Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026306.14ON45145124250.0
NDAI0I022806.14ON48241611841e-159
KAFR0B065506.14ON45646310701e-142
Skud_15.1646.14ON48242510321e-136
Suva_15.1786.14ON47642310281e-136
KNAG0E009206.14ON53140310311e-135
KNAG0F02970singletonON42039110141e-134
KLLA0D00979g6.14ON56143610241e-134
SAKL0E01012g6.14ON54443910211e-133
YOR003W (YSP3)6.14ON47842510071e-132
TBLA0A073006.14ON57342110121e-132
Smik_15.1726.14ON47842310031e-132
KAFR0L003606.14ON50247710041e-132
Kwal_56.223876.14ON54342110041e-131
Skud_5.296.14ON60842710081e-131
Smik_5.276.14ON6084219991e-129
ZYRO0C07942g6.14ON5484189931e-129
YEL060C (PRB1)6.14ON6354219961e-129
Kpol_1032.56.14ON6804079971e-128
Kpol_1045.756.14ON4774339791e-128
CAGL0B03619g6.14ON4683679751e-128
KLTH0C11396g6.14ON5504329791e-127
TDEL0G045506.14ON5644159801e-127
NCAS0F002206.14ON6954189901e-127
Suva_5.76.14ON6644219821e-126
Ecym_30186.14ON5754249701e-125
CAGL0E02651g6.14ON4854159561e-125
NDAI0K028806.14ON7044229621e-123
TPHA0M002306.14ON5854159341e-120
ACR012C6.14ON5414379241e-119
CAGL0L13266gsingletonON5794966183e-73
KLTH0A06094g6.313ON4963205224e-60
SAKL0A02002g6.313ON4793645181e-59
Kwal_23.61836.313ON4934145154e-59
ZYRO0D08822g6.313ON4903925085e-58
Kpol_1028.616.313ON5183305062e-57
Kpol_1018.56.313ON4653655004e-57
TDEL0A072806.313ON4363204974e-57
NCAS0D043906.313ON4923814953e-56
KNAG0I024706.313ON4753694911e-55
Suva_3.846.313ON5274284931e-55
KAFR0J024506.313ON4783514804e-54
Smik_3.1496.313ON4913184796e-54
YCR045C (RRT12)6.313ON4913184735e-53
TPHA0D037606.313ON6073204761e-52
Skud_3.1246.313ON5403184652e-51
CAGL0L10802g6.313ON5173404606e-51
AAR069W6.313ON7683444558e-49
Ecym_21056.313ON6103164491e-48
NDAI0I005606.313ON4833914314e-47
TBLA0F039706.313ON7343204353e-46
KLLA0F06028g6.313ON5083264045e-43
TBLA0A067006.313ON4972593888e-41
Kwal_33.133721.78ON3773033702e-39
KLTH0F02288g1.78ON3803053554e-37
Kpol_2000.691.78ON3863552951e-28
ZYRO0F16764g1.78ON3863392818e-27
TPHA0B045201.78ON3883152685e-25
TBLA0A054101.78ON3823272571e-23
TDEL0C062301.78ON3642212501e-22
TDEL0G024002.310ON7745760.088
NCAS0G036602.310ON7948720.38
SAKL0G00440g2.6ON836215780.53
KLTH0H00418g2.6ON811209780.53
Kwal_56.248002.6ON803200751.3
YMR210Wna 1ON449131732.0
ZYRO0G06710gna 2ON58448732.3
Smik_13.418na 1ON448131722.3
Suva_13.393na 1ON448128722.4
NDAI0F038902.6ON833205732.4
Skud_13.379na 1ON450126722.5
SAKL0D14234g7.31ON41447713.4
CAGL0L08624g8.69ON208460714.5
SAKL0G12694g5.211ON101274705.6
Kwal_33.15618singletonON46265688.1
TDEL0G040106.71ON75575688.7
ZYRO0F15598g2.6ON790206689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02630
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     938   0.0  
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   460   e-159
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   416   e-142
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   402   e-136
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   400   e-136
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   401   e-135
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              395   e-134
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   399   e-134
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   397   e-133
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   392   e-132
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   394   e-132
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   390   e-132
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   391   e-132
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   391   e-131
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   392   e-131
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   389   e-129
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   387   e-129
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   388   e-129
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   388   e-128
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   381   e-128
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   380   e-128
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   381   e-127
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   382   e-127
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   385   e-127
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   382   e-126
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   378   e-125
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   372   e-125
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   375   e-123
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   364   e-120
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   360   e-119
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   242   3e-73
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   205   4e-60
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   204   1e-59
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   202   4e-59
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   200   5e-58
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   199   2e-57
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   197   4e-57
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   196   4e-57
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   195   3e-56
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   193   1e-55
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   194   1e-55
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   189   4e-54
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   189   6e-54
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   186   5e-53
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   187   1e-52
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   183   2e-51
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   181   6e-51
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   179   8e-49
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   177   1e-48
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    170   4e-47
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   172   3e-46
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   160   5e-43
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   154   8e-41
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   147   2e-39
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   141   4e-37
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   118   1e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   112   8e-27
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...   107   5e-25
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...   103   1e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...   100   1e-22
TDEL0G02400 Chr7 (460300..460533) [234 bp, 77 aa] {ON} Anc_2.310...    34   0.088
NCAS0G03660 Chr7 complement(681457..681696) [240 bp, 79 aa] {ON}...    32   0.38 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.53 
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    35   0.53 
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    33   1.3  
YMR210W Chr13 (687516..688865) [1350 bp, 449 aa] {ON} Putative a...    33   2.0  
ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {...    33   2.3  
Smik_13.418 Chr13 (671591..672937) [1347 bp, 448 aa] {ON} YMR210...    32   2.3  
Suva_13.393 Chr13 (667909..669252) [1344 bp, 448 aa] {ON} YMR210...    32   2.4  
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    33   2.4  
Skud_13.379 Chr13 (661288..662640) [1353 bp, 450 aa] {ON} YMR210...    32   2.5  
SAKL0D14234g Chr4 complement(1173584..1174828) [1245 bp, 414 aa]...    32   3.4  
CAGL0L08624g Chr12 (940058..946312) [6255 bp, 2084 aa] {ON} simi...    32   4.5  
SAKL0G12694g Chr7 (1081452..1084490) [3039 bp, 1012 aa] {ON} som...    32   5.6  
Kwal_33.15618 s33 (1189375..1190763) [1389 bp, 462 aa] {ON} YLR4...    31   8.1  
TDEL0G04010 Chr7 complement(728724..730991) [2268 bp, 755 aa] {O...    31   8.7  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    31   9.4  

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MKLLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFNIDSDSPSNIIHHAASPIPNQYIVL 60
           MKLLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFNIDSDSPSNIIHHAASPIPNQYIVL
Sbjct: 1   MKLLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFNIDSDSPSNIIHHAASPIPNQYIVL 60

Query: 61  FKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPI 120
           FKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPI
Sbjct: 61  FKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPI 120

Query: 121 IQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDT 180
           IQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDT
Sbjct: 121 IQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDT 180

Query: 181 GINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLD 240
           GINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLD
Sbjct: 181 GINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLD 240

Query: 241 ARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKL 300
           ARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKL
Sbjct: 241 ARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKL 300

Query: 301 GVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMST 360
           GVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMST
Sbjct: 301 GVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMST 360

Query: 361 YIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFS 420
           YIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFS
Sbjct: 361 YIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFS 420

Query: 421 TEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451
           TEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN
Sbjct: 421 TEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  460 bits (1184), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 242/416 (58%), Positives = 290/416 (69%), Gaps = 20/416 (4%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTI-------LHSFQLAHDLQGYTS 105
           IP+QYIVLF++DTTD+Q       L+S +   + +Y +       L  FQ+++D +G   
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMII 122

Query: 106 RLP-EQLIRSLATD-----PIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQD 159
           R P +  +  +  +      II+ IE+DSYVH      QIDS WGL+RISQR  LKLLQD
Sbjct: 123 RAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQRNHLKLLQD 182

Query: 160 QFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGV 219
           QFY YDD+G+     CYILDTGIN NH EF+GRA WG      EP+ ED NGHGTHCAG+
Sbjct: 183 QFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSNGHGTHCAGI 242

Query: 220 IGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQD-----QTGFK 274
           IGS  YGVAK T LIAVKVLD +GDG MS VI G+E+V   H              + FK
Sbjct: 243 IGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISSSSSVHSEFK 302

Query: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334
           GSV+NLSLGA KSP+L   +E+A K+G+H  VAAGNED+DAC TSPADSP  +TVGASSF
Sbjct: 303 GSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPAVITVGASSF 362

Query: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394
           SDDR FFSNWGPCVDVFAPGINI STYIGP+NNET SLSG+SMS+PFV+GL AY+LSLQP
Sbjct: 363 SDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQP 422

Query: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           D  SQF+  +   TP QLK KII FST G+L E+P  T N++VYNGGG  L  FWN
Sbjct: 423 DVSSQFHDSLM--TPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGKDLSGFWN 476

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  416 bits (1070), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 221/463 (47%), Positives = 304/463 (65%), Gaps = 25/463 (5%)

Query: 3   LLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFNIDSDSP---SNIIHHAASP----IPN 55
           LL   +  +LT    SL++P I+   G    +   D DS    + ++ H ++     I +
Sbjct: 4   LLFWYTSFVLTGGCLSLLLPEIFQCRGIET-ISQKDRDSTFSRTEVLEHLSAKQNDIIKD 62

Query: 56  QYIVLFKSDTTDIQRETHLATLNSWLL-------NTDPQYTILHSFQLAHDLQGYTSRLP 108
           QYIV+FK+     ++E H   L +++          D   + L+ F++   L GY  R P
Sbjct: 63  QYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDHKSNLNIFKIGTTLSGYILRGP 122

Query: 109 EQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSG 168
            + ++ L  DPI+Q IE DS VHAL  + Q D+PWGL+RISQR R+++ QDQ Y+YDD+ 
Sbjct: 123 IETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYYDDA- 181

Query: 169 ASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVA 228
            S N   Y+LDTGI  +H +F GRA+WG    P + + ED +GHGTH AG+I S ++GVA
Sbjct: 182 TSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVD-EDNSGHGTHVAGIIASDKFGVA 240

Query: 229 KNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSP 288
           K   ++AVKVL + G+G+MS V++GIE+V   H ++         KGSV+NLSLGA KSP
Sbjct: 241 KTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS-----KGSVVNLSLGASKSP 295

Query: 289 ALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCV 348
           AL+  I+AA+   +HFAVAAGNE+ DAC TSPAD+  A+TVGAS FSD+R FFSNWG CV
Sbjct: 296 ALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECV 355

Query: 349 DVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPT 408
           DVFAPG+N+MSTYIG  +N T SLSGTS +AP+  GLIAY+LSLQPD  S ++TG    T
Sbjct: 356 DVFAPGMNVMSTYIGS-DNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYFTG--EMT 412

Query: 409 PYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451
           P +LK KI++F ++ VL+E+PE TPN ++YNG G +L  FW +
Sbjct: 413 PSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  402 bits (1032), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/425 (49%), Positives = 276/425 (64%), Gaps = 27/425 (6%)

Query: 46  IHHAASPIPNQYIVLFKSDTTDIQRETHLATL--------------NSWLLNT------D 85
           +   +  +P +YI++F  D T+   E+H   +              +S+L         +
Sbjct: 62  VLRGSKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPN 121

Query: 86  PQYT-ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWG 144
           PQ+  I  SF +    +GYT    +++I  +  DP+++ IE +S V      +Q D+PWG
Sbjct: 122 PQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWG 181

Query: 145 LARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP 204
           L RIS RER K  QD  Y Y+D+ A +    Y+LDTGI+  H +F+GRAKWGAV  P   
Sbjct: 182 LHRISHRERAKYGQDLEYLYEDA-AGTGVTSYVLDTGIDTEHEDFEGRAKWGAVI-PEND 239

Query: 205 NQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQD 264
              D NGHGTHCAG+IGS  +GVAKNT ++AVKVL + G+G +S VI+GIEYV + H   
Sbjct: 240 EASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIAS 299

