGT L+  +L+     L  + 
Sbjct: 134 DDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKD- 192

Query: 541 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGM------- 699
               +  +I +ELTVFS+N NAI FYK IGM  TPDSPRD++   ++RRTR         
Sbjct: 193 ---YQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESK 249

Query: 700 ----AQNISTSVG-RTIVQKPIYYLFYLPL 774
               +  ++TS   + I++KP YYL +LP+
Sbjct: 250 NNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  165 bits (417), Expect = 1e-49
 Identities = 102/248 (41%), Positives = 147/248 (59%)
 Frame = +1

Query: 31  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLD 210
           +L+ FP +  +TL++     ++ ++I EP +  +   S  V          + +L QFL 
Sbjct: 13  VLDSFPTS--ITLKDGSLATRKVLVIDEPSSGIAP--SGQVCTWSGDRQSSNSLLIQFLK 68

Query: 211 ILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLTE 390
           +LD+NLG KY  VS  +Y N R W  NKLEEM++ GLVYV Y+   S  P++FLSF+LT+
Sbjct: 69  VLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS--PLMFLSFLLTD 126

Query: 391 EDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIG 570
           E  F  D   + VVYLYEIQ+LP ++ ++LGT++L  +L++    L       L+  L G
Sbjct: 127 EPDFLPDP--VKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSL-----SRLDPLLKG 179

Query: 571 IELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVGRTIVQKPI 750
           IELTVFSDN+ A+  Y SIGM L P SP D +A   +RRTR    ++ T      V +P 
Sbjct: 180 IELTVFSDNDAALHLYYSIGMALAPGSPTDEIA-TSQRRTRHSTTDLQT------VSRPD 232

Query: 751 YYLFYLPL 774
           YYL +LP+
Sbjct: 233 YYLMFLPV 240

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  154 bits (390), Expect = 1e-45
 Identities = 92/223 (41%), Positives = 127/223 (56%), Gaps = 17/223 (7%)
 Frame = +1

Query: 37  EEFPLTLE---VTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFL 207
           + FP T+    + L  +L  +  +   +E D C S  +S           + +K+L Q L
Sbjct: 15  QNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCISYVHSPR---------EAEKLLWQLL 65

Query: 208 DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESD----------E 357
           +ILD NLG+KY   S+ +Y N RPW+VNK  EM +PGLVYV Y    +            
Sbjct: 66  EILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFS 125

Query: 358 PMLFLSFMLTEEDGFTEDD--KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRL- 528
           P+LFLSFMLTEEDG   DD  ++ +V+YLYE+Q+LP +R   L  RLL +HL     +L 
Sbjct: 126 PLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLC 185

Query: 529 -RSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSP 654
            RS  G   +    G+ELTVF+DN  AI+ Y+S+GM+L  DSP
Sbjct: 186 TRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  149 bits (376), Expect = 3e-43
 Identities = 88/198 (44%), Positives = 120/198 (60%), Gaps = 3/198 (1%)
 Frame = +1

Query: 184 DKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPM 363
           ++ L  FL+ILD NLG  Y ++S+KIY N++ W+ NK  EM S  LVYVSYW  +S EP+
Sbjct: 80  ERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVSDS-EPV 138

Query: 364 LFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENG 543
           L+ SFMLTEE+G +  +    VVYLYEIQ++ ++R +KLG  +++   + A         
Sbjct: 139 LYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECA--------- 189

Query: 544 ELLEYP-LIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT--RGMAQNIS 714
             LE P +  + LTVFSDNE A+KFY+ +    T DSPRD V    RRRT  R       
Sbjct: 190 --LESPEVAAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAARTALDPAR 247

Query: 715 TSVGRTIVQKPIYYLFYL 768
            S  +  ++KP YYL YL
Sbjct: 248 DSDVKVTIKKPTYYLLYL 265

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  136 bits (342), Expect = 5e-38
 Identities = 91/265 (34%), Positives = 137/265 (51%), Gaps = 12/265 (4%)
 Frame = +1

