Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026402.532ON26026013820.0
NDAI0I022702.532ON2772736553e-85
KAFR0A018502.532ON2562715404e-68
CAGL0K02981g2.532ON2782654679e-57
TPHA0C041802.532ON2642524406e-53
SAKL0A09460g2.532ON2402494318e-52
Kpol_1018.342.532ON2922704174e-49
TDEL0A030602.532ON2442234031e-47
KNAG0C058202.532ON2711983763e-43
YMR069W (NAT4)2.532ON2852673652e-41
Smik_13.2482.532ON2552653604e-41
ZYRO0B01980g2.532ON1881663223e-36
Skud_13.2252.532ON2542193187e-35
KLTH0D06820g2.532ON2602722796e-29
TBLA0G022202.532ON2782082711e-27
Suva_13.2442.532ON2572192603e-26
Kwal_26.80162.532ON2402522061e-18
Ecym_72562.532ON2432181303e-08
KLLA0E18569g2.532ON215166984e-04
KLLA0A12089gsingletonON181110760.22
ZYRO0C03806g8.376ON46562780.25
Suva_12.1797.463ON143375721.3
NDAI0G023208.376ON46349702.1
KNAG0L011607.186ON117065702.4
KLLA0D18095g8.376ON46953692.6
Smik_12.2258.376ON46249692.8
KNAG0A027608.376ON46749692.8
YLR163C (MAS1)8.376ON46249692.9
Suva_10.2608.376ON46249693.0
Skud_12.2308.376ON46249693.0
NCAS0C029708.376ON46149683.3
TDEL0F050008.376ON45659683.8
KNAG0D025908.82ON57791683.9
KLLA0B06457g2.490ON104632675.5
Ecym_41918.376ON46253666.1
YEL056W (HAT2)6.9ON40184666.4
SAKL0H14168g8.376ON46149666.6
KLTH0F09570g2.334ON59756666.7
NOTE: 1 genes in the same pillar as NCAS0D02640 were not hit in these BLAST results
LIST: Agos_YGOB_Anc_2.532

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02640
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   536   0.0  
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   256   3e-85
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   212   4e-68
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   184   9e-57
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   174   6e-53
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   170   8e-52
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   165   4e-49
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...   159   1e-47
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...   149   3e-43
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   145   2e-41
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   143   4e-41
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...   128   3e-36
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...   127   7e-35
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   112   6e-29
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...   108   1e-27
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...   104   3e-26
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    84   1e-18
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    55   3e-08
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    42   4e-04
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    34   0.22 
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    35   0.25 
Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR09...    32   1.3  
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    32   2.1  
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    32   2.4  
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    31   2.6  
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    31   2.8  
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    31   2.8  
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    31   2.9  
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    31   3.0  
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    31   3.0  
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     31   3.3  
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    31   3.8  
KNAG0D02590 Chr4 complement(456578..458311) [1734 bp, 577 aa] {O...    31   3.9  
KLLA0B06457g Chr2 complement(570933..574073) [3141 bp, 1046 aa] ...    30   5.5  
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    30   6.1  
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    30   6.4  
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    30   6.6  
KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {...    30   6.7  

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ 60
           MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ
Sbjct: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQ 60

Query: 61  GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP 120
           GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP
Sbjct: 61  GDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEP 120

Query: 121 MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 180
           MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN
Sbjct: 121 MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 180

Query: 181 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS 240
           GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS
Sbjct: 181 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTS 240

Query: 241 VGRTIVQKPIYYLFYLPLSI 260
           VGRTIVQKPIYYLFYLPLSI
Sbjct: 241 VGRTIVQKPIYYLFYLPLSI 260

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  256 bits (655), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/273 (50%), Positives = 185/273 (67%), Gaps = 19/273 (6%)

Query: 5   EAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSG--KNSQDVVYMKCSTDQGD 62
           +A  +++ EEFP  L+    + +   +R+I      +  S   ++S +V  +     Q  
Sbjct: 7   DALLNIVCEEFPTILQSA--DGVTTWRRRIHHKPSHDEVSIPIEHSSEVYNLSSDPQQRS 64

Query: 63  KMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPML 122
            +L++FL+ILDVNLG KYTKVSK IYEN + WK NKLEEM SPGL+YVSYWDE+  EP+L
Sbjct: 65  DVLNKFLNILDVNLGAKYTKVSKTIYENDKSWKSNKLEEMLSPGLIYVSYWDEKYQEPLL 124