Query: 265 MKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSP 324
            KK+  + FKGS  NLSLG+ KSPA+   + AAV  GVHFA+AAGNED+DAC +SPA + 
Sbjct: 300 SKKRG-SKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAE 358

Query: 325 HALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTG 384
            ++TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM+AP V G
Sbjct: 359 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHVAG 417

Query: 385 LIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444
           +++Y LSLQP   S+F+    SP   QLK KI+ FST GVL ++ E TPNR+VYNGGG  
Sbjct: 418 ILSYLLSLQPAQDSEFFYDTVSPQ--QLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKK 475

Query: 445 LKDFW 449
           L +FW
Sbjct: 476 LDEFW 480

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  400 bits (1028), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 282/423 (66%), Gaps = 25/423 (5%)

Query: 46  IHHAASPIPNQYIVLFKSDTTDIQRETH--------------LATLNSWLLNT----DPQ 87
           + + A  +P +YI+ F  D++    E+H              LA  +++ ++T    D Q
Sbjct: 60  VVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQ 119

Query: 88  YTILHSFQLAHDL-QGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLA 146
           +  + SF   + L +GYT    E++I+ +  DPII+ IEQ+S V       Q ++PWGL 
Sbjct: 120 FGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLH 179

Query: 147 RISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQ 206
           RIS RE+ K  QD  Y Y+D+ A      Y+LDTGI+ NH +F+GRA WGAV  P     
Sbjct: 180 RISHREKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDINHEDFEGRAVWGAVI-PDNDEA 237

Query: 207 EDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMK 266
            D NGHGTHCAG+IGS  +GV KNT L+AVKVL + G+G +S VI+GIEYV + H  D  
Sbjct: 238 SDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDH-IDSS 296

Query: 267 KQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHA 326
           K+    FKGS  NLSLG+ KSPA+   + AAV+ GVHFA+AAGNED+DAC +SPA +  +
Sbjct: 297 KKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356

Query: 327 LTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLI 386
           +TVGAS+FSDDR FFS+WG CVDVFAPG+NI+STYIG   N + SLSGTSM+AP V G++
Sbjct: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSR-NASLSLSGTSMAAPHVAGIL 415

Query: 387 AYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLK 446
           +YFLSLQP + S+F+    SP   QLK KII+FST+GVL ++ E TPNR++YNGGG  L 
Sbjct: 416 SYFLSLQPSSDSEFFDSTVSPQ--QLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLD 473

Query: 447 DFW 449
           +FW
Sbjct: 474 NFW 476

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  401 bits (1031), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/403 (52%), Positives = 262/403 (65%), Gaps = 11/403 (2%)

Query: 55  NQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT------ILHSFQLAHDLQGYTSRLP 108
           N+YI+LFK   T  Q   H   L   LL T           +L SF L   L GY + L 
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLETSDVSAQGIVADVLDSFDLEGVLSGYVAELS 155

Query: 109 EQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSG 168
             ++  +   P +Q +EQDS VH      Q ++PWGLARIS R+ L L     Y YDD+ 
Sbjct: 156 PMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDA- 214

Query: 169 ASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVA 228
           A      YI+DTGIN  H EF+GRA+WG    P     ED NGHGTHCAG I S  YGVA
Sbjct: 215 AGEGVDSYIIDTGINVKHKEFEGRAQWGKTI-PDNDFDEDGNGHGTHCAGTIASKHYGVA 273

Query: 229 KNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSP 288
           K   +IAVKVL + G G MS VI G+E+  +QH    K  D+  FKGS  N+SLG GKSP
Sbjct: 274 KRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKK-FKGSTANMSLGGGKSP 332

Query: 289 ALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCV 348
           +L RV++AAVKLG+HF+VAAGNE+ DAC+TSPA S  A+TVGAS+ SDDR +FSNWG CV
Sbjct: 333 SLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCV 392

Query: 349 DVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPT 408
           D+FAPG+NI+STY G  ++ T +LSGTSM++P V GL+ YFLSLQP+  SQF T     T
Sbjct: 393 DIFAPGLNILSTYTGS-DDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTS-AQIT 450

Query: 409 PYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWNN 451
           P QLK K++ +ST+GVL ++PE TPN ++YNGGG  L DFW +
Sbjct: 451 PEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGD 493

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  395 bits (1014), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/391 (50%), Positives = 266/391 (68%), Gaps = 13/391 (3%)

Query: 51  SPIPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTSR-LPE 109
           S I N+++V+FK      + E  L+ L                F +A +L G+T +  P 
Sbjct: 39  STILNEFLVMFKPMVDREEVEVGLSVLAGRF-----PLAQFEQFHIADELIGFTVKNFPF 93

Query: 110 QLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGA 169
             +  L   P ++ +E +S V+AL    Q D PWGL R+SQR+R+++  +Q Y YD  G+
Sbjct: 94  HNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDEQVYRYDTRGS 153

Query: 170 SSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAK 229
           + +   YILDTGI  +H EF+GRA+WG      +P+++D NGHGTHCAG++G   YGVAK
Sbjct: 154 AKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDD-NGHGTHCAGIVGGATYGVAK 212

Query: 230 NTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPA 289
              LIAVKVL A GDGEMS VIRGIE+   +H    + QD+   +GS+INLSLGAG+SPA
Sbjct: 213 EANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLT--RNQDEV--RGSIINLSLGAGESPA 268

Query: 290 LLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVD 349
           L RV+ AA+  GVHFAVAAGNEDD+AC +SPA+    +TVG S+FSDDR FFSNWGPC+D
Sbjct: 269 LQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFFSNWGPCID 328

Query: 350 VFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTP 409
           VFAPG+N+ S+Y+G   N+T SLSGTS SAP V GL+AY LSL+PDTKSQF+T  ++P  
Sbjct: 329 VFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFHTAWSNPA- 387

Query: 410 YQLKYKIISFSTEGVLHEIPEGTPNRIVYNG 440
            QLK K++S +TEG L E+P+ T N +++NG
Sbjct: 388 -QLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  399 bits (1024), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 276/436 (63%), Gaps = 32/436 (7%)

Query: 41  SPSNIIHHAASPIPNQYIVLFKSDTT--------DIQRETHLATLNSWLLNTDPQYT--- 89
           +P + ++  A+ IPN+YI++FK D +        ++    H   L S L + DP +T   
Sbjct: 85  APLSTVNDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGS-LADNDPFFTATS 143

Query: 90  ----------------ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHAL 133
                           I  SF +A  L GY     +++I  +   P+++ +E+DS V + 
Sbjct: 144 GEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSN 203

Query: 134 GRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRA 193
               Q  +PWGLARIS RE+L L     Y YDD  A      Y++DTG+N NH +F GRA
Sbjct: 204 SFNTQNSAPWGLARISHREKLNLGSFNKYLYDDD-AGKGVTAYVVDTGVNVNHKDFDGRA 262

Query: 194 KWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRG 253
            WG      +P+  D NGHGTHCAG IGS  YGVAKN  ++AVKVL + G G MS V++G
Sbjct: 263 VWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKG 321

Query: 254 IEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDD 313
           +EYV + H++ +++Q + GFKGS  N+SLG GKSPAL   + AAVK GVHFAVAAGNE+ 
Sbjct: 322 VEYVAEAHKKAVEEQ-KKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQ 380

Query: 314 DACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLS 373
           DAC+TSPA + +A+TVGAS+ SD+R +FSNWG CVD+F PG+NI+STYIG  +  T +LS
Sbjct: 381 DACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGS-DTATATLS 439

Query: 374 GTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTP 433
           GTSM+ P V GL+ YFLSLQPD  S+++      TP QLK K+I FST+ VL ++PE T 
Sbjct: 440 GTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTV 499

Query: 434 NRIVYNGGGHSLKDFW 449
           N ++YNGGG  L D W
Sbjct: 500 NYLIYNGGGQDLDDLW 515

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  397 bits (1021), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 208/439 (47%), Positives = 277/439 (63%), Gaps = 38/439 (8%)

Query: 37  IDSDSPSNIIHHAASPIPNQYIVLFKSDTT--------DIQRETH------LATLNSWLL 82
           + S  P+NII       P++YI++FK D T        +I  E H      L + +S+  
Sbjct: 69  VSSPQPANII-------PHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFA 121

Query: 83  NTD------------PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYV 130
            T              +  I  SF +A+ L GY     ++++  +  +  ++ IE+DS V
Sbjct: 122 ATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLV 181

Query: 131 HALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQ 190
            A     Q  +PWGL+RIS RERL L     Y YDD  A      Y++DTGIN NH +F 
Sbjct: 182 FASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDD-AGKGVTSYVIDTGINVNHKDFN 240

Query: 191 GRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAV 250
           GRA WG    P      D NGHGTHCAG I S  YGVAKN  ++A+KVL + G G MS V
Sbjct: 241 GRAVWGKT-VPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299

Query: 251 IRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGN 310
           ++G+E+  Q H Q+  K+++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGN
Sbjct: 300 VKGVEFAAQSH-QEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGN 358

Query: 311 EDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETT 370
           E+ DAC+TSPA + +A+TVGAS+ SDDR +FSNWG CVD+FAPG+N++STYIG     T 
Sbjct: 359 ENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSE-TATA 417

Query: 371 SLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPE 430
           +LSGTSM++P V GL+ YFLSLQPD+ S+F+   +  TP QLK K+I++ST+ VL+E+PE
Sbjct: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQA-SGITPAQLKKKLIAYSTKDVLYELPE 476

Query: 431 GTPNRIVYNGGGHSLKDFW 449
            TPN ++YNGGG  L DFW
Sbjct: 477 DTPNYLIYNGGGQDLSDFW 495

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  392 bits (1007), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 201/425 (47%), Positives = 280/425 (65%), Gaps = 27/425 (6%)

Query: 46  IHHAASPIPNQYIVLFKSDTTDIQRETHLATLNS-------WLLNTDPQYTILHS----- 93
           + H    +P +Y+++F  D +  Q ++H+  +          L   D  + ++ S     
Sbjct: 60  VAHKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSK 119

Query: 94  ---------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWG 144
                    F +    +GYT    +++I+ ++ DPII+ +EQ++ V       Q ++PWG
Sbjct: 120 SQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWG 179

Query: 145 LARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP 204
           L R+S RE+ K  QD  Y Y+D+ A      Y+LDTGI+  H +F+GRA+WGAV  P   
Sbjct: 180 LHRVSHREKPKYGQDLEYLYEDA-AGKGVTSYVLDTGIDTEHEDFEGRAEWGAVI-PAND 237

Query: 205 NQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQD 264
              D NGHGTHCAG+IGS  +GVAKNT ++AVKVL + G+G +S VI+GIEYVT++H + 
Sbjct: 238 EASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIES 297

Query: 265 MKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSP 324
            KK+++  FKGS  NLSLG+ KS A+   + AAV  GVHFA+AAGNED+DAC +SPA + 
Sbjct: 298 SKKKNKE-FKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAE 356

Query: 325 HALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTG 384
            ++TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM++P V G
Sbjct: 357 KSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMASPHVAG 415

Query: 385 LIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444
           +++YFLSLQP   S+F+    +P+P +LK K++ FST+GVL +I + TPN+++YNGGG  
Sbjct: 416 ILSYFLSLQPAPDSEFFN--DAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKK 473

Query: 445 LKDFW 449
           L  FW
Sbjct: 474 LDGFW 478

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  394 bits (1012), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 270/421 (64%), Gaps = 22/421 (5%)

Query: 48  HAASPIPNQYIVLFKSDTTDIQRETHLATLNSW-----------------LLNTDPQYTI 90
           H  + IP++YI+ FK D    + + H  ++N                   +   D Q  I
Sbjct: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPI 179

Query: 91  LHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQ 150
           + SF +   LQGY     + +I  +  +P++Q +EQDS V+      Q  +PWGLARIS 
Sbjct: 180 IDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISH 239