Query: 10  FEAFSHMILEEFPLTLEVTLQE-----QLKCLKRKILIIEPDNCTS--GKNSQDVVYMKC 168
           F+ F ++ +E+FP ++E    +         L+R+I+ I  D+  S    +S   +  K 
Sbjct: 33  FQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKL 92

Query: 169 STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 348
              +GD++LD  + ++D +LG KY + S+ +Y N +PWK NKL EM+S GLVYV YWD  
Sbjct: 93  HKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD-- 150

Query: 349 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQDA 516
           +     F SFMLTEE G  E D L    + V+YLYE+ +  + R   +G RLL   L D 
Sbjct: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210

Query: 517 CSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRG 696
            +R    +   +     G+ LTVFSDN  A + Y+++G    P SP      +   R  G
Sbjct: 211 VAR----HTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGG 266

Query: 697 MAQNISTSVGRTIVQ-KPIYYLFYL 768
                    GR +V   P+YY++ L
Sbjct: 267 ---------GRVVVPCDPLYYVYCL 282

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  135 bits (339), Expect = 7e-38
 Identities = 90/265 (33%), Positives = 133/265 (50%), Gaps = 12/265 (4%)
 Frame = +1

Query: 10  FEAFSHMILEEFPLTLEVTLQE------QLKCLKRKILIIEPDNCTSGKNSQ--DVVYMK 165
           F  F  + +++FP TLE T  +          LKR++L I   +  S  N +    V  +
Sbjct: 2   FHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNYR 61

Query: 166 CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 345
               +G+ +LD  + ++D +LG KY + S+ +Y N +PWK NKL EM+SP LVYVSYWD 
Sbjct: 62  LHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD- 120

Query: 346 ESDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQD 513
            +     F SFMLTEE G  E D      + V+YLYE+ +    R   +G RLL   L +
Sbjct: 121 -NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCE 179

Query: 514 ACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTR 693
             +R    +   L     G+ LTVFSDN  A + Y+++G    P SP         R TR
Sbjct: 180 GVAR----HVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSP--AAGAPTTRPTR 233

Query: 694 GMAQNISTSVGRTIVQKPIYYLFYL 768
              + +       + + P+YY++ L
Sbjct: 234 HGGERV------VVPRDPLYYVYCL 252

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  131 bits (330), Expect = 1e-36
 Identities = 90/264 (34%), Positives = 129/264 (48%), Gaps = 11/264 (4%)
 Frame = +1

Query: 10  FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILIIEPDNC-TSGKNSQDVVYMKC 168
           F+ F  + ++EFP TLE T   +         LKR+I+ I  +N      +         
Sbjct: 2   FKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNL 61

Query: 169 STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 348
               GD +LD  + ++D +LG+KY + S+ +Y N  PWK NKL EM+S GL+YVSYW   
Sbjct: 62  HKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWG-- 119

Query: 349 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQDA 516
           +     F SFMLTEE G  E D      + V+YLYEI +  + R   LG RLL   L + 
Sbjct: 120 NGALGAFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEG 179

Query: 517 CSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRG 696
            +R        +     G+ LTVF DN  A + Y++IG    P SP      L  R TR 
Sbjct: 180 VAR----RVRRVRCDFFGVALTVFGDNTRARRLYEAIGFCRAPGSPAPAAPAL--RPTRH 233

Query: 697 MAQNISTSVGRTIVQKPIYYLFYL 768
             + +       + + P+YY++ L
Sbjct: 234 GRKRV------VVARDPLYYVYCL 251

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  129 bits (324), Expect = 2e-36
 Identities = 76/198 (38%), Positives = 112/198 (56%)
 Frame = +1

Query: 166 CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 345
           C ++  DK+L++ L ++++NLG  Y K +K IY+N + W+ NK +EM S  L +VSYW+ 
Sbjct: 12  CISNSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNV 71