Query: 123 FLSFMLTEEDGFT-----------EDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQD 171
           FLSFMLTE DGF             +D+L+SV+YLYEIQILP LR + +GT+LL+ HL  
Sbjct: 125 FLSFMLTEGDGFIGTHSNDDDENEHNDQLMSVIYLYEIQILPQLRGQGIGTKLLSVHLHQ 184

Query: 172 ACSRLRSENG-ELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT 230
            CS L ++ G + L YPL+GIELTVFSDN  AI FYKSIGM+LTPDSP D V  +E+R+T
Sbjct: 185 CCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQIEKRQT 244

Query: 231 RGMAQ--NIST-SVGRTIVQKPIYYLFYLPLSI 260
           R + +  N  T  V + I++KP+YYL+YLP+ +
Sbjct: 245 RNLRRINNAGTREVTKQIIKKPVYYLYYLPIDL 277

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  212 bits (540), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 130/271 (47%), Positives = 167/271 (61%), Gaps = 31/271 (11%)

Query: 1   MHAFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILII-----EPDNCTSGKNSQDVVYMK 55
           +  F  F  ++ +EFP  L    Q     LKRKIL I     E     S  N QD +  K
Sbjct: 4   IEIFNGFLKIVSDEFPKELRTKGQN----LKRKILYIASEDEENKESDSVINEQDDL-TK 58

Query: 56  CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115
            +   G K+LD FL+ILD NLG KY K+S++IY+N   WK NKL EM+SPGL+YVSYW E
Sbjct: 59  FTEGIGSKLLDSFLEILDNNLGNKYEKISREIYDNNDSWKKNKLVEMKSPGLIYVSYWKE 118

Query: 116 ESDEP--MLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRL---LAEHLQ 170
           E+++    LFLSFMLTEED   +D +  SV+YLYEIQ++   R  +LGTRL   L+   Q
Sbjct: 119 EAEKKTCALFLSFMLTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQ 178

Query: 171 DACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT 230
            A  ++R        +PLIGI+LTVFSDN+ AIKFY+ IGM+ T  SP+D V  +E R+T
Sbjct: 179 IAQVKIRP------AFPLIGIQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKT 232

Query: 231 RGMAQNISTSVGR---TIVQKPIYYLFYLPL 258
           R       TSV R    +V+KPIYYL YLP+
Sbjct: 233 R-------TSVNRKTLKVVRKPIYYLLYLPV 256

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  184 bits (467), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 163/265 (61%), Gaps = 11/265 (4%)

Query: 5   EAFSHMILEEFP--LTLEVTLQEQLK--CLKRKILIIEPDN-CTSGKN-SQDVVYMKCST 58
           ++F H +L+ FP  +T +  L + ++   L+RK+L+I+ D+ C + K  + +VV      
Sbjct: 13  DSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVLRSKHI 72

Query: 59  DQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW---DE 115
            +   +L   L++LD NLG+KY   SK++Y N +PWK NK+EEM + G++YVSYW   D+
Sbjct: 73  KESKNILSSLLELLDQNLGQKYEISSKEMYGNKKPWKENKIEEMNTEGMIYVSYWTKVDD 132

Query: 116 ESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 175
           E   P+LFLSFMLTEE+  T +D + SV++LYEIQI   LR + LG   L+  L     R
Sbjct: 133 EHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCLFQCAKR 192

Query: 176 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQ 235
           L   +   LE+P  GIELTVF+DN  AI  Y+ +GM  TP+SP+D +     RR    ++
Sbjct: 193 LLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSR 252

Query: 236 NISTS--VGRTIVQKPIYYLFYLPL 258
            I+      R +++KP+YY+++ P+
Sbjct: 253 KINNKNESPRILIKKPLYYMYWKPI 277

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score =  174 bits (440), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 105/252 (41%), Positives = 161/252 (63%), Gaps = 18/252 (7%)

Query: 20  EVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVV---YMKCSTDQGDKMLD--QFLDILDV 74
           E+ + + L  L +KI++++ +     KNS ++    Y+  S ++ +  ++  + L ILD 
Sbjct: 18  EIYVNKNLTKLVKKIIVVDSE-TEDIKNSAELYNGRYLTYSQNKEECEIEFSKILTILDN 76