Query: 151 RERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDEN 210
           RERL L     Y +DD  A      Y++DTG+N  HN+F+GRA WG    P      D N
Sbjct: 240 RERLNLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHNDFEGRASWGKTI-PNNDEDLDGN 297

Query: 211 GHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQ 270
           GHGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+EY T  H  D+K + +
Sbjct: 298 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNK-K 356

Query: 271 TGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVG 330
           +GFKGS  N+SLG GKSP+L   + AAVK G+HFAVAAGNE+ DAC+TSPA + +A+TVG
Sbjct: 357 SGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVG 416

Query: 331 ASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFL 390
           AS+ SDDR +FSNWG CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL++YFL
Sbjct: 417 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLSYFL 475

Query: 391 SLQPDTKSQFYTGITSP-TPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449
           SLQP+  S+F T      TP QLK ++IS+ T+ +L +IPE TPN +V+NG G  L DFW
Sbjct: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

Query: 450 N 450
           N
Sbjct: 536 N 536

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  390 bits (1003), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 208/423 (49%), Positives = 273/423 (64%), Gaps = 27/423 (6%)

Query: 48  HAASPIPNQYIVLFKSDTTDIQRETHLA------TLNSWLLNTDPQYTILHSFQLAHDLQ 101
           H    IP +YIV+F  D +    E+H        +++   L  D  +  + S  +A DLQ
Sbjct: 62  HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQ 121

Query: 102 ---------------GYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLA 146
                          GY     ++++  ++ DP+I+ IEQ+S V       Q D+PWGL 
Sbjct: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181

Query: 147 RISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQ 206
           RIS RE+ K  QD  Y Y+D+ A      Y+LDTGI+  H +F+GRA WGAV  P     
Sbjct: 182 RISHREKAKYGQDLEYLYEDA-AGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI-PGNDEA 239

Query: 207 EDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMK 266
            D NGHGTHCAG+IGS  YGVAKNT L+AVKVL + G+G +S VI+GIEYV ++H +  +
Sbjct: 240 SDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSR 299

Query: 267 KQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHA 326
           K+ +  FKGS  NLSLG+ KS A+   ++AAV  GVHFA+AAGNE++DAC +SPA +  +
Sbjct: 300 KKSKE-FKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS 358

Query: 327 LTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLI 386
           +TVGAS+FSDDR FFSNWG CVDVFAPGINIMSTYIG   N T SLSGTSM+AP V G++
Sbjct: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSR-NATLSLSGTSMAAPHVAGML 417

Query: 387 AYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLK 446
           +YFLSLQP   S+++    SP   +LK K++ FST GVL +I + TPNR++YNGGG  L 
Sbjct: 418 SYFLSLQPAPDSEYFDNALSPQ--ELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILD 475

Query: 447 DFW 449
           D W
Sbjct: 476 DLW 478

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  391 bits (1004), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 209/477 (43%), Positives = 295/477 (61%), Gaps = 37/477 (7%)

Query: 3   LLRLISICLLTRIGYSLVIPSIWAQTGKSPGVFN--IDSDSPSNI--IHHAASP--IPNQ 56
           L+ L+ +C  + +  +LVIPS+     K     +  +DS   S++  +H+A +   IP++
Sbjct: 4   LIHLLLVC--STLVNALVIPSLKDSIDKFSDDIHGLLDSAKFSSLAPVHNADAENIIPHR 61

Query: 57  YIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT-----------------------ILHS 93
           YI++FK   +  Q + H   + +  L     ++                       I+  
Sbjct: 62  YIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPESMRQSLGGIVSD 121

Query: 94  FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRER 153
           F ++  L GY + L ++L+  +  +P+I  IE D+ VH      Q ++PWGLARIS RE 
Sbjct: 122 FDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNAPWGLARISHRES 181

Query: 154 LKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHG 213
           L L     Y YDD  A  N   Y++DTG++ NH EF  RA WG    P+     D NGHG
Sbjct: 182 LNLANFNKYLYDDD-AGKNVDAYVIDTGVDVNHVEFHSRAHWGKTI-PLNDQDIDGNGHG 239

Query: 214 THCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGF 273
           TH AG IGS  YGVAK+  +IAVKVL + G G MS V++G+E+    H + MK  ++   
Sbjct: 240 THVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLERMK--NEKNL 297

Query: 274 KGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS 333
           KGSV N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ +AC++SPA +  A+TVGAS+
Sbjct: 298 KGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAEQAVTVGAST 357

Query: 334 FSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQ 393
            SD+R +FSNWG CVD+FAPG+NI+STYIG +++ T +LSGTSM++P V GL+AY+LSLQ
Sbjct: 358 ISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQ 417

Query: 394 PDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           P+  S+F T   S +  QLK K+I ++T+ VL ++PEGTPN ++YNGGG  L DFWN
Sbjct: 418 PEKSSEFSTRAISTS--QLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDLSDFWN 472

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 195/421 (46%), Positives = 271/421 (64%), Gaps = 28/421 (6%)

Query: 53  IPNQYIVLFKSDTTDIQRETHL----------------------ATLNSWL--LNTDPQY 88
           IP++YIV+FK      + + H+                      AT++  +  + T  + 
Sbjct: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139

Query: 89  TILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARI 148
            IL SF +   L+GY     ++++  +  +P++  +EQDS V+A     Q  +PWGL+RI
Sbjct: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199

Query: 149 SQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQED 208
           S RE+L L     Y YDD+ A      Y++DTGIN +H +F+GRA WG    P     +D
Sbjct: 200 SHREKLNLGSFNKYLYDDA-AGKGVTSYVIDTGINIDHKDFEGRAAWGKT-VPTNDLDQD 257

Query: 209 ENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQ 268
            NGHGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+E+  + H QD  K+
Sbjct: 258 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSH-QDAVKK 316

Query: 269 DQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALT 328
           ++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC++SPA + +A+T
Sbjct: 317 NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAIT 376

Query: 329 VGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAY 388
           VGAS+ +DDR +FSNWG CVD+FAPG+N++STYIG     T +LSGTSM++P V GL+ Y
Sbjct: 377 VGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSE-TATATLSGTSMASPHVAGLLTY 435

Query: 389 FLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDF 448
           FLSLQPD+ S+++      TP QLK K+I++ST+  L ++PE T N ++YNGGG  L DF
Sbjct: 436 FLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDF 495

Query: 449 W 449
           W
Sbjct: 496 W 496

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  392 bits (1008), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 272/427 (63%), Gaps = 28/427 (6%)

Query: 49  AASP--IPNQYIVLFKS----DTTDIQRET-HLATLNSWL----------------LNTD 85
           AA P  IPN+YI++FK     + TD  +E+ H A L S                  L+T 
Sbjct: 146 AAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRDSSLSTS 205

Query: 86  PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGL 145
               I  SF + +   GY     +++I  +  +P++  +E+DS V A     Q  +PWGL
Sbjct: 206 ETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQNSAPWGL 265

Query: 146 ARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPN 205
           ARIS RERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+   
Sbjct: 266 ARISHRERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI-PLNDE 323

Query: 206 QEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM 265
             D NGHGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+EY  + H Q  
Sbjct: 324 DLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARAH-QKQ 382

Query: 266 KKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPH 325
            ++ + GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  
Sbjct: 383 AQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADK 442

Query: 326 ALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGL 385
           A+TVGAS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL
Sbjct: 443 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGL 501

Query: 386 IAYFLSLQPDTKSQFY-TGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHS 444
           + YFLSLQP + S+F+  G  S TP QLK K+I +ST+ +L ++PE TPN ++YNGGG  
Sbjct: 502 LTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGGGQD 561

Query: 445 LKDFWNN 451
           L  FWN+
Sbjct: 562 LSAFWND 568

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  389 bits (999), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 267/421 (63%), Gaps = 26/421 (6%)

Query: 53  IPNQYIVLFKS----DTTDIQRET-HLATLNS----------------WLLNTDPQYTIL 91
           IPN+YIV+FK     +  +  +E+ H A L S                  L+T     I 
Sbjct: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDTYLSTSEAGGIQ 211

Query: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151
            SF + +   GY     +++I  +  +P++  +E+DS V A     Q  +PWGLARIS R
Sbjct: 212 DSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQNSAPWGLARISHR 271

Query: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 272 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTI-PLNDEDLDGNG 329

Query: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271
           HGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+EY  + H Q   ++ + 
Sbjct: 330 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAH-QKQAQEKKK 388

Query: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331
           GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 389 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 448

Query: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
           S+ SDDR +FSNWG CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL+ YFLS
Sbjct: 449 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLTYFLS 507

Query: 392 LQPDTKSQFYT-GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IPE TPN ++YNGGG  L  FWN
Sbjct: 508 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGGGQDLSAFWN 567

Query: 451 N 451
           +
Sbjct: 568 D 568

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  387 bits (993), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 203/418 (48%), Positives = 271/418 (64%), Gaps = 26/418 (6%)

Query: 53  IPNQYIVLFKS--------------DTTDIQRETHLATLNSWL-------LNTDPQYTIL 91
           + N+YI+LFK               +   +Q  + L   +S+        +   P   I 
Sbjct: 89  LENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRLDGVYDSPLGGID 148

Query: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151
           H+F +   L GY+   P +++  +   P+I+ +EQDS V+      +  +PWGLARIS R
Sbjct: 149 HTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHR 208

Query: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211
           ERL L     Y YD+ G S  T  Y++DTG+N +HN+F GRAKWG    P     ED NG
Sbjct: 209 ERLNLGSYNKYLYDEQGGSGVT-SYVIDTGVNVHHNQFGGRAKWGKTI-PAGDLDEDGNG 266

Query: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271
           HGTHCAG IGS  YGVAK   ++AVKVL + G G MS V++G+E+  Q H Q+  KQ + 
Sbjct: 267 HGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDH-QNAVKQKKP 325

Query: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331
           GFKGS  N+SLG GKSP+L + + AAV  G++FAVAAGNED DAC+TSPA +   +TVGA
Sbjct: 326 GFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGA 385

Query: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
           S+ SDDR +FSN+G CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL+AYFLS
Sbjct: 386 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIG-SDSSTATLSGTSMASPHVAGLLAYFLS 444

Query: 392 LQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449
           LQP + S+F  G +S +P QLK K+++FST+ VL +IP GTPN ++YNGGG  L  FW
Sbjct: 445 LQPGSDSEFDAG-SSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFW 501

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 199/421 (47%), Positives = 273/421 (64%), Gaps = 26/421 (6%)

Query: 53  IPNQYIVLFK----SDTTDIQRET----------HLATLNSWL-------LNTDPQYTIL 91
           IPN+YI++FK     +  D  +E           +L+  +++        L+T     I 
Sbjct: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238

Query: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151
            SF + +   GY     ++++  +  +P++  +E+DS V A     Q  +PWGLARIS R
Sbjct: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298

Query: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 299 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTI-PLNDEDLDGNG 356

Query: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271
           HGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+EY  + H+++ +++ + 
Sbjct: 357 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEK-KK 415

Query: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331
           GFKGS  N+SLG GKSPAL   + AAV++G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475

Query: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
           S+ SDDR +FSNWG CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLS
Sbjct: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLS 534

Query: 392 LQPDTKSQFYT-GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IPE TPN ++YNGGG  L  FWN
Sbjct: 535 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWN 594

Query: 451 N 451
           +
Sbjct: 595 D 595

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  388 bits (997), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 201/407 (49%), Positives = 271/407 (66%), Gaps = 15/407 (3%)

Query: 53  IPNQYIVLFKSDTT--DIQRETHL---ATLNSWLLNTDPQYTIL----HSFQLAHDLQGY 103
           IPN+YI++FK D +  D+Q    L   A      ++ +   +IL     +F +A+   GY
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSSSILGGIEEAFNVANLFHGY 291

Query: 104 TSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYH 163
                EQL++ +   PI+  +EQDS VHA     Q ++PWGLARIS R+ L L     Y 
Sbjct: 292 IGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYL 351

Query: 164 YDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSH 223
           YDD  A      Y++DTGIN  H EF GRA WG    P      D NGHGTHCAG I S 
Sbjct: 352 YDDV-AGEGVTAYVIDTGINIKHKEFGGRAVWGKTI-PENDQDVDGNGHGTHCAGTIASK 409