Query: 346 ESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 525
           ES+E + F S M  EE     + ++ +++YLYEI + P  RN+K G  +L    +  C +
Sbjct: 72  ESNELVCFCSIMPCEES--IVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPK 129

Query: 526 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQ 705
                       L GIELTVFS NE AI FY++ G  L+ DSP D+     RRRTR    
Sbjct: 130 AH----------LSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK-----RRRTR---- 170

Query: 706 NISTSVGRTIVQKPIYYL 759
                 G  I+ +P YY+
Sbjct: 171 -----TGIRII-RPTYYI 182

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  122 bits (306), Expect = 9e-33
 Identities = 82/255 (32%), Positives = 131/255 (51%), Gaps = 26/255 (10%)
 Frame = +1

Query: 88  LKRKILII---EPDNCTSGKNSQ---DVVYMKCSTDQGDKMLD----QFLDILDVNLGEK 237
           L+RKI II   E ++  S +N+    D +Y      +   + +    Q   ++D NLG+ 
Sbjct: 26  LERKIYIIGDSENNSLLSDQNNNSNDDEIYWYFKDRKNPTVENIIKTQIFQLIDENLGKL 85

Query: 238 YTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLTEEDGFTEDDK 417
           Y K SKKIYEN   W +NK EEM +  ++Y++YWD + +   LFLS +  EE    E++ 
Sbjct: 86  YKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSILSCEETYILENND 145

Query: 418 LLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDN 597
              V+YLYEI I    + + +G RL+ ++L +    ++    E  +   IG+ELTVFS+N
Sbjct: 146 QGEVLYLYEIHITKEYQRQGIGERLIKDYLIE--KLIKPLKIERQDNNFIGLELTVFSEN 203

Query: 598 ENAIKFY-KSIGMELTPDSPRDRVAHLERRRTRGMAQNI---------------STSVGR 729
            +A  FY   I M+ T  SPRD + ++ +R TR   + +                  + R
Sbjct: 204 NDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEHCEDNKLPSLNDKKKQLYR 263

Query: 730 TIVQKPIYYLFYLPL 774
             ++KP YY+   P+
Sbjct: 264 KSIRKPEYYILVFPV 278

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  121 bits (304), Expect = 1e-32
 Identities = 88/271 (32%), Positives = 132/271 (48%), Gaps = 15/271 (5%)
 Frame = +1

Query: 10  FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILII-EPDNCTSGKNSQDVVYMKC 168
           F+ F  + +EEFP TL+ T  +          L+R+++ + E D    G ++ + +  K 
Sbjct: 2   FQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKL 61

Query: 169 STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW--D 342
               GD+ L   + ++D +LG KY + S+ +Y N  PWK NKL EM+S GLVYV YW  D
Sbjct: 62  HKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGND 121

Query: 343 EESDEPM-LFLSFMLTEEDGFTEDD----KLLSVVYLYEIQILPSLRNRKLGTRLLAEHL 507
            + +  +  F SFMLTEE G  E D    + + V+YLYE+      R R LG RLLA+ L
Sbjct: 122 AQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXH--RGRGLGRRLLAKAL 179

Query: 508 -QDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERR 684
            +   +R+R    +     L G+ LTVF DN  A + Y+S                    
Sbjct: 180 CEGVAARVRRTCDD-----LFGVALTVFGDNTRARRLYESXXXXXXXXXXXXXXXXXXXX 234

Query: 685 RTRGMAQNISTSVGRTIVQKPIYYLFYLPLS 777
              G A          + + P+YY++ L L+
Sbjct: 235 XXXGRA--------AAVARDPLYYVYCLRLA 257

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  120 bits (301), Expect = 3e-32
 Identities = 74/195 (37%), Positives = 113/195 (57%), Gaps = 1/195 (0%)
 Frame = +1