Query: 75  NLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSY-WDEESDEPMLFLSFMLTEEDG 133
           NLG+ YT  +KK+Y N++PWK NK++EM++ GL+YV Y  ++E     L+LSF LT+E G
Sbjct: 77  NLGDIYTIKNKKLYGNSKPWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYLSFTLTKESG 136

Query: 134 FTEDDKLLS-VVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIE 192
           F  D  + S V+YLYEIQ+ P +RN  LGT+L+A +L+D    +     E +   +IGIE
Sbjct: 137 FLPDIDVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVH----ENIHKDIIGIE 192

Query: 193 LTVFSDNENAIKFYKSIGMELTPDSPRDR-VAHLERRRTRGMAQNISTS-----VGRTIV 246
           LTVFSDN NAI+FY++IGM+LTPDSP D+ + +  R +TR    +   S        ++V
Sbjct: 193 LTVFSDNTNAIRFYETIGMKLTPDSPNDKTINYGHRIKTRSQNSSKKGSSSDKPTSLSVV 252

Query: 247 QKPIYYLFYLPL 258
           +KP YYL+YLPL
Sbjct: 253 KKPDYYLYYLPL 264

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  170 bits (431), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 148/249 (59%), Gaps = 22/249 (8%)

Query: 11  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSG-KNSQDVVYMKCSTDQGDKMLDQFL 69
           +L+ FP +  +TL++      RK+L+I  D  +SG   S  V          + +L QFL
Sbjct: 13  VLDSFPTS--ITLKDG-SLATRKVLVI--DEPSSGIAPSGQVCTWSGDRQSSNSLLIQFL 67

Query: 70  DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLT 129
            +LD+NLG KY  VS  +Y N R W  NKLEEM++ GLVYV Y+   S  P++FLSF+LT
Sbjct: 68  KVLDLNLGSKYRSVSATLYGNTRSWTENKLEEMQTIGLVYVGYFQGVS--PLMFLSFLLT 125

Query: 130 EEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLI 189
           +E  F  D   + VVYLYEIQ+LP ++ ++LGT++L  +L++    L       L+  L 
Sbjct: 126 DEPDFLPDP--VKVVYLYEIQLLPEVQGQRLGTQMLQVYLKNTVHSLSR-----LDPLLK 178

Query: 190 GIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVGRTIVQKP 249
           GIELTVFSDN+ A+  Y SIGM L P SP D +A   +RRTR    ++ T      V +P
Sbjct: 179 GIELTVFSDNDAALHLYYSIGMALAPGSPTDEIAT-SQRRTRHSTTDLQT------VSRP 231

Query: 250 IYYLFYLPL 258
            YYL +LP+
Sbjct: 232 DYYLMFLPV 240

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  165 bits (417), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 156/270 (57%), Gaps = 31/270 (11%)

Query: 15  FPLTLEV-----TLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFL 69
           FP TLE+     +   Q K L R+++ I+  N      +  + Y K +  + D +L++ L
Sbjct: 15  FPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYKDNV-KCDVVLNKLL 73

Query: 70  DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSFMLT 129
           DILD NLG  Y + S KIY N +PWK NK+ EM+S GL+YV Y D+ + EP+LF+SFM+T
Sbjct: 74  DILDNNLGPIYLEKSSKIYCNEKPWKENKIVEMKSEGLLYVIYNDDITKEPLLFMSFMIT 133

Query: 130 EEDGF---TEDD------KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSEN 180
           ++      T++D         +V+YLYEIQ+L  +RN+KLGT L+  +L+     L  + 
Sbjct: 134 DDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGTILITNYLKKTIEILNKD- 192

Query: 181 GELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGM------- 233
               +  +I +ELTVFS+N NAI FYK IGM  TPDSPRD++   ++RRTR         
Sbjct: 193 ---YQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRDKIILPQKRRTRSTTIALESK 249

Query: 234 ----AQNISTSVGRTIVQKPI-YYLFYLPL 258
               +  ++TS     + K   YYL +LP+
Sbjct: 250 NNEPSSRLTTSKPIKKIIKKPDYYLLFLPI 279

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score =  159 bits (403), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 93/223 (41%), Positives = 128/223 (57%), Gaps = 26/223 (11%)