Query: 224 EYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLG 283
            YGVAKN  ++AVKVL + G G MS V++G+EY    H++ ++++ + GFKGS  N+SLG
Sbjct: 410 NYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREK-KKGFKGSTANMSLG 468

Query: 284 AGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSN 343
            GKS +L   ++AAVK G+HFAVAAGNE+ DAC++SPA S +A+TVGAS+ SDDR +FSN
Sbjct: 469 GGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSN 528

Query: 344 WGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFY-T 402
           WG CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL++YFLS+QPD  S+F+ +
Sbjct: 529 WGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSS 587

Query: 403 GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449
           G  S +P QLK K+I++ST+ +  ++PE TPN +VYN  GH++ DFW
Sbjct: 588 GSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  381 bits (979), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 208/433 (48%), Positives = 268/433 (61%), Gaps = 30/433 (6%)

Query: 42  PSNIIHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSWLLN--TDPQY-----TILHS- 93
           P+++I   +  IP  YIV+F    T  +   H+ T++   L   TD  Y     TI  S 
Sbjct: 24  PASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSS 83

Query: 94  --------------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQI 139
                         F++ +DL GYT    ++++  L   P+++ IE+DS VH      Q 
Sbjct: 84  DVNSNGLLGGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQY 143

Query: 140 DSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVF 199
           ++PWGLARIS R RL L     Y YDD G     K Y++DTGIN  + +F GRA WG   
Sbjct: 144 NAPWGLARISHRSRLNLSTFNKYLYDDLGGKG-VKAYVIDTGINITNVDFGGRAYWGKTI 202

Query: 200 TPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQ 259
              E N  D NGHGTH AG I S  YGVAK   + AVKVL + G G MS V++G+EYV  
Sbjct: 203 PAGEANV-DGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVG 261

Query: 260 QHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTS 319
            H++D+      GFKGSV N+SLG GKS +L   + AAV  GVHFAVAAGNE+ DAC+TS
Sbjct: 262 AHQRDV---GTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTS 318

Query: 320 PADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSA 379
           PA +  A+TVGAS+ SD R +FSNWG CV +FAPG+NI+STYIG   + T +LSGTSM++
Sbjct: 319 PAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSP-DATATLSGTSMAS 377

Query: 380 PFVTGLIAYFLSLQPDTKSQFYT--GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIV 437
           P + GL+AYFLSLQP  KSQFY+    T+ TP QLK KI++F T+  L ++P  TPN I 
Sbjct: 378 PHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIA 437

Query: 438 YNGGGHSLKDFWN 450
           YNG G SL+DFWN
Sbjct: 438 YNGAGKSLEDFWN 450

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  380 bits (975), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/367 (52%), Positives = 245/367 (66%), Gaps = 6/367 (1%)

Query: 86  PQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGL 145
           P+  I   F +    QG     PE +++ L    I++ +E+DS VHA     Q ++PWGL
Sbjct: 53  PRGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGL 112

Query: 146 ARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPN 205
           ARIS R+RL L     Y YD++G    T  Y++DTGIN  H EF GRA+WG    P+   
Sbjct: 113 ARISHRDRLNLGNFNKYLYDNAGGEGVT-AYVIDTGINVKHVEFDGRAQWGKTI-PLNDL 170

Query: 206 QEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM 265
             D NGHGTHCAG I S  YG+AK   ++AVKVL + G G MS VI+G+EY  Q H ++ 
Sbjct: 171 DIDGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKES 230

Query: 266 KKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPH 325
           K   +  FKGS  N+SLG GKSPAL   + AAV  G+HFAVAAGNE+ DAC+TSPA +  
Sbjct: 231 KNNKK--FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEK 288

Query: 326 ALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGL 385
           A+TVGAS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  N ET SLSGTSM++P V GL
Sbjct: 289 AITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGL 348

Query: 386 IAYFLSLQPDTKSQFYTGIT-SPTPYQLKYKIISFSTEGVLHEIPE-GTPNRIVYNGGGH 443
           + YFLSLQPD+ S+FY       TP QLK K+I++ST+ VL ++P+  +PN ++YNG G 
Sbjct: 349 LTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGG 408

Query: 444 SLKDFWN 450
            L  FWN
Sbjct: 409 DLGVFWN 415

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  381 bits (979), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/432 (45%), Positives = 272/432 (62%), Gaps = 40/432 (9%)

Query: 53  IPNQYIVLFKSDTT--------DIQRETHLATLNSWLLNTDPQYT--------------- 89
           IP++YIV+FK + +         I  E HL ++ + L +T   +T               
Sbjct: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSV-AKLESTHEFFTSTENFVEDRDFELDY 137

Query: 90  ------------ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQK 137
                       I  SF ++  L GY     ++++  +  +P++  +EQDS V A     
Sbjct: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197

Query: 138 QIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGA 197
           Q  +PWGL+RIS RE+L L     Y YDD  A      Y++DTG+N +H +F+GRA WG 
Sbjct: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDFEGRASWGK 256

Query: 198 VFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYV 257
              P     +D NGHGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+E+ 
Sbjct: 257 TI-PTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFA 315

Query: 258 TQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACS 317
            + H QD  K+++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC+
Sbjct: 316 AKSH-QDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACN 374

Query: 318 TSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSM 377
           +SPA + +A+TVGAS+ +DDR +FSNWG CVD+FAPG+N++STYIG  +  T +LSGTSM
Sbjct: 375 SSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-DTATATLSGTSM 433

Query: 378 SAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIV 437
           ++P V GL+ YFLSLQPD+ S+++      TP QLK K+I++ST+ VL +IP+ T N ++
Sbjct: 434 ASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLI 493

Query: 438 YNGGGHSLKDFW 449
           +NGGG  L DFW
Sbjct: 494 FNGGGEGLDDFW 505

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/415 (47%), Positives = 267/415 (64%), Gaps = 22/415 (5%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNT-------DPQYT---------ILHSFQL 96
            P++YIV+ K  + + +   H+  +    L +       DP ++         I  SF +
Sbjct: 111 FPHRYIVVLKHSSPE-EIALHMEAITQSQLQSVGELAQDDPFFSAQGVRTTGGIQDSFDV 169

Query: 97  AHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKL 156
           A  L GY     + ++  +   P++  +E DS VHA     Q  +PWGL+RIS RERL L
Sbjct: 170 AGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHRERLNL 229

Query: 157 LQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHC 216
                Y +DD  A      Y++DTGIN  H +F+GRA WG    P      D NGHGTHC
Sbjct: 230 GSFNKYLFDDE-AGKGVTSYVIDTGINVKHQDFEGRAHWGKTI-PTNDEDLDGNGHGTHC 287

Query: 217 AGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGS 276
           AG I S  YGVAK   ++AVKVL + G G MS VI+G+E+  Q H++ +K + + GFKGS
Sbjct: 288 AGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDK-KKGFKGS 346

Query: 277 VINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSD 336
             N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC+TSPA +  A+TVGAS+ SD
Sbjct: 347 TANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSD 406

Query: 337 DRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDT 396
           DR +FSN+G CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLSLQPD+
Sbjct: 407 DRAYFSNYGKCVDIFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLSLQPDS 465

Query: 397 KSQFY-TGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
            S F+  G    TP QLK K+I++ST+ +L+++PE TPN ++YNGGGH LK FW+
Sbjct: 466 DSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWD 520

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  385 bits (990), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 197/418 (47%), Positives = 268/418 (64%), Gaps = 25/418 (5%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDP--------------------QYTILH 92
           IPN+YIV+FK      + + H   +N   L +                      Q  IL 
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGILT 158

Query: 93  SFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRE 152
           +F +++ L GY     ++++  +  +P+++ +E+DS V A     Q ++PWGLARIS RE
Sbjct: 159 TFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHRE 218

Query: 153 RLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGH 212
           RL L     Y YDD  A     CY++DTGIN  HN+F  RA WG    P+     D NGH
Sbjct: 219 RLNLGSFNKYLYDDD-AGKGVTCYVIDTGINTEHNDFNKRAVWGKTI-PLNDKDIDGNGH 276

Query: 213 GTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTG 272
           GTHCAG I S  YGVAKN  ++AVKVL + G G MS VI+G+E+  + H +   K+ + G
Sbjct: 277 GTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIK-AAKEKKKG 335

Query: 273 FKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGAS 332
           FKGS  N+SLG GKSP L   + AAV  G+HFAVAAGNE+ DAC+TSPA +  A+TVGAS
Sbjct: 336 FKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGAS 395

Query: 333 SFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSL 392
           + SDDR +FSNWG CVD+FAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLSL
Sbjct: 396 TLSDDRAYFSNWGKCVDIFAPGLNILSTYIGD-DDATATLSGTSMASPHVAGLLTYFLSL 454

Query: 393 QPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           QP + S+F+   T  TP Q+K K+I++S++ VL ++PEGTPN++++NG G +L D WN
Sbjct: 455 QPGSDSEFFD-PTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  382 bits (982), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/421 (47%), Positives = 269/421 (63%), Gaps = 26/421 (6%)

Query: 53  IPNQYIVLFKSDT----TDIQRET----------HLATLNSWLLNT-DPQYT------IL 91
           IPN+YI++FK D         RET          +LA  +++ ++T D   +      I 
Sbjct: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQ 266

Query: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151
            SF +     GY     ++++  +  +P++  +E+DS V A     Q  +PWGLAR+S R
Sbjct: 267 DSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHR 326

Query: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 327 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI-PLNDEDLDGNG 384

Query: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271
           HGTHCAG I S  YGVAKN  ++AVKVL + G G MS V++G+EY  + H Q   ++ + 
Sbjct: 385 HGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKAH-QKQAEEKKK 443

Query: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331
           GFKGS  N+SLG GKSPAL   + AAV+ G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 444 GFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGA 503

Query: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
           S+ SDDR +FSN+G CVDVFAPG+NI+STYIG  +  T +LSGTSM++P V GL+ YFLS
Sbjct: 504 STLSDDRAYFSNYGKCVDVFAPGLNILSTYIGS-DEATATLSGTSMASPHVAGLLTYFLS 562

Query: 392 LQPDTKSQFYT-GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IP+ TPN ++YNGGG  L  FWN
Sbjct: 563 LQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWN 622

Query: 451 N 451
           +
Sbjct: 623 D 623

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 264/424 (62%), Gaps = 32/424 (7%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNT----DPQYTILHS--------------- 93
           IP++YIV+FK   TD     H   + +  + T    DP ++   +               
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 94  ------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLAR 147
                 F++A  L+GY     + ++  +    +++ IEQDS VHA   + Q  +PWGLAR
Sbjct: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228

Query: 148 ISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQE 207
           +S RERL L     Y YDD+ A      Y++DTGIN +H EF+GRA+WG    P      
Sbjct: 229 VSHRERLNLGSFNKYLYDDN-AGKGVTAYVIDTGINIDHVEFEGRAQWGKTI-PSNDADY 286

Query: 208 DENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKK 267
           D NGHGTHCAG I S  YGVAKN  ++AVKVL   G G MS V+RG+EYV  +H    K 
Sbjct: 287 DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHR---KA 343

Query: 268 QDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHAL 327
                FKGS  N+SLG GKS AL   ++AAV  G+HFAVAAGNE+ DAC+TSPA S   +
Sbjct: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 328 TVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIA 387
           TV AS+ SDDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSGTSM++P V GL+A
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGS-DTAVATLSGTSMASPHVAGLLA 462

Query: 388 YFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKD 447
           YFLSLQPD+ S++YTG +S +P  LK KI+++ ++ +L+ +P  T N +++NGGG SL  
Sbjct: 463 YFLSLQPDSGSEYYTG-SSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 448 FWNN 451
           FWN+
Sbjct: 522 FWNS 525

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  372 bits (956), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 198/415 (47%), Positives = 265/415 (63%), Gaps = 23/415 (5%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNS------WLLNTD----PQYT--------ILHSF 94
           IPN+YIVLFK   TD + ++HL+ +        +L ++D     QY         + H F
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYNDISTRGIGLQHEF 133

Query: 95  QLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERL 154
            +   + GY     E   + +A  P+++ +E DS V     + Q   PWGL RISQRE+L
Sbjct: 134 SIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQREKL 193

Query: 155 KLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGT 214
            +L  +FYHYDD G   +T  +++DTGI  +H +F+GRA WG      + N  D NGHGT
Sbjct: 194 PILGKRFYHYDDRGGK-DTVTFVIDTGIYVDHEDFEGRASWGKTIVEND-NDYDLNGHGT 251

Query: 215 HCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFK 274
           HCAG I S  YG+AK   +IAVKVL + G G MS VIRG+EY  + +  D+KK  ++  K
Sbjct: 252 HCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAY-NDLKKT-KSNLK 309

Query: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334
           G+  N+SLGA KS AL R ++AA   G+ FAVAAGNE DDAC++SPA +   +TVG S+ 
Sbjct: 310 GAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGSTL 369

Query: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394
           SDD  FFSN+G CVD+FAPG+NIMSTYIG   N T SLSGTSMS+P V G++AY+LSLQP
Sbjct: 370 SDDVAFFSNYGRCVDIFAPGVNIMSTYIGS-KNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449
           D KSQFY   ++ +P  LK K+++++T G L  +P  T N +VYNGGG +L  FW
Sbjct: 429 DHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  375 bits (962), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 269/422 (63%), Gaps = 29/422 (6%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTD-----PQYTILHS-------------- 93
           +PN+YI++FK D+ +I   ++   L S +         P +   HS              
Sbjct: 239 LPNKYIIVFK-DSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEEEESFRNGGI 297

Query: 94  ---FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQ 150
              F + + L GY+    +++I  +  +P+++ +E+DS V       Q ++PWGL+RIS 
Sbjct: 298 ISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWGLSRISH 357

Query: 151 RERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDEN 210
           RERL L     Y YDD  A     C+++DTGIN NH +F  RA WG    P      D N
Sbjct: 358 RERLNLGSFNKYLYDDD-AGKGVTCFVIDTGINVNHVDFGKRAIWGKTI-PSNDQDIDGN 415

Query: 211 GHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQ 270
           GHGTHCAG I S  YGVAKN  ++AVKVL + G G MS VI+G+E+  + H  + K  ++
Sbjct: 416 GHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLNNEK--NK 473

Query: 271 TGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVG 330
             +KGS  N+SLG GKSP L   + AAV+ G+HF+VAAGNE+ DAC++SPA + +A+TVG
Sbjct: 474 KDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAITVG 533

Query: 331 ASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFL 390
           AS+ SDDR +FSNWG CVDVFAPG+NI+STY+G  N+ T +LSGTSM++P V GL+ YFL
Sbjct: 534 ASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLTYFL 593

Query: 391 SLQPDTKSQFYTGITSP--TPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDF 448
           SLQPD+KS F+   +    TP QLK K+I++ST  +L+++P+GTPN+++YNG G  + D 
Sbjct: 594 SLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDISDL 653

Query: 449 WN 450
           WN
Sbjct: 654 WN 655

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  364 bits (934), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 266/415 (64%), Gaps = 24/415 (5%)

Query: 55  NQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYT----------------ILHSFQLAH 98
           ++YI++FK      Q + HL  +++       +                  ++ +F++A 
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRPAAAPGASALRDGFDRVMDTFEVAG 193

Query: 99  DLQGYTSRLPE-QLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKLL 157
              GY + +   +++  +  +P++  +E+DS VH+L  + Q ++PWGLARIS RE L L 
Sbjct: 194 AFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSL-DETQNNAPWGLARISHREGLNLG 252

Query: 158 QDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCA 217
               Y Y  + A      Y++DTGI+ +H EF  RAKWG    P+     D NGHGTHCA
Sbjct: 253 NFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTI-PINDYDIDGNGHGTHCA 311

Query: 218 GVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM---KKQDQTGFK 274
           G IGS  YGVAK   L+AVKVL + G G MS V++G+E+V  +H + +   +K   + +K
Sbjct: 312 GTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKNSNYK 371

Query: 275 GSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSF 334
           G+  N+SLG GKSPAL + + AAVK GVHFAVAAGNE+ DAC++SPA + +A+TVGAS+ 
Sbjct: 372 GATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVGASTL 431

Query: 335 SDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQP 394
           SDDR +FSN+G CVD+FAPG+NI+STYIG  N+ T +LSGTSM++P V GL+ Y LSLQP
Sbjct: 432 SDDRAYFSNYGKCVDIFAPGLNILSTYIGT-NDATATLSGTSMASPHVAGLLTYLLSLQP 490

Query: 395 DTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449
           D  S+FY   +  TP Q+K KII ++T+  L ++P  TPN+++YNGG +S  DFW
Sbjct: 491 DKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFW 544

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  360 bits (924), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 193/437 (44%), Positives = 257/437 (58%), Gaps = 31/437 (7%)

Query: 41  SPSNIIHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSW----LLNTDPQYTILHS--- 93
           SP   +      IP++YIV+F+   +D +   H+  + +     +   D Q+    S   
Sbjct: 59  SPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG 118

Query: 94  -------------------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALG 134
                              F L   L+GY     E ++  L ++P +  +E+DS V A  
Sbjct: 119 ENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASD 178

Query: 135 RQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAK 194
              Q  +PWGLAR+S RE+L       Y YDD+     T  Y++DTGIN +H +F+ RA 
Sbjct: 179 FTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVT-SYVIDTGINIDHVDFEDRAL 237

Query: 195 WGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGI 254
           WG    P      D NGHGTHCAG I S  YGVAK   ++AVKVL + G G MS V+RG+
Sbjct: 238 WGKTI-PNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGV 296

Query: 255 EYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDD 314
           EY  + H +  +K D+ GFKGS  N+SLG G+S AL   ++AAV  G+HFAVAAGNE+ D
Sbjct: 297 EYAVKAHRKAAEKADK-GFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQD 355

Query: 315 ACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSG 374
           AC+TSPA S  A+TVGAS+ +DDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSG
Sbjct: 356 ACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSG 414

Query: 375 TSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPN 434
           TSM++P V GL+ YFLSLQPD  S+F    T  +P  LK K+I F T+  L  +P  T N
Sbjct: 415 TSMASPHVAGLLTYFLSLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTAN 473

Query: 435 RIVYNGGGHSLKDFWNN 451
            ++YNGGG  L DFW N
Sbjct: 474 VLIYNGGGADLSDFWGN 490

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  242 bits (618), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 158/496 (31%), Positives = 251/496 (50%), Gaps = 58/496 (11%)

Query: 1   MKLLRLISICL-LTRIGYSLVIPSI--WAQTGKSPGVFNI--DSDSPSNIIHHAASP--- 52
           M+L  +I++ + +  +  ++V+P I    QT +S    N    S  P N+     +P   
Sbjct: 1   MRLSNIITLVIGIISLSNAIVLPDINTLEQTSESQEYDNFFKQSKRPGNVKAPLVAPLGE 60

Query: 53  --------IPNQYIVLFKSDTTDIQRETHLATLNSWLLN-------TDPQY--------- 88
                   +P +YIV+FK+     + + H+ T+    L         DP +         
Sbjct: 61  NDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTRDKEFS 120

Query: 89  -----TILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPW 143
                 +L++F +     GY     ++++  +    I+  +E DS +    ++   +S W
Sbjct: 121 TEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETDSNSHW 180

Query: 144 GLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPME 203
            LARIS R +L L     Y +D +G   N   YILDTG+ + H  +  R   G V TP E
Sbjct: 181 HLARISHRPKLGLSNFNEYKFDPNGGQ-NIDAYILDTGVYQTHAYYIERTIRGIVITPNE 239

Query: 204 PNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQ 263
            ++ D NGHGT  AG++G  E GVA+  TLI VKVL+ +G G +S +I+G+ +V   H Q
Sbjct: 240 -DERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHHHPQ 298

Query: 264 DMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADS 323
            ++K    G  G+V+  S+   KS +L    +  V  G+H  V AG +  +AC++SPA S
Sbjct: 299 RIEKN---GVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPASS 355

Query: 324 PHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETT---SLSGTSMSAP 380
              +TV   S +D+ +   NWG CVD++ PG  + +TY     N+ T   S++G+S +A 
Sbjct: 356 SKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAAAA 415

Query: 381 FVTGLIAYFLSLQPDTKSQFYTGITSP-----TPYQLKYKIISFSTEGVLHEIPEGTPNR 435
            V GL+AYF SLQP        G+ +P     TP +LK ++I F T+G L  +   +PN 
Sbjct: 416 QVAGLLAYFASLQP--------GLGTPDVIPLTPEELKERLIDFGTKGKLTNLERMSPNI 467

Query: 436 IVYNGGGHSLKDFWNN 451
           I +NG G +L  F+N+
Sbjct: 468 IAFNGAGGNLDSFFND 483

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  205 bits (522), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/320 (40%), Positives = 187/320 (58%), Gaps = 45/320 (14%)

Query: 138 QIDSPWGLARISQR-------ERLKLLQDQF-YHYDDSGASSNTKCYILDTGINENHNEF 189
           Q  +P  LARIS+R       E + +    F Y+YDD  + +    Y++DTGI + H + 
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 190 QGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSA 249
           +GRAK+GA      P   D NGHGTH AG+IGS ++GVAK+ +LI VK L+A+G G +++
Sbjct: 195 EGRAKFGADLVGEGPG--DFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTS 252

Query: 250 VIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAG 309
           VI  IE+ T  H +  +       +G V NLSLG+ ++  L + +EAA++ GV   VAAG
Sbjct: 253 VISAIEF-TVNHCRKSR-------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAG 304

Query: 310 NEDDDACSTSPADSPHALTVGASSFSDDR----VFFSNWGPCVDVFAPGINIMS-TYIGP 364
           N + +AC +SPA S  A+TVGA    DDR      FSNWG CVD+FAPG+ I S + + P
Sbjct: 305 NSNANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPP 361

Query: 365 HNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGV 424
              +  + SGTSM++P V+G++A  L           +GI    P+ +K ++I  +T+ V
Sbjct: 362 F--KPVAFSGTSMASPIVSGMVANLLD----------SGI---HPFDIKTELIDLATDSV 406

Query: 425 LHE----IPEGTPNRIVYNG 440
            H+       GTPNR+ + G
Sbjct: 407 FHKRTLLFKPGTPNRVAFTG 426

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  204 bits (518), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 133/364 (36%), Positives = 190/364 (52%), Gaps = 47/364 (12%)

Query: 100 LQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQI------------DSPWGLAR 147
            +G+T+  P+  +  L  +P++  +  +S  +   +++QI            D+P  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 148 ISQR------ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTP 201
           +S+R      E     Q+  Y+YD      +   YI+DTGI + H +  GRA +GA    
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVG 180

Query: 202 MEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQH 261
             P   D NGHGTH AG++GS  +GVAK   L+ VK L+A+G G +++VI  IE+     
Sbjct: 181 EGPG--DYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNH- 237

Query: 262 EQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPA 321
               KK         V NLSLG+ ++  L + +EAAV+ G+   VAAGN + +AC  SPA
Sbjct: 238 ---CKKSGML----CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 322 DSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAP 380
            +  A+TVGA     D +  FSNWG CVDVFA G+ +MS    P   +  + SGTSM++P
Sbjct: 291 SAISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPP-FKPVAYSGTSMASP 349

Query: 381 FVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEGTPNRI 436
            V GL A  L           +GI  P    +K KII  +TE V  +       GTPNRI
Sbjct: 350 SVAGLAAVLLD----------SGIDPP---DIKQKIIDLATENVFQKRTLVFKPGTPNRI 396

Query: 437 VYNG 440
            +NG
Sbjct: 397 AFNG 400

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  202 bits (515), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 148/414 (35%), Positives = 215/414 (51%), Gaps = 79/414 (19%)

Query: 77  LNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQ 136
           +N   LN   Q  IL +F      +G+T   P  LI  L  +P++  I  +   +    +
Sbjct: 40  INDEFLNIFSQGKILKTFSFGK-FEGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFDGE 98