Query: 190 MLDQFLDILDVNLGEKYTKVSKKIYENARP-WKVNKLEEMRSPGLVYVSYWDEESDEPML 366
           +LDQ L ++  NLG  YT+ ++ IY   R  W   K  EM +PGLVYV Y D  S +P++
Sbjct: 77  LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHS-QPLV 135

Query: 367 FLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGE 546
           F+S +LT+E    ++     V+YL+EI +   +R + LGT LL + L    + L   +  
Sbjct: 136 FMSLLLTDEPELGQE-LAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPS 194

Query: 547 LLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVG 726
           +L     G ELTVFS+N+ A++ Y ++GM +   SP+DR A + RRRTR +A + S    
Sbjct: 195 VL-----GAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQV-RRRTRAIAYDSS---- 244

Query: 727 RTIVQKPIYYLFYLP 771
             +V +P YY+ + P
Sbjct: 245 --LVTRPAYYILFWP 257

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score =  100 bits (250), Expect = 6e-25
 Identities = 74/201 (36%), Positives = 105/201 (52%), Gaps = 7/201 (3%)
 Frame = +1

Query: 190 MLDQFLDILDVNLGEKYTKVSKKIY-ENARPWKVNKLEEMRSPGLVYVSYW--DEESDE- 357
           +L+Q L ++D NLG  Y + +K +Y +    WK  K +EM +PGLVYV Y   DEE+ + 
Sbjct: 52  LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKE 111

Query: 358 --PMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLR 531
             P+ FLS +LT+E          +VVYL EI +   +R   LG  LL E +        
Sbjct: 112 GLPLAFLSLLLTDEPELGPAPA--AVVYLMEIHVADIIRGLGLGGTLLREGVAGTV---- 165

Query: 532 SENGELLEYPLI-GIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQN 708
              G    +P I G ELTVF+DNE A++ Y  +GM++   SP+D    +  RRTR     
Sbjct: 166 --RGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEV-HRRTR----- 217

Query: 709 ISTSVGRTIVQKPIYYLFYLP 771
            +T      V +P YYL + P
Sbjct: 218 -ATRYESRKVTRPTYYLLFWP 237

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 47.0 bits (110), Expect = 1e-05
 Identities = 48/206 (23%), Positives = 82/206 (39%), Gaps = 41/206 (19%)
 Frame = +1

Query: 142 SQDVVYM-KCSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYEN---ARPWKVNKLEEMR 309
           S+D++   + S     K   Q   I++  LG  Y   +  +Y     +RPW+ +K  E++
Sbjct: 29  SRDIIITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQ 88

Query: 310 SPGLVYVSYWDEESDEPML-FLSFMLTEEDGF---------------------------- 402
             G  +V Y  E     +  F+S +  +E  +                            
Sbjct: 89  GLGTCHVLYRKENPGGAIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAF 148

Query: 403 --TEDDKLLSVVYLYEIQILPSLRNRKLGT------RLLAEHLQDACSRLRSENGELLEY 558
             T       VVY+ EI + PS +N+ LG+      R L +H+Q +  +L+         
Sbjct: 149 EETPPPPPCKVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLK--------- 199

Query: 559 PLIGIELTVFSDNENAIKFYKSIGME 636
              G+ELTVF+ N  A+  Y+  G +
Sbjct: 200 ---GLELTVFTGNRQALALYRRQGFK 222

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 42.4 bits (98), Expect = 4e-04
 Identities = 42/164 (25%), Positives = 71/164 (43%), Gaps = 14/164 (8%)
 Frame = +1

Query: 193 LDQFLDILDVNLGEKYTKVSKKIY--------ENARPWKVNKLEEMRSPGLVYVSYWDEE 348
           L + L I+  NL   Y      IY        +    W   K +EM    LVY+  +  +
Sbjct: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108

Query: 349 SDEPMLFLSFMLTEEDGFTEDDKLLS--VVYLYEIQILPSLRNRKLGTRLLAEHLQDACS 522
           + + + F S  L++      D   L+   ++LYEI ++   ++R LG+ +          
Sbjct: 109 TTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIF--------- 159