Query: 13  EEFPLTLE---VTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFL 69
           + FP T+    + L  +L  +  +   +E D C S        Y+  S  + +K+L Q L
Sbjct: 15  QNFPTTINAAGIQLTRKLLAIDTEEYPVETDQCIS--------YVH-SPREAEKLLWQLL 65

Query: 70  DILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESD----------E 119
           +ILD NLG+KY   S+ +Y N RPW+VNK  EM +PGLVYV Y    +            
Sbjct: 66  EILDENLGQKYAGSSRALYHNTRPWRVNKWREMLTPGLVYVIYSTAATTTATQRRNAPFS 125

Query: 120 PMLFLSFMLTEEDGFTEDD--KLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRL- 176
           P+LFLSFMLTEEDG   DD  ++ +V+YLYE+Q+LP +R   L  RLL +HL     +L 
Sbjct: 126 PLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRRLGLAARLLGDHLAQCGRQLC 185

Query: 177 -RSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSP 218
            RS  G   +    G+ELTVF+DN  AI+ Y+S+GM+L  DSP
Sbjct: 186 TRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAADSP 228

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score =  149 bits (376), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 120/198 (60%), Gaps = 15/198 (7%)

Query: 62  DKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPM 121
           ++ L  FL+ILD NLG  Y ++S+KIY N++ W+ NK  EM S  LVYVSYW  +S EP+
Sbjct: 80  ERCLRIFLEILDNNLGPVYARLSRKIYGNSKHWRENKWLEMLSAQLVYVSYWVSDS-EPV 138

Query: 122 LFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENG 181
           L+ SFMLTEE+G +  +    VVYLYEIQ++ ++R +KLG  +++   + A         
Sbjct: 139 LYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIVSYLTECA--------- 189

Query: 182 ELLEYP-LIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRT--RGMAQNIS 238
             LE P +  + LTVFSDNE A+KFY+ +    T DSPRD V    RRRT  R       
Sbjct: 190 --LESPEVAAVALTVFSDNEKALKFYERLNFTYTIDSPRDEVTEKPRRRTAARTALDPAR 247

Query: 239 TSVGRTIVQKPIYYLFYL 256
            S  +  ++KP YYL YL
Sbjct: 248 DSDVKVTIKKPTYYLLYL 265

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  145 bits (365), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/267 (34%), Positives = 138/267 (51%), Gaps = 27/267 (10%)

Query: 4   FEAFSHMILEEFPLTLEVTLQE-----QLKCLKRKILIIEPDNCTS--GKNSQDVVYMKC 56
           F+ F ++ +E+FP ++E    +         L+R+I+ I  D+  S    +S   +  K 
Sbjct: 33  FQHFLNLCVEKFPESIEHKDTDGNGNFTTAILEREIIYIPEDDTDSIDSVDSLKCINYKL 92

Query: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 116
              +GD++LD  + ++D +LG KY + S+ +Y N +PWK NKL EM+S GLVYV YWD  
Sbjct: 93  HKSRGDQVLDACVQLIDKHLGAKYRRASRIMYGNRKPWKANKLAEMKSAGLVYVCYWD-- 150

Query: 117 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQDA 172
           +     F SFMLTEE G  E D L    + V+YLYE+ +  + R   +G RLL   L D 
Sbjct: 151 NGVLGAFTSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDG 210

Query: 173 CSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRG 232
            +R    +   +     G+ LTVFSDN  A + Y+++G    P SP      +   R  G
Sbjct: 211 VAR----HTRRMCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSPAPASPTIRHTRHGG 266

Query: 233 MAQNISTSVGRTIVQ-KPIYYLFYLPL 258
                    GR +V   P+YY++ L +
Sbjct: 267 ---------GRVVVPCDPLYYVYCLHM 284

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 90/265 (33%), Positives = 133/265 (50%), Gaps = 26/265 (9%)

Query: 4   FEAFSHMILEEFPLTLEVTLQE------QLKCLKRKILIIEPDNCTSGKNSQ--DVVYMK 55
           F  F  + +++FP TLE T  +          LKR++L I   +  S  N +    V  +
Sbjct: 2   FHQFLKICMQDFPETLEYTNTDGNNGTATTTVLKREMLFIPEGDSNSQDNIEIPTCVNYR 61

Query: 56  CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115
               +G+ +LD  + ++D +LG KY + S+ +Y N +PWK NKL EM+SP LVYVSYWD 
Sbjct: 62  LHKSRGNHILDSCVQLIDEHLGAKYRRASRTMYGNRKPWKANKLAEMKSPNLVYVSYWD- 120