Query: 137 K---------------------------------QIDSPWGLARISQRERLKLLQDQF-- 161
           +                                 Q ++P  LARIS+R  L    +    
Sbjct: 99  EDPSYWDDDNGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENIAP 158

Query: 162 ------YHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTH 215
                 Y+YDDS   +    Y++DTGI + H +FQGRAK+GA      P   D NGHGTH
Sbjct: 159 KTSNFSYYYDDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADLVGEGPG--DLNGHGTH 216

Query: 216 CAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKG 275
            AG+IGS +YGVAK+ +LI VK L+A+G G +++VI  IE+ T  H +  K       +G
Sbjct: 217 VAGLIGSQKYGVAKDVSLIEVKALNAKGQGNLTSVISAIEF-TVNHCRKSK-------RG 268

Query: 276 SVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFS 335
            V NLSLG+ ++  L + +EAA++ GV   VAAGN + +AC +SPA S  A++VGA    
Sbjct: 269 CVANLSLGSFRNSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGA---F 325

Query: 336 DDR----VFFSNWGPCVDVFAPGINIMS-TYIGPHNNETTSLSGTSMSAPFVTGLIAYFL 390
           DDR      FSNWG CVD+FAPG+ I S + I P   ++ + SGTSM++P VTG++A  L
Sbjct: 326 DDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPF--KSVAYSGTSMASPLVTGMVAVLL 383

Query: 391 SLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEGTPNRIVYNG 440
                      +GI    P+ +K ++I+ +T+ V H+       GTPNR+ + G
Sbjct: 384 D----------SGI---HPFDIKEELINTATDSVFHKRALLFKPGTPNRVAFTG 424

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  200 bits (508), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 135/392 (34%), Positives = 198/392 (50%), Gaps = 66/392 (16%)

Query: 90  ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQ----SIEQDSYVHALGRQK-------- 137
           I H+F      +G T  + + ++  +  +P++     +I+  ++   LG Q+        
Sbjct: 52  ISHTFSFG-SFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGD 110

Query: 138 ---------------QIDSPWGLARISQRERLKLLQDQFYHYDDS--------GASSNTK 174
                          Q ++P  LAR+S+R  L    D    Y++S            N  
Sbjct: 111 NLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNIN 170

Query: 175 CYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLI 234
            YI+DTGI + H +F GRA +G  FT   P   D NGHGTH AG++GS  +GVAK   LI
Sbjct: 171 AYIIDTGIYKEHKDFCGRAIFGRDFTGEGPG--DRNGHGTHVAGIVGSSNFGVAKKVNLI 228

Query: 235 AVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVI 294
            VK L+ RG G ++ VI  +E+     +        +G KG V NLSLGA ++  + + I
Sbjct: 229 EVKALNNRGQGNLTTVISAVEFAVNHCK-------SSGKKGCVANLSLGAVRNSVINQAI 281

Query: 295 EAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAP 353
           +AA + G+   VAAGN + +AC  SPA +P A+TVGA     D +  FSNWGPCVD+FA 
Sbjct: 282 KAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFAS 341

Query: 354 GINIMS-TYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQL 412
           G+ + S +   PH  +  + SGTSM++P VTGL+A  L            G+    P  +
Sbjct: 342 GVKVKSLSAFPPH--KPIAFSGTSMASPSVTGLVAILLD----------KGV---EPENI 386

Query: 413 KYKIISFSTEGVLHE----IPEGTPNRIVYNG 440
           K K++  +T  +L         GTPNRI +NG
Sbjct: 387 KAKLVELATHDLLQRRTLFFKPGTPNRIAFNG 418

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  199 bits (506), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 180/330 (54%), Gaps = 45/330 (13%)

Query: 138 QIDSPWGLARISQRERLKL---LQDQF-----YHYDDSGASSNTKCYILDTGINENHNEF 189
           Q  +P  L RIS R +L      +++F     Y+Y+D    SN   YILDTGI   H +F
Sbjct: 154 QYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPDF 213

Query: 190 QGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSA 249
           + R   GA  T   P   D NGHGTH AG++GS  +GVAKN TL+ VKVL  RG G ++ 
Sbjct: 214 ENRVIVGADMTGEGPG--DSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 250 VIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAG 309
           V+ GI++    H + M+   +T  K  V N+SLG  ++  +   I  A K G+   VAAG
Sbjct: 272 VLSGIQFAV-DHCRLMR---ETQGKQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 310 NEDDDACSTSPADSPHALTVGASSFSDDR----VFFSNWGPCVDVFAPGINIMSTYIGP- 364
           N +  AC TSPA + +A+TVGA    DDR     +FSNWG CVD+FAPG+ I S    P 
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 365 -HNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEG 423
            H+   T  SGTSM++P V GL A  L                  P+ +K K++  ST+ 
Sbjct: 385 SHHKHVTH-SGTSMASPVVAGLAAILLD-------------KGVEPFDVKDKLLHLSTKD 430

Query: 424 VLHEI----PEGTPNRIVYNGGGHSLKDFW 449
           V +++      GTPN+I YNG    ++DF+
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG----IEDFF 456

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  197 bits (500), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 130/365 (35%), Positives = 188/365 (51%), Gaps = 58/365 (15%)

Query: 107 LPEQLIRSLATDPIIQSIEQDSYVHALGRQK--------------QIDSPWGLARISQRE 152
           LP  +I  L  +P I  I  +  V+A                   Q ++P  L+R+S+R 
Sbjct: 70  LPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRHLSRLSRRG 129

Query: 153 RL-------KLLQDQF-YHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP 204
           +L           + F Y++D     S+   YI+DTGI + H EF+GR K+    T   P
Sbjct: 130 QLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFAIDLTQEGP 189

Query: 205 NQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQD 264
              DENGHGTH AG++GS  +GVAK   +I VK LD +G G++S +++ +E+  +  ++ 
Sbjct: 190 G--DENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALEFTIRHCKES 247

Query: 265 MKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSP 324
           + K+        V NLS GA ++  +   I+ A   G+   VAAGN + DAC  SPA S 
Sbjct: 248 VDKK-------CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNIDACWNSPASSK 300

Query: 325 HALTVGASSFSDDR----VFFSNWGPCVDVFAPGINIMS-TYIGPHNNETTSLSGTSMSA 379
             +TVGA    DDR      FSNWG CVDVFAPG+ + S ++I  + ++   LSGTSM++
Sbjct: 301 DVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHI--NGSDVLLLSGTSMAS 355

Query: 380 PFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEGTPNR 435
           P V+G+ A  L                  P  +K KII  ST+ + H+    I   TPN 
Sbjct: 356 PSVSGIAAILLD-------------KGLNPKFVKSKIIESSTKNIFHQGTIMIKPNTPNL 402

Query: 436 IVYNG 440
           IV+NG
Sbjct: 403 IVFNG 407

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  196 bits (497), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 171/320 (53%), Gaps = 39/320 (12%)

Query: 136 QKQIDSPWGLARISQRERL----KLLQDQF-----YHYDDSGASSNTKCYILDTGINENH 186
           ++Q  +P  L+R+S+R +L    +   D +     Y+YD+         YI+DTGI + H
Sbjct: 112 RRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEH 171

Query: 187 NEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGE 246
            EF GRA +G   T   P   D NGHGTH AG++GS +YGVAK+ TL+ VK L A+G G 
Sbjct: 172 AEFGGRAVFGEDLTGEGPG--DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGN 229

Query: 247 MSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAV 306
           ++ VI  +E+                 KG VINLSLGA ++  + + ++AA + G+   V
Sbjct: 230 LTTVISAMEFAVNHCRSSEG-------KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVV 282

Query: 307 AAGNEDDDACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPH 365
           AAGN + +AC  SPA +P A+TVGA     D +  FSNWG CVD+FAPG+ + S    PH
Sbjct: 283 AAGNSNINACLNSPASAPEAITVGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPH 342

Query: 366 NNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPY-QLKYKIISFSTEGV 424
                  SGTSM++P +TGL A  L                  PY ++K  I+  +T  V
Sbjct: 343 LKPIL-FSGTSMASPSITGLAAILLD--------------EGVPYDKIKDYILKMATNDV 387

Query: 425 LHE----IPEGTPNRIVYNG 440
                     GTPNR+ +NG
Sbjct: 388 FQRRTLVFKPGTPNRVAFNG 407

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  195 bits (495), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 193/381 (50%), Gaps = 65/381 (17%)

Query: 100 LQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQK---------------------- 137
            +G+T  L + L+ ++  +P++  +  +  VHA    K                      
Sbjct: 67  FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKCSV 126

Query: 138 --QIDSPWGLARISQRERL--------KLLQDQFYHYDDSGASSNTKCYILDTGINENHN 187
             Q  +P  LAR+S+R++L          L    Y YD     ++   YI+D+GI   H 
Sbjct: 127 KVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSGIYLEHE 186

Query: 188 EFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEM 247
           EF GRA  G   T       D NGHGTH AG++GS  YGVAK   LI +KVL+  G G +
Sbjct: 187 EFNGRAIPGIDLTG--EGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRLGQGSL 244

Query: 248 SAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVA 307
           + V+ GIE+   +H Q+  K+ +      V NLSLG+ ++  L + I+AA+  G+   VA
Sbjct: 245 AMVLGGIEFAV-KHCQETSKKGRC-----VANLSLGSMRTAILNKAIKAAIDAGLVVVVA 298

Query: 308 AGNEDDDACSTSPADSPHALTVGASSFSDDRV----FFSNWGPCVDVFAPGINIMSTYIG 363
           AGN + +AC  SPA +P A+TVGA    DDR+     FSNWG C+D+FAPG+ I S  I 
Sbjct: 299 AGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKSLSI- 354

Query: 364 PHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEG 423
             + E  + SGTSM++P V GL A  L            G+++    ++K  I+   T+ 
Sbjct: 355 FKDKEDVTYSGTSMASPTVAGLAALTLD----------QGVSAE---EVKDYILEMGTDN 401

Query: 424 VLHE----IPEGTPNRIVYNG 440
           V H        GTPN+I +NG
Sbjct: 402 VFHRRSLLFKPGTPNKICFNG 422

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  193 bits (491), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/369 (34%), Positives = 197/369 (53%), Gaps = 51/369 (13%)

Query: 93  SFQLAHDLQGYTSRLPEQLIRSLATDPIIQS-----IEQDSYVHALGRQKQIDSPWGLAR 147
           +  L+HD+     R P   ++ +  + ++++     +E +S++  + RQ+   +P  LAR
Sbjct: 65  TMNLSHDVLDKIKRHP--FVKEVVPNIMVKAFEGDAVEDESWLPKMKRQRG--APRHLAR 120

Query: 148 ISQRERLKL-------LQDQF-YHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVF 199
           IS+R +L          +D F Y+YD     + T+ YILDTG+  +H EF+ R ++G   
Sbjct: 121 ISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTDC 180

Query: 200 TPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQ 259
           T     + D NGHGTH AG++GS  +GVAK+  L+ VK LDA G G + +++  +E+  Q
Sbjct: 181 TG--EGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQ 238

Query: 260 QHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTS 319
             ++    Q        V+N+SLG+ KS  L + I    K G+   VAAGN + +AC TS
Sbjct: 239 DCQEHEDSQ-------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTS 291

Query: 320 PADSPHALTVGASSFSDDR----VFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGT 375
           P+ +  A+TVGA    DDR      FSNWGPCVD+FAPG+N+ S  +          SGT
Sbjct: 292 PSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVAS-LVNRDWPSFVKYSGT 347

Query: 376 SMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEG 431
           SM++P V G++A  L            G+    P  ++  +   +T+GV  +       G
Sbjct: 348 SMASPIVCGMVALLLD----------DGV---PPEDIRDYLQELATDGVFKKRTLVFKPG 394

Query: 432 TPNRIVYNG 440
           TPN ++YNG
Sbjct: 395 TPNSVLYNG 403

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  194 bits (493), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 145/428 (33%), Positives = 211/428 (49%), Gaps = 67/428 (15%)