Query: 523 RLRSENGELL----EYPLIGIELTVFSDNENAIKFYKSIGMELT 642
                NG L+    +     IEL VF+ N+ A ++YK +G +LT
Sbjct: 160 -----NGLLIPLARDLTCPSIELCVFTANDVACRWYKRLGFQLT 198

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {ON}
           Anc_1.113 YJR097W
          Length = 159

 Score = 33.9 bits (76), Expect = 0.20
 Identities = 23/78 (29%), Positives = 37/78 (47%)
 Frame = +1

Query: 37  EEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLDIL 216
           E   L  + +L+E  K  K K+L   PD      +S +V          +K+ + +  + 
Sbjct: 7   ETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDESSSVEV----------NKIQEAYKVLC 56

Query: 217 DVNLGEKYTKVSKKIYEN 270
           DVNL EKY +  KK Y++
Sbjct: 57  DVNLREKYDESLKKQYKH 74

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 33.5 bits (75), Expect = 0.32
 Identities = 33/122 (27%), Positives = 49/122 (40%), Gaps = 5/122 (4%)
 Frame = +1

Query: 298 EEMRSPGLVYVSYWDEESDEPMLFL-----SFMLTEEDGFTEDDKLLSVVYLYEIQILPS 462
           EE  +  ++     DE S   +LF      +F+   +     +D     V L  I IL  
Sbjct: 51  EESFNDAVLKKEILDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQK 110

Query: 463 LRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELT 642
            + + LG R+L + + D              Y    I L V+  N+ AI FYK  G E+T
Sbjct: 111 YQGKGLG-RVLMDKVHDIAQ----------SYGKKKIWLGVWEHNQKAIDFYKKFGFEIT 159

Query: 643 PD 648
            D
Sbjct: 160 GD 161

>KLTH0H16060g Chr8 (1383120..1384904) [1785 bp, 594 aa] {ON} weakly
           similar to uniprot|P03874 Saccharomyces cerevisiae
           YHL038C CBP2 Protein required for splicing of COB aI5
           intron Cytochrome B pre-mRNA processing protein
          Length = 594

 Score = 32.7 bits (73), Expect = 1.0
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 8/96 (8%)
 Frame = +1

Query: 211 ILDVNLGEKYTK--VSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE------ESDEPML 366
           I D  L E+Y K  V   +YENA+  +   + E +    VY+S WDE      E    + 
Sbjct: 330 ICDSQLKEEYCKATVLYNLYENAQRIQKRLISENKLTHEVYLSLWDELILLRLEELNKLT 389

Query: 367 FLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNR 474
            +  + T   G T+ D+ L  + LY   +   LR +
Sbjct: 390 LVEDLNTMIRGKTKFDEFLLDLNLYNTIVNAELRGK 425

>KNAG0D02590 Chr4 complement(456578..458311) [1734 bp, 577 aa] {ON}
           Anc_8.82 YPL007C
          Length = 577

 Score = 32.0 bits (71), Expect = 1.8
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 8/90 (8%)
 Frame = +1

Query: 403 TEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLE----YPLIG 570
           T+D K+  V  L E  I+P LR R+    ++      +C     + GELL     +P + 
Sbjct: 250 TKDTKMFRVDPLQEFHIIPLLRTRE----VVFLSNSSSCKLNLDQAGELLSEDIIFPNLE 305

Query: 571 IELTVFSDNENAIKFYKSI----GMELTPD 648
            +L  +++  N +K YKS     G+ L+PD
Sbjct: 306 RKLKKWNEVWNPLKKYKSTLFIHGVALSPD 335

>KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {ON}
           similar to uniprot|P30777 Saccharomyces cerevisiae
           YGL142C GPI10 Integral membrane protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           putative alpha 1 2 mannosyltransferase required for
           addition of the third mannose onto the GPI core
           structure human PIG-Bp is a functional homolog
          Length = 597