Query: 116 ESDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQD 171
            +     F SFMLTEE G  E D      + V+YLYE+ +    R   +G RLL   L +
Sbjct: 121 -NGALAAFASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCE 179

Query: 172 ACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTR 231
             +R    +   L     G+ LTVFSDN  A + Y+++G    P SP         R TR
Sbjct: 180 GVAR----HVRCLYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSP--AAGAPTTRPTR 233

Query: 232 GMAQNISTSVGRTIVQKPIYYLFYL 256
              + +       + + P+YY++ L
Sbjct: 234 HGGERV------VVPRDPLYYVYCL 252

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score =  128 bits (322), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 99/166 (59%), Gaps = 12/166 (7%)

Query: 56  CSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115
           C ++  DK+L++ L ++++NLG  Y K +K IY+N + W+ NK +EM S  L +VSYW+ 
Sbjct: 12  CISNSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKRWQSNKWQEMCSENLFHVSYWNV 71

Query: 116 ESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSR 175
           ES+E + F S M  EE     + ++ +++YLYEI + P  RN+K G  +L    +  C +
Sbjct: 72  ESNELVCFCSIMPCEES--IVEGEMSNIIYLYEIHVAPEWRNQKFGKSILNALKEKLCPK 129

Query: 176 LRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDR 221
                       L GIELTVFS NE AI FY++ G  L+ DSP D+
Sbjct: 130 AH----------LSGIELTVFSSNERAINFYRNNGFTLSYDSPSDK 165

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score =  127 bits (318), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 111/219 (50%), Gaps = 17/219 (7%)

Query: 4   FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILIIEPDNC-TSGKNSQDVVYMKC 56
           F+ F  + ++EFP TLE T   +         LKR+I+ I  +N      +         
Sbjct: 2   FKKFLSICIDEFPETLEYTESNENATVVTTTVLKREIMYIPEENGEVDSIDGPQCTNYNL 61

Query: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEE 116
               GD +LD  + ++D +LG+KY + S+ +Y N  PWK NKL EM+S GL+YVSYW   
Sbjct: 62  HKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYGNRIPWKANKLAEMKSAGLLYVSYWGNG 121

Query: 117 SDEPMLFLSFMLTEEDGFTEDDKL----LSVVYLYEIQILPSLRNRKLGTRLLAEHLQDA 172
           +     F SFMLTEE G  E D      + V+YLYEI +  + R   LG RLL   L + 
Sbjct: 122 ALGA--FASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVAHAHRGHGLGRRLLERALCEG 179

Query: 173 CSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGM 211
            +R        +     G+ LTVF DN  A + Y++IG 
Sbjct: 180 VARRVRR----VRCDFFGVALTVFGDNTRARRLYEAIGF 214

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  112 bits (279), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 134/272 (49%), Gaps = 33/272 (12%)

Query: 3   AFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGD 62
           A E F H + + FPL L  TL    + L R +  I P + T  +  ++        + G 
Sbjct: 6   ASELFPH-VTQCFPLVL--TLPNGQQQLTRAVYGI-PSDATQHEERREPRAAGPKPEPGP 61

Query: 63  K--------------MLDQFLDILDVNLGEKYTKVSKKIYENAR-PWKVNKLEEMRSPGL 107
                          +LDQ L ++  NLG  YT+ ++ IY   R  W   K  EM +PGL
Sbjct: 62  TPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGL 121

Query: 108 VYVSYWDEESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAE 167
           VYV Y D  S +P++F+S +LT+E    ++     V+YL+EI +   +R + LGT LL +
Sbjct: 122 VYVVYSDSHS-QPLVFMSLLLTDEPELGQE-LAARVLYLFEIHVSDIIRGQGLGTHLLRD 179

Query: 168 HLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLER 227
            L    + L   +  +L     G ELTVFS+N+ A++ Y ++GM +   SP+DR A +  
Sbjct: 180 CLGGTLASLSRASPSVL-----GAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQV-- 232

Query: 228 RRTRGMAQNISTSVGRTIVQKPIYYLFYLPLS 259
                  +  + +   ++V +P YY+ + P +
Sbjct: 233 -----RRRTRAIAYDSSLVTRPAYYILFWPAA 259