Query: 53  IPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLI 112
           +  +Y+V FK+ T   Q+ T  +   SW    D  + I   F +    +G T  L + L+
Sbjct: 56  LAEEYLVRFKNPTA-FQQFTSTSN-RSWRQFID--HRIEKKFSIG-SFRGVTMNLSKNLV 110

Query: 113 RSLATDPIIQSIEQDSYVHALGRQKQI-------------------------DSPWGLAR 147
             L   P+I  I  +    A     ++                         D+P  LAR
Sbjct: 111 NKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKYAYQDIDEAQNVTYQPDAPRHLAR 170

Query: 148 ISQRERLKL-LQDQ-------FYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVF 199
           IS+  +L   L+D+        Y+Y+D         YI+DTGI+  H EF+ R   G   
Sbjct: 171 ISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEFEDRVIQGVDL 230

Query: 200 TPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQ 259
           T  +    DENGHGTH AG++GS  +G AK  +L+ VKVL   G GE S V+ G+E++ +
Sbjct: 231 T--KEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNVLSGLEFIVE 288

Query: 260 QHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTS 319
              +  + Q     K  V NLSLG+ +SP +   +E A++ G+ F  AAGN + DA   S
Sbjct: 289 HCTKVSRPQG----KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWAS 344

Query: 320 PADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMS 378
           PA + + +TVGA     D +  FSNWGPCV++FAPG+ I S     ++NE+  LSGTSMS
Sbjct: 345 PASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS-HLNDNESLVLSGTSMS 403

Query: 379 APFVTGLIAYFLS--LQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEGT 432
            P VTG+ A  LS  ++P+  +Q           +++Y     ST  V H         T
Sbjct: 404 TPIVTGVAAVLLSKGIEPELIAQ-----------EIEY----LSTRNVFHRRTLFFKPST 448

Query: 433 PNRIVYNG 440
           PN+I+YNG
Sbjct: 449 PNQILYNG 456

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  189 bits (480), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 127/351 (36%), Positives = 187/351 (53%), Gaps = 48/351 (13%)

Query: 107 LPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKL-------LQD 159
           +P  L ++   D +     Q+   H +    Q ++P  LARIS+R++L          + 
Sbjct: 92  VPNILFKAFENDELNNEQTQEYVSHVV----QSEAPRHLARISRRDKLPYDFTNVSSYKK 147

Query: 160 QF-YHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAG 218
            F Y+Y      ++ + YILD+G++ N  +F+GR ++G  FT     + D NGHGTH AG
Sbjct: 148 SFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFTG--DGEGDSNGHGTHVAG 205

Query: 219 VIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEY-VTQQHEQDMKKQDQTGFKGSV 277
           ++GS  YGVAK  T++ VK LD  G G +  V+  IE+ V   HE   K+         V
Sbjct: 206 LVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPEKR--------CV 257

Query: 278 INLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDD 337
            NLSLG+ K+  + + I+AA + GV   VAAGN + +AC TSPA +  A+TVGA    DD
Sbjct: 258 ANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAITVGA---FDD 314

Query: 338 RV----FFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQ 393
           R+     FSNWGPCVD++APG+ + S    P   +  S SGTSM++P V G +A  L   
Sbjct: 315 RIDTIAKFSNWGPCVDIYAPGVAVESLANFPM-VKNISYSGTSMASPIVCGQVAILLD-- 371

Query: 394 PDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE----IPEGTPNRIVYNG 440
                    GI +     +K  +I  +T+ V  +        TPNR+++NG
Sbjct: 372 --------KGIPND---DIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  189 bits (479), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 175/318 (55%), Gaps = 37/318 (11%)

Query: 138 QIDSPWGLARISQRERLKL-LQDQ-------FYHYDDSGASSNTKCYILDTGINENHNEF 189
           Q D+P  LARIS+  +L   ++D+        Y+Y+D     +   YI+DTGI  +H EF
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 190 QGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSA 249
           + R   G   T  +    D+NGHGTH AG++GS  YG AK   L+ VKVL   G GE S 
Sbjct: 185 EDRVIQGIDLT--KEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 250 VIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAG 309
           V+ G+E++ +   +  + Q     K  V NLSLG+ +SP +   +E A++ G+ F  AAG
Sbjct: 243 VLSGLEFIVEHCTRVSRPQG----KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAG 298

Query: 310 NEDDDACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHNNE 368
           N + DA   SPA + + +TVGA     D +  FSNWGPCV++FAPG+ I S     + N+
Sbjct: 299 NFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS-HLNFND 357

Query: 369 TTSLSGTSMSAPFVTGLIAYFLS--LQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLH 426
           T  LSGTSMS P VTG+ A  LS  ++P+  +Q           +L+Y     ST  V H
Sbjct: 358 TLVLSGTSMSTPIVTGVAAVLLSKGIEPEMIAQ-----------ELEY----LSTRNVFH 402

Query: 427 E----IPEGTPNRIVYNG 440
                    TPN+I+YNG
Sbjct: 403 RRTLFFKPSTPNQILYNG 420

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  186 bits (473), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 126/318 (39%), Positives = 170/318 (53%), Gaps = 37/318 (11%)

Query: 138 QIDSPWGLARISQ----------RERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHN 187
           Q D+P  LARIS+          ++R K   + +Y +D  G   N   YI+DTGI  +H 
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVN--AYIMDTGIFADHP 182

Query: 188 EFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEM 247
           EF+ R   G   T  +    D+NGHGTH AG++GS  YG AK   L+ VKVL   G GE 
Sbjct: 183 EFEDRVIQGIDLT--KEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEA 240

Query: 248 SAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVA 307
           S V+ G+E++ +   +  + Q     K  V NLSLG+ +SP +   +E A++ G+ F  A
Sbjct: 241 SNVLSGLEFIVEHCTKVSRPQG----KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAA 296

Query: 308 AGNEDDDACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHN 366
           AGN + DA   SPA + + +TVGA     D +  FSNWGPCV++FAPG+ I S     + 
Sbjct: 297 AGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLS-HLNY 355

Query: 367 NETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLH 426
           N+T  LSGTSMS P VTG+ A  LS           GI    P  +  +I   ST  V H
Sbjct: 356 NDTLILSGTSMSTPIVTGVAAILLS----------KGI---EPEMIAQEIEYLSTRNVFH 402

Query: 427 E----IPEGTPNRIVYNG 440
                    TPN+I+YNG
Sbjct: 403 RRTLFFKPSTPNQILYNG 420

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  187 bits (476), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 175/320 (54%), Gaps = 33/320 (10%)

Query: 134 GRQKQIDSPWGLARISQRERLKL-LQDQ-------FYHYDDSGASSNTKCYILDTGINEN 185
           G   Q  +P  L ++S R +L   ++D+        Y+YD     +N+  YI+DTG+ + 
Sbjct: 146 GVDIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKE 205

Query: 186 HNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDG 245
           H EF  R  +G  F  +   + D NGHGTH AG+IGS  +GVAKN TL  VKVLD +G G
Sbjct: 206 HKEFGNRVHFGGDF--IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFG 263

Query: 246 EMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFA 305
            +++V+ GIE+       + K + Q   K  VIN+SLG  ++P +   I+ A   G+   
Sbjct: 264 NLTSVLEGIEFAV----NNCKLKQQPMGKNCVINMSLGTIRNPIINEAIKEAFLSGITPV 319

Query: 306 VAAGNEDDDACSTSPADSPHALTVGASSFSDDRV-FFSNWGPCVDVFAPGINIMSTYIGP 364
           VAAGN +  AC TSPA S  A+TVGA     D +  FSNWG CVD+FAPG+ I S     
Sbjct: 320 VAAGNNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRM 379

Query: 365 HNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGV 424
             N     SGTSM++P V GL+A  + ++   K             ++K K+I  S++ +
Sbjct: 380 LENGVIH-SGTSMASPIVAGLVA--ILMEKGYKCD-----------EIKQKLIDDSSKSI 425

Query: 425 LHEI----PEGTPNRIVYNG 440
             ++      GTPNR++YNG
Sbjct: 426 FSKLTLFFKYGTPNRVIYNG 445

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  183 bits (465), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 170/318 (53%), Gaps = 37/318 (11%)

Query: 138 QIDSPWGLARISQRERLKL-LQDQF-------YHYDDSGASSNTKCYILDTGINENHNEF 189
           Q D+P  LARIS+  +L   ++D+        Y+Y+D     +   YI+DTGI  +H EF
Sbjct: 174 QSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEF 233

Query: 190 QGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSA 249
           + R   G   T  +    D+NGHGTH AG++GS  YG AK   L+ VKVL   G GE S 
Sbjct: 234 EDRVIQGIDLT--KEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 291

Query: 250 VIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAG 309
           V+ G+E++ +   +  + Q     K  V NLSLG+ +SP +   +E A++ G+ F  AAG
Sbjct: 292 VLSGLEFIVEHCTRVSRPQG----KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAG 347

Query: 310 NEDDDACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHNN- 367
           N + DA   SPA + + +TVGA     D +  FSNWGPCV++FAPG+ I S     H N 
Sbjct: 348 NFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESL---SHLNY 404

Query: 368 -ETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLH 426
            +T  LSGTSMS P VTG+ A  LS           GI    P  +  +I   ST  V H
Sbjct: 405 EDTLILSGTSMSTPIVTGVAAVLLS----------KGI---EPALIAQEIEYLSTRNVFH 451

Query: 427 E----IPEGTPNRIVYNG 440
                    T N+I+YNG
Sbjct: 452 RRTLFFKPSTANQILYNG 469

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  181 bits (460), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 174/340 (51%), Gaps = 55/340 (16%)

Query: 136 QKQIDSPWGLARISQRERL--------KLLQDQFYHYDDSGASSNTKCYILDTGINENHN 187
           + Q ++P  LAR+S+R +L        +   D  Y+Y       +   Y+LD+G+  +H 
Sbjct: 158 KTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHC 217

Query: 188 EFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEM 247
           +F+GRA +GA F     N  D+NGHGTH AG+IGS  YGV+K   +I VKVLD+ G G +
Sbjct: 218 DFEGRAYYGADFI-RSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTL 276

Query: 248 SAVIRGIEYVTQQHE-----------------QDMKKQDQTGFKGSVINLSLGAGKSPAL 290
             V+ G+E+V+                      +    D    K  VINLSLG  +S  +
Sbjct: 277 DTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTII 336

Query: 291 LRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRV----FFSNWGP 346
              IE  +K G+   VAAGN + +AC TSPA     +TVGA    DDR+     FSNWG 
Sbjct: 337 NEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGN 393

Query: 347 CVDVFAPGINI--MSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGI 404
           CVD+FAPG+ +  +S     +  E T   GTSM+ P VTGL+A  L           +GI
Sbjct: 394 CVDIFAPGVLVKSLSNKFPYYPIEQT---GTSMATPIVTGLVALLLD----------SGI 440

Query: 405 TSPTPYQLKYKIISFSTEGVLHE----IPEGTPNRIVYNG 440
               P Q+K ++   +T+ +          GTPNRI +NG
Sbjct: 441 ---KPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNG 477

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  179 bits (455), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 182/344 (52%), Gaps = 42/344 (12%)

Query: 110 QLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRERLKL-----LQDQF-YH 163
           + IR +  +P+  +  +  + +A+    Q+D+P  LAR  +R  L        +  F Y+
Sbjct: 404 EPIRGIPAEPVAGAPGEGLHQYAI----QVDAPRHLARTCRRTGLPFDPSGDKEYTFNYY 459

Query: 164 YDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSH 223
           YD+         Y+LD+GI ++H EF GRA +G   T   P   D NGHGTH AG++GS 
Sbjct: 460 YDEEHLGEGVNVYVLDSGIYKSHPEFDGRAHFGIDTTKEGPG--DLNGHGTHVAGLVGSR 517

Query: 224 EYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLG 283
            +G+AK   +  +KV+   G G  S +I G+E+  +  +Q  K+         V N+SLG
Sbjct: 518 TFGIAKKANIYEIKVMTVDGRGSTSNIIAGVEFAVKHCQQSGKR--------CVANMSLG 569