 Score = 32.0 bits (71), Expect = 1.8
 Identities = 20/56 (35%), Positives = 27/56 (48%)
 Frame = +1

Query: 178 QGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 345
           QG K L  ++D  D      Y  + K +Y+N  P      +E+RSPG VY   W E
Sbjct: 497 QGKKKLSDYMDESDY----LYENIPKFVYKNFPPVF---RKELRSPGKVYTHEWPE 545

>KNAG0J01500 Chr10 complement(275375..278119) [2745 bp, 914 aa] {ON}
           Anc_8.638 YOR219C
          Length = 914

 Score = 32.0 bits (71), Expect = 2.0
 Identities = 34/145 (23%), Positives = 59/145 (40%), Gaps = 25/145 (17%)
 Frame = -1

Query: 441 VKINHRQ*LIILSKSIF--FRQHKT*KQHWL----IRFLVPVTNIH*PWRTHLFQFIHFP 280
           V+I+HR   II   +I   FR H +   +W+     + ++P+T            F+HF 
Sbjct: 237 VRISHRLDKIIFGTNIQPGFR-HSSKGYYWIKDVDSQEIIPITPFRGSTEPEAISFVHFS 295

Query: 279 RSSILIYFLRHFSILLTKIHIQDIQKLIQHLITLIRGTLHIHN-------VLRVLAARTI 121
            +   IYF     +    I++Q +   +  +     G+  + N          VLA+ + 
Sbjct: 296 PNYNFIYF-----VYENNIYLQPVNHNVAPMSLTTDGSGAVRNGKPDWIYEEEVLASESA 350

Query: 120 IW------------FNNKNLPLQTF 82
           +W            FN+ N+PL TF
Sbjct: 351 VWWAPDDSKVIFAKFNDTNVPLYTF 375

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 32.0 bits (71), Expect = 2.0
 Identities = 21/65 (32%), Positives = 32/65 (49%)
 Frame = +1

Query: 490 LLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVA 669
           LLAE ++   ++LR E    LE+ +   +L   S    A  ++    M    DS RD+V+
Sbjct: 198 LLAEEIEPKLNKLRGEKRIFLEFQVTQTDLEKISRVVTAFDYH---NMSTRRDSARDKVS 254

Query: 670 HLERR 684
             ERR
Sbjct: 255 SNERR 259

>Kwal_33.13421 s33 complement(215424..215615) [192 bp, 63 aa] {OFF}
           [contig 117] FULL
          Length = 63

 Score = 28.9 bits (63), Expect = 2.7
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = -3

Query: 556 TPIIHHSHSVIENMHLEDVQQVNESPISDFEVMVIFESRKDKPQTITYHP 407
           T II+H+ +V+  +HL+DV   N+   S     V++ +   KP  IT  P
Sbjct: 2   TFIINHNVTVVTILHLQDV--ANDGVSSQTGRKVVYSTAVFKPSWITIRP 49

>Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR092W
            (REAL)
          Length = 1433

 Score = 31.2 bits (69), Expect = 3.6
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 7/81 (8%)
 Frame = +1

Query: 352  DEPMLFLSFMLTEEDGFTEDDKLLSVVYL----YEIQILPSLRNRKLGTRLLAEHLQD-- 513
            D      ++ L E  GF  DD   S   L    YE++  PS+RN+ +   +L + L+   
Sbjct: 851  DHDSTSFNYALDEAAGFNRDDSKKSFSSLWEKNYELKPPPSIRNQSIAPDVLQKLLESDA 910

Query: 514  -ACSRLRSENGELLEYPLIGI 573
             + + L+S+N E +    +G+
Sbjct: 911  KSVTELKSDNEEEINVAHMGL 931

>Kpol_541.3 s541 complement(7377..11672) [4296 bp, 1431 aa] {ON}
           complement(7377..11672) [4296 nt, 1432 aa]
          Length = 1431