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score =  108 bits (271), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 111/208 (53%), Gaps = 18/208 (8%)

Query: 67  QFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDEESDEPMLFLSF 126
           Q   ++D NLG+ Y K SKKIYEN   W +NK EEM +  ++Y++YWD + +   LFLS 
Sbjct: 73  QIFQLIDENLGKLYKKKSKKIYENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLSI 132

Query: 127 MLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEY 186
           +  EE    E++    V+YLYEI I    + + +G RL+ ++L +    ++    E  + 
Sbjct: 133 LSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKL--IKPLKIERQDN 190

Query: 187 PLIGIELTVFSDNENAIKFY-KSIGMELTPDSPRDRVAHLERRRTRGMAQNIS------- 238
             IG+ELTVFS+N +A  FY   I M+ T  SPRD + ++ +R TR   + +        
Sbjct: 191 NFIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRDEIINVMKRITRSFDEKLGEHCEDNK 250

Query: 239 --------TSVGRTIVQKPIYYLFYLPL 258
                     + R  ++KP YY+   P+
Sbjct: 251 LPSLNDKKKQLYRKSIRKPEYYILVFPV 278

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score =  104 bits (260), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 111/219 (50%), Gaps = 20/219 (9%)

Query: 4   FEAFSHMILEEFPLTLEVTLQEQ------LKCLKRKILII-EPDNCTSGKNSQDVVYMKC 56
           F+ F  + +EEFP TL+ T  +          L+R+++ + E D    G ++ + +  K 
Sbjct: 2   FQQFLSICMEEFPQTLDYTGSDDENGDSTTTLLRRQMMYMPEDDGDDGGIDTPECMNYKL 61

Query: 57  STDQGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYW--D 114
               GD+ L   + ++D +LG KY + S+ +Y N  PWK NKL EM+S GLVYV YW  D
Sbjct: 62  HKADGDQTLHSCVQLVDEHLGAKYRRASRTMYGNRLPWKANKLAEMKSAGLVYVCYWGND 121

Query: 115 EESDEPM-LFLSFMLTEEDGFTEDD----KLLSVVYLYEIQILPSLRNRKLGTRLLAEHL 169
            + +  +  F SFMLTEE G  E D    + + V+YLYE+      R         A   
Sbjct: 122 AQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGLGRRLLAKAL-C 180

Query: 170 QDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKS 208
           +   +R+R    +L      G+ LTVF DN  A + Y+S
Sbjct: 181 EGVAARVRRTCDDLF-----GVALTVFGDNTRARRLYES 214

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 116/252 (46%), Gaps = 32/252 (12%)

Query: 11  ILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGDKMLDQFLD 70
           + + FP TL +   ++++   R +  +  D   S     D     C       +L+Q L 
Sbjct: 13  VTDSFPTTLTLASGQRIQ---RAVYGVPMDTVRSRAEIPD----PC-------LLEQLLA 58

Query: 71  ILDVNLGEKYTKVSKKIY-ENARPWKVNKLEEMRSPGLVYVSYW--DEESD-EPMLFLSF 126
           ++D NLG  Y + +K +Y +    WK  K +EM +PGLVYV Y   DEE+  E +     
Sbjct: 59  LVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFL 118

Query: 127 MLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEY 186
            L   D         +VVYL EI +   +R   LG  LL E +           G    +
Sbjct: 119 SLLLTDEPELGPAPAAVVYLMEIHVADIIRGLGLGGTLLREGVAGTV------RGARRAH 172

Query: 187 PLI-GIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLERRRTRGMAQNISTSVGRTI 245
           P I G ELTVF+DNE A++ Y  +GM++   SP+D    +  RRTR      +T      
Sbjct: 173 PFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVH-RRTR------ATRYESRK 225

Query: 246 VQKPIYYLFYLP 257
           V +P YYL + P
Sbjct: 226 VTRPTYYLLFWP 237

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 87/218 (39%), Gaps = 54/218 (24%)

Query: 42  CTSGKN-SQDVVYM-KCSTDQGDKMLDQFLDILDVNLGEKYTKVSKKIYEN---ARPWKV 96
           C +G   S+D++   + S     K   Q   I++  LG  Y   +  +Y     +RPW+ 
Sbjct: 22  CRNGCTLSRDIIITDRLSVAARQKFAKQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQA 81