Query: 284 A---GKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA-SSFSDDRV 339
               G S AL   +EAA++ G+ F VAAGN  + AC  SPA    A+TVGA    SD   
Sbjct: 570 GLSFGHS-ALDSAVEAAIEEGLVFVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIA 628

Query: 340 FFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQ 399
            FSN+G CVD+FAPG+ + S    P N     L+GTSMSAP   G++A  L         
Sbjct: 629 SFSNYGKCVDIFAPGVAVASLSNSPSNT-MRVLNGTSMSAPITAGVVAVLLD-------- 679

Query: 400 FYTGITSPTPYQLKYKIISFSTEGVLHE---IPEGTPNRIVYNG 440
              GI    P+++K  ++S ST+G+ H+   +   TP+R ++ G
Sbjct: 680 --QGI---EPHEVKDHLLSISTKGLFHKRRLVSSRTPDRALFTG 718

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  177 bits (449), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 166/316 (52%), Gaps = 38/316 (12%)

Query: 138 QIDSPWGLARISQRERLKLLQD-----QF-YHYDDSGASSNTKCYILDTGINENHNEFQG 191
           Q  +P  LAR  +R  L          +F Y+YD          YILD+GI+++H EF+G
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 192 RAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVI 251
           RA +G   T   P   D NGHGTH AG++GS  YG AK  T+  VKV+   G G  S +I
Sbjct: 330 RAVFGIDTTNEGPG--DLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNII 387

Query: 252 RGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGA---GKSPALLRVIEAAVKLGVHFAVAA 308
            G+E+  +  +Q  KK         V N+SLG    G S AL   +EAA++ G+ F VAA
Sbjct: 388 AGVEFAVKHCQQSGKK--------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAA 438

Query: 309 GNEDDDACSTSPADSPHALTVGA-SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNN 367
           GN  + AC  SPA    A+TVGA    SD    FSN+G CVD+FAPG+ + S    P+N 
Sbjct: 439 GNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNT 498

Query: 368 ETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHE 427
               L+GTSMSAP   G++A  L            G+       +K ++I  ST+GV H 
Sbjct: 499 -VRVLNGTSMSAPITAGVVAVLLD----------QGVKHE---DVKERLIDLSTKGVFHR 544

Query: 428 ---IPEGTPNRIVYNG 440
              +   TP+R ++NG
Sbjct: 545 RRLVSSRTPDRTLFNG 560

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  170 bits (431), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 188/391 (48%), Gaps = 68/391 (17%)

Query: 100 LQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGR------------------------ 135
            +G T  L + ++ ++  +P++  +  +  +HA                           
Sbjct: 65  FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDIKQPEELFDKNSY 124

Query: 136 --QKQIDSPWGLARISQRERLKLLQDQFYHYDDSGA--------SSNTKCYILDTGINEN 185
             + Q  +P  LAR+S+R  L    D    Y+DS +         ++   YI+D+GI+ N
Sbjct: 125 LVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDVNAYIIDSGIDIN 184

Query: 186 HNEFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDG 245
             EF+GRA  G   T   P   D NGHGTH AG++GS  YGVAKN TL+ VK LD +G G
Sbjct: 185 QEEFEGRATHGLDLTGEGPG--DRNGHGTHVAGLVGSKTYGVAKNVTLVEVKALDRQGSG 242

Query: 246 EMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFA 305
            +  VI  +E+V     +   K+        V NLSLGA   P L   I+A V  GV   
Sbjct: 243 SLITVISALEFVVNHCGKSKSKK-------CVANLSLGAFMMPLLNEAIKATVDSGVVVV 295

Query: 306 VAAGNEDDDACSTSPADSPHALTVGASSFSDDRV----FFSNWGPCVDVFAPGINIMSTY 361
           VAAGN + DAC  SPA    A+TVGA    DDR+     FSNWG CVD+FAPG+ I S  
Sbjct: 296 VAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIFAPGVAISSLS 352

Query: 362 IGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFST 421
           I   N ++   SGTSM++P V G+++  L            G+ +     ++  +   +T
Sbjct: 353 I-KDNQKSVEFSGTSMASPQVAGIVSILLD----------QGVENE---DIRDYLFELAT 398

Query: 422 EGVLHE----IPEGTPNRIVYNGGGHSLKDF 448
           + V  +        TPNRI +NG     +DF
Sbjct: 399 DDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  172 bits (435), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 166/320 (51%), Gaps = 43/320 (13%)

Query: 138 QIDSPWGLARISQRERLKL-------LQDQF-YHYDDSGASSNTKCYILDTGINENHNEF 189
           Q  +P  LARIS R++L          ++Q  Y+YDD+        Y++DTGI + H +F
Sbjct: 287 QRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKEHKDF 346

Query: 190 QGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSA 249
           + R ++G   T       D NGHGTH AG+IGS  YGV K   +I VK +   G  ++S 
Sbjct: 347 EDRVEFGTDLTG--EGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQLSH 404

Query: 250 VIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAG 309
           +I  IEY        + K      K  V+N+SLG+     +   +E+A+  GV F VAAG
Sbjct: 405 IIEAIEYTVNDCNSRVDK------KACVVNMSLGSFYVKVINEAVESAIAEGVVFVVAAG 458

Query: 310 NEDDDACSTSPADSPHALTVGASSFSDDRV----FFSNWGPCVDVFAPGINIMS-TYIGP 364
           N + DAC +SP  S +A+TVGA    DDR+     FSNWG CVD+FA G+ + S +   P
Sbjct: 459 NNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQVP 515

Query: 365 HNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGV 424
           +  +    SGTSM++P V G ++  LS           G+    P  ++ +++  ST+G 
Sbjct: 516 Y--KYIKYSGTSMASPIVCGFVSILLS----------QGV---KPNDVQEEMVKLSTKGD 560

Query: 425 LHE----IPEGTPNRIVYNG 440
                      T NRI++NG
Sbjct: 561 FTRRSLIFKPFTSNRILFNG 580

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  160 bits (404), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 117/326 (35%), Positives = 166/326 (50%), Gaps = 43/326 (13%)

Query: 138 QIDSPWGLARISQRERLKLLQDQ------FYHYDDSGASSNTKCYILDTGINENHNEFQG 191
           Q  +P  LARIS+R +L +++         YHY +         Y+LD+G+N +H +F+G
Sbjct: 154 QSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHPDFEG 213

Query: 192 RAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVI 251
           RA  G   T       D  GHGTH AG+IGS  YGVAK   ++ VKVLD+ G G ++ +I
Sbjct: 214 RAMKGIDTT--GEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTVTNII 271

Query: 252 RGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGA-GKSPALLRVIEAAVKLGVHFAVAAGN 310
            G+EYV  Q     +K         VIN+SLGA G    L + + A ++ GV   VA GN
Sbjct: 272 EGLEYVVNQCIGKKRK--------CVINMSLGAPGTHSILDKAVSAVIEEGVVVVVAGGN 323

Query: 311 EDDDACSTSPADSPHALTVGASSFSDDRVF----FSNWGPCVDVFAPGINIMSTYIGPHN 366
              +AC  SPA    A+TV A    DDR      FSNWG C+D++APG+N+ S  +    
Sbjct: 324 SGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKS--LSNKG 378

Query: 367 NETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLH 426
             T  LSGTSM++P V G  A +L    D             P +++  +   +T GV  
Sbjct: 379 RGTFVLSGTSMASPIVAGAAAIYLDQGAD-------------PAEVRKILSKTATRGVFK 425

Query: 427 E----IPEGTPNRIVYNGGGHSLKDF 448
           +    +   TPN+++Y G      +F
Sbjct: 426 KRAIAVRPRTPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  154 bits (388), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 140/259 (54%), Gaps = 17/259 (6%)

Query: 138 QIDSPWGLARISQRERLKLLQDQFYHY----DDSGASSNTKCYILDTGINENHNEFQGRA 193
           Q ++P  L+R S+  +L    +  Y+Y    D  GA  N   Y+LD+GI  +H EF+GR 
Sbjct: 145 QFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGA--NVTVYVLDSGIRMDHPEFEGRI 202

Query: 194 KWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRG 253
                FT  +    D  GHGT  AG+IGS  YGVAKN  LI +KVL+ +G G + ++++G
Sbjct: 203 LEAYDFT--DSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 254 IEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDD 313
           ++++T+  E++            +IN SLGA     L +  E     G+    AAGN   
Sbjct: 261 LQFITKHCEENTNGN-------CIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 314 DACSTSPADSPHALTVGASSFSDDRVF-FSNWGPCVDVFAPGINIMSTYIGPHNNETTSL 372
           +AC  +PA S    TVG+    DD +  FSNWG CVD+ APG+ +  T +  +   +   
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYV-RTLLYTNQKGSRES 372

Query: 373 SGTSMSAPFVTGLIAYFLS 391
           SGTS+S P VTGL A  LS
Sbjct: 373 SGTSVSTPIVTGLAAILLS 391

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  147 bits (370), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/303 (32%), Positives = 157/303 (51%), Gaps = 14/303 (4%)

Query: 93  SFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRE 152
           +  L +  +      P++L+ +L  D  I ++  D  +       Q  +P  LAR+SQ+ 
Sbjct: 48  AISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKS 107

Query: 153 RLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENGH 212
            L+     + ++ + G  +    Y+LDTGI++ H E +GR +  A  T    +  D +GH
Sbjct: 108 TLRGSDGTYIYHSNGG--NGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGH 165

Query: 213 GTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTG 272
           GT  AGVIGS  +G AK   L  V+V D+ G+  +  VIR +E     H   +    Q  
Sbjct: 166 GTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALE-----HASKLASVTQ-- 218

Query: 273 FKGSVINLSLGAGKSPALLRVIEAAVK-LGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331
            + SV+ +     K+  L   IEA ++   +   VA GN + +AC +SPA +  ALT+G+
Sbjct: 219 -RPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGS 277

Query: 332 SSFS--DDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYF 389
              +  D    F+N+G C+D FA G+NI S   G + +  T  SGTS+SA   +G++AY+
Sbjct: 278 IDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESN-TQYSGTSISAGIASGVVAYY 336

Query: 390 LSL 392
           +SL
Sbjct: 337 MSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  141 bits (355), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 155/305 (50%), Gaps = 15/305 (4%)

Query: 93  SFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRE 152
           +  L +  +      P+QL+        I ++  D  +       Q  +P  LAR+SQ+ 
Sbjct: 48  AITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLSQKS 107

Query: 153 RLKLLQ--DQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDEN 210
            L+     D   +   S A +    Y+LDTGI+  H  F+GR +  A F+       D +
Sbjct: 108 SLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATGDPH 167

Query: 211 GHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQ 270
           GHGT  AGVIGS  +GVAK   L  V+V ++ G   +  V+R +E+ +        K   
Sbjct: 168 GHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHAS--------KLAA 219

Query: 271 TGFKGSVINLSLGAGKSPALLRVIEAAVK-LGVHFAVAAGNEDDDACSTSPADSPHALTV 329
              + S+I + L   ++  L   +EA V+ L +   VAAGNE+  ACS SPA +  ALT+
Sbjct: 220 VTKRPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTI 279

Query: 330 GASSFSDDRVF--FSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIA 387
           G+   + +     F+N+  CVD+F  G+++ +  +G  ++    LSGTS+SA   +GL+A
Sbjct: 280 GSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGLVA 337

Query: 388 YFLSL 392
           Y++S+
Sbjct: 338 YYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  118 bits (295), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 101/355 (28%), Positives = 168/355 (47%), Gaps = 42/355 (11%)

Query: 56  QYIVLFKSDTTDIQRETHLATLNSWL----LNT--DPQYTILHSFQLAHDLQGYTSRLPE 109
           +Y+V   S+T+          LNS+L    LN   +P   I+    +  D  G++    +
Sbjct: 25  EYVVQLTSETS----------LNSFLESNSLNNLDEPVDKIV----IGSDFHGFSGEFED 70

Query: 110 QLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQ---RERLKLLQDQFYHYDD 166
           +++  L  DP + SI  