 Score = 30.8 bits (68), Expect = 4.7
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 5/82 (6%)
 Frame = -3

Query: 658 LLVNQASIPFQSICKIL*HSHYH*IQSI-----QCQLMDTPIIHHSHSVIENMHLEDVQQ 494
           LL N     F +  K+L     H + SI     +  + + P   H+  +I+   L+D+ Q
Sbjct: 262 LLKNSQKEMFYAFIKLLPDGKPHQLLSILKIGQELSIEEEPF--HNEKLIKLQVLQDLLQ 319

Query: 493 VNESPISDFEVMVIFESRKDKP 428
           +++  +S FE++  F S+K KP
Sbjct: 320 IDDYKLSAFELLT-FSSKKSKP 340

>Suva_13.14 Chr13 complement(14928..16457) [1530 bp, 509 aa] {ON}
           YML128C (REAL)
          Length = 509

 Score = 30.4 bits (67), Expect = 5.5
 Identities = 40/150 (26%), Positives = 69/150 (46%), Gaps = 11/150 (7%)
 Frame = +1

Query: 31  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLD 210
           + E    T E   Q++L  L+   L  +    TSG+  +D V+ K S+DQ    L+    
Sbjct: 194 VKENIYKTSEKAEQQRLGVLESLDLAHQQILDTSGQ-IKDTVFDKWSSDQLSNWLENHKV 252

Query: 211 ILDVNLGEKYTKVSKKIYENARP------WKVNKLEEMRSPGLV----YV-SYWDEESDE 357
            LD N+ +K+  + +   EN+        W ++ ++   SP L     YV S WD  ++ 
Sbjct: 253 KLDKNMAKKHDYLVRMAKENSDNLKDDIYWYLDYMKRESSPFLAKTPEYVGSVWDSTTN- 311

Query: 358 PMLFLSFMLTEEDGFTEDDKLLSVVYLYEI 447
               LS + ++  G T  D L++  +L +I
Sbjct: 312 ---CLSNLFSKFRGKT--DNLINDTFLVDI 336

>ADR225W Chr4 (1097826..1098536) [711 bp, 236 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR077W (RTS2)
          Length = 236

 Score = 30.0 bits (66), Expect = 5.6
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 5/65 (7%)
 Frame = +1

Query: 235 KYTKVSKKIYENARPWK-----VNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLTEEDG 399
           +YT ++K I   ++  K     V +LEE   PG + +SY D  SD  +        EE+ 
Sbjct: 108 RYTSLTKFIQHLSKTGKIRVHGVEELEEDMDPGQILISYIDNSSDNMLKKDKLRELEEND 167

Query: 400 FTEDD 414
             E+D
Sbjct: 168 KHEED 172

>YNL144C Chr14 complement(352820..355042) [2223 bp, 740 aa] {ON}
           Putative protein of unknown function; non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies; contains a PH domain and binds
           phosphatidylinositols and phosphatidylethanolamine in a
           large-scale study
          Length = 740

 Score = 30.4 bits (67), Expect = 5.9
 Identities = 27/109 (24%), Positives = 48/109 (44%)
 Frame = +1

Query: 118 DNCTSGKNSQDVVYMKCSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKL 297
           +N  S  NS  +  ++C  D+    ++ F  + +   G   + +S       R  K+N+ 
Sbjct: 495 ENFRSRSNSNPIDPLRC--DRSVLKINNFEPVYE---GTGRSTISNSAERTNREEKLNRG 549

Query: 298 EEMRSPGLVYVSYWDEESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYE 444
            E  +         DE+ DE     ++   +EDG+ EDD +  +VYL E
Sbjct: 550 NEDVNG--------DEDDDEDEDDANYEEDDEDGYVEDDDINRLVYLDE 590

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 30.0 bits (66), Expect = 6.5
 Identities = 21/71 (29%), Positives = 38/71 (53%)
 Frame = +1