Query: 97  NKLEEMRSPGLVYVSYWDEESDEPML-FLSFMLTEEDGF--------------------- 134
           +K  E++  G  +V Y  E     +  F+S +  +E  +                     
Sbjct: 82  HKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHWPAGNGSRAAASTAERERGPSG 141

Query: 135 ---------TEDDKLLSVVYLYEIQILPSLRNRKLGT------RLLAEHLQDACSRLRSE 179
                    T       VVY+ EI + PS +N+ LG+      R L +H+Q +  +L+  
Sbjct: 142 RSAEPAFEETPPPPPCKVVYVMEIHVSPSFQNQGLGSCMLLCARQLVQHMQPSFPQLK-- 199

Query: 180 NGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDS 217
                     G+ELTVF+ N  A+  Y+  G +   ++
Sbjct: 200 ----------GLELTVFTGNRQALALYRRQGFKTATNT 227

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 72/166 (43%), Gaps = 32/166 (19%)

Query: 65  LDQFLDILDVNLGEKYTKVSKKIY--------ENARPWKVNKLEEMRSPGLVYVSYWDEE 116
           L + L I+  NL   Y      IY        +    W   K +EM    LVY+  +  +
Sbjct: 49  LPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVYIVLFKRD 108

Query: 117 SDEPMLFLSFMLTEEDGFTEDDKLLS--VVYLYEIQILPSLRNRKLGTRLLAEHLQDACS 174
           + + + F S  L++      D   L+   ++LYEI ++   ++R LG+ +          
Sbjct: 109 TTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLIF--------- 159

Query: 175 RLRSENGELLEYPLI------GIELTVFSDNENAIKFYKSIGMELT 214
                NG L+  PL        IEL VF+ N+ A ++YK +G +LT
Sbjct: 160 -----NGLLI--PLARDLTCPSIELCVFTANDVACRWYKRLGFQLT 198

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 44/110 (40%), Gaps = 16/110 (14%)

Query: 114 DEESDEPMLFL-----SFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEH 168
           DE S   +LF      +F+   +     +D     V L  I IL   + + LG R+L + 
Sbjct: 65  DEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTEYVELQRIYILQKYQGKGLG-RVLMDK 123

Query: 169 LQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSP 218
           + D              Y    I L V+  N+ AI FYK  G E+T D  
Sbjct: 124 VHDIAQS----------YGKKKIWLGVWEHNQKAIDFYKKFGFEITGDHS 163

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 29/62 (46%), Gaps = 4/62 (6%)

Query: 158 RKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDS 217
           R  GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + F KS    L  D 
Sbjct: 67  RNNGTAHFLEHLAFKGTKNRSQTGIELEIENIGSHLNAYTSRENTVYFAKS----LEEDV 122

Query: 218 PR 219
           PR
Sbjct: 123 PR 124

>Suva_12.179 Chr12 (277003..281304) [4302 bp, 1433 aa] {ON} YJR092W
           (REAL)
          Length = 1433

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 124 LSFMLTEEDGFTEDDKLLSVVYL----YEIQILPSLRNRKLGTRLLAEHLQD---ACSRL 176
            ++ L E  GF  DD   S   L    YE++  PS+RN+ +   +L + L+    + + L
Sbjct: 857 FNYALDEAAGFNRDDSKKSFSSLWEKNYELKPPPSIRNQSIAPDVLQKLLESDAKSVTEL 916

Query: 177 RSENGELLEYPLIGI 191
           +S+N E +    +G+
Sbjct: 917 KSDNEEEINVAHMGL 931

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 68  GTAHFLEHLAFKGTKNRSQKGIELEIENIGSHLNAYTSRENTVYYAKSL 116

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 164 LLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVA 223
           LLAE ++   ++LR E    LE+ +   +L   S    A  ++    M    DS RD+V+
Sbjct: 198 LLAEEIEPKLNKLRGEKRIFLEFQVTQTDLEKISRVVTAFDYH---NMSTRRDSARDKVS 254

Query: 224 HLERR 228
             ERR
Sbjct: 255 SNERR 259

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMEL 213
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+  ++
Sbjct: 74  GTAHFLEHLAFKGTQNRSQTGIELEIENIGSHLNAYTSRENTVYYAKSLKQDI 126

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 67  GTAHFLEHLAFKGTQNRSQQGIELEIENIGSHLNAYTSRENTVYYAKSL 115

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 70  GTAHFLEHLAFKGTKNRSQRGIELEIENIGSHLNAYTSRENTVYYAKSL 118

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 67  GTAHFLEHLAFKGTQNRSQQGIELEIENIGSHLNAYTSRENTVYYAKSL 115

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 67  GTAHFLEHLAFKGTQNRSQQGIELEIENIGSHLNAYTSRENTVYYAKSL 115

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 67  GTAHFLEHLAFKGTQNRSQQGIELEIENIGSHLNAYTSRENTVYYAKSL 115

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 66  GTAHFLEHLAFKGTQNRSQKGIELEIENIGSHLNAYTSRENTVYYAKSL 114

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 4/59 (6%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPR 219
           GT    EHL    ++ R+++G  LE   IG  L  ++  EN + + KS    L  D PR
Sbjct: 61  GTAHFLEHLAFKGTKDRTQSGIELEIENIGSHLNAYTSRENTVYYAKS----LRDDIPR 115

>KNAG0D02590 Chr4 complement(456578..458311) [1734 bp, 577 aa] {ON}
           Anc_8.82 YPL007C
          Length = 577

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 12/91 (13%)

Query: 135 TEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLE----YPLIG 190
           T+D K+  V  L E  I+P LR R++    L+     +C     + GELL     +P + 
Sbjct: 250 TKDTKMFRVDPLQEFHIIPLLRTREV--VFLSN--SSSCKLNLDQAGELLSEDIIFPNLE 305

Query: 191 IELTVFSDNENAIKFYKSI----GMELTPDS 217
            +L  +++  N +K YKS     G+ L+PD 
Sbjct: 306 RKLKKWNEVWNPLKKYKSTLFIHGVALSPDG 336

>KLLA0B06457g Chr2 complement(570933..574073) [3141 bp, 1046 aa]
           {ON} similar to uniprot|P33314 Saccharomyces cerevisiae
           YKL092C BUD2 GTPase activating factor for Rsr1p/Bud1p
           required for both axial and bipolar budding patterns
           mutants exhibit random budding in all cell types
          Length = 1046

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 9/32 (28%)

Query: 23  LQEQLKCLKRKILIIEPD---------NCTSG 45
           ++ QLKC ++K+ IIEPD         NC SG
Sbjct: 668 IKTQLKCFRKKLEIIEPDEKISSKSLLNCISG 699

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 157 NRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           +R  GT    EHL    +  RS+ G  LE   IG  L  ++  EN + + KS+
Sbjct: 62  SRNNGTAHFLEHLAFKGTTNRSQVGIELEIENIGSHLNAYTSRENTVYYAKSL 114

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 13/84 (15%)

Query: 142 SVVYLYEIQILPSLRNRKLGTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNEN 201
           S VYLY+      LRN K     ++ H +DA + L           + G+ ++  SDN  
Sbjct: 274 SYVYLYD------LRNMKEPLHHMSGH-EDAVNNLE------FSTHVDGVVVSSGSDNRL 320

Query: 202 AIKFYKSIGMELTPDSPRDRVAHL 225
            +   K IG E TPD   D V  L
Sbjct: 321 MMWDLKQIGAEQTPDDAEDGVPEL 344

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 161 GTRLLAEHLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSI 209
           GT    EHL    ++ R++ G  LE   IG  L  ++  EN + + KS+
Sbjct: 66  GTAHFLEHLAFKGTQNRTQTGIELEIENIGSHLNAYTSRENTVYYAKSL 114

>KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {ON}
           similar to uniprot|P30777 Saccharomyces cerevisiae
           YGL142C GPI10 Integral membrane protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           putative alpha 1 2 mannosyltransferase required for
           addition of the third mannose onto the GPI core
           structure human PIG-Bp is a functional homolog
          Length = 597

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 60  QGDKMLDQFLDILDVNLGEKYTKVSKKIYENARPWKVNKLEEMRSPGLVYVSYWDE 115
           QG K L  ++D  D      Y  + K +Y+N  P  V + +E+RSPG VY   W E
Sbjct: 497 QGKKKLSDYMDESDY----LYENIPKFVYKNFPP--VFR-KELRSPGKVYTHEWPE 545

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,330,440
Number of extensions: 1293700
Number of successful extensions: 3491
Number of sequences better than 10.0: 49
Number of HSP's gapped: 3539
Number of HSP's successfully gapped: 49
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)