Query: 64  TLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLDILDVNLGEKYT 243
           +L++  + +K     IE D  T  K    + + K + ++ ++ LD +  +LD+  GEK T
Sbjct: 141 SLKQYEQAVKDAEQAIEVDP-TYSKGFSRLGFAKYALNKPEEALDAYKKVLDIE-GEKAT 198

Query: 244 KVSKKIYENAR 276
            V K+ YE A+
Sbjct: 199 DVMKRDYETAK 209

>TPHA0L00490 Chr12 complement(82007..82879) [873 bp, 290 aa] {ON} 
          Length = 290

 Score = 29.6 bits (65), Expect = 8.1
 Identities = 13/50 (26%), Positives = 28/50 (56%)
 Frame = +2

Query: 485 LVYLLNIFKMHVLDYGVRMVNYWSIH*LALN*LYLVIMRML*NFTNRLEW 634
           L+ +LNI  +++L Y +  + YWS+    ++ +Y  +M  +  F+  + W
Sbjct: 42  LMQVLNILSLYLLTYTIVSILYWSV----MSSVYSFLMPFMGTFSKNIFW 87

>Smik_15.78 Chr15 (135387..144617) [9231 bp, 3076 aa] {ON} YOL081W
           (REAL)
          Length = 3076

 Score = 30.0 bits (66), Expect = 8.5
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 4/93 (4%)
 Frame = -1

Query: 342 VPVTNIH*PWRTHLFQFIHFPRSSILIYFLRHFS----ILLTKIHIQDIQKLIQHLITLI 175
           VPVT  H    TH     H   SS+    + HF     I LTK + +   +LI++L   +
Sbjct: 267 VPVTQTH----THSHSHSHSLSSSVYNSIIPHFDLFSFIYLTKHNFKRYLELIRNLSMAL 322

Query: 174 RGTLHIHNVLRVLAARTIIWFNNKNLPLQTFEL 76
           R +++   +L   A   + W   +  P + +EL
Sbjct: 323 RKSIYHCLLLHFSAKAIMFWIMAR--PAEYYEL 353

>YLL040C Chr12 complement(54211..63645) [9435 bp, 3144 aa] {ON}
           VPS13Protein of unknown function; heterooligomeric or
           homooligomeric complex; peripherally associated with
           membranes; involved in sporulation, vacuolar protein
           sorting, prospore membrane formation and protein-Golgi
           retention; homologous to human CHAC and COH1 which are
           involved in chorea acanthocytosis and Cohen syndrome,
           respectively
          Length = 3144

 Score = 30.0 bits (66), Expect = 8.5
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 3/42 (7%)
 Frame = +1

Query: 340 DEESDEPMLFLSFMLTEEDGFTEDD---KLLSVVYLYEIQIL 456
           +EE DEP+L  SF L   DG  + +   KLL +   Y +  +
Sbjct: 598 EEEEDEPLLRASFELNPLDGLADSNLNIKLLGMTVFYHVHFI 639

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 29.6 bits (65), Expect = 9.1
 Identities = 27/84 (32%), Positives = 37/84 (44%)
 Frame = +1

Query: 424 SVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNEN 603
           S VYLY+      LRN K     ++ H +DA + L           + G+ ++  SDN  
Sbjct: 274 SYVYLYD------LRNMKEPLHHMSGH-EDAVNNLEFSTH------VDGVVVSSGSDNRL 320

Query: 604 AIKFYKSIGMELTPDSPRDRVAHL 675
            +   K IG E TPD   D V  L
Sbjct: 321 MMWDLKQIGAEQTPDDAEDGVPEL 344

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,215,247
Number of extensions: 1859440
Number of successful extensions: 5749
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5702
Number of HSP's successfully gapped: 37
Length of query: 261
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 154
Effective length of database: 41,212,137
Effective search space: 6346669098
Effective search space used: 6346669098
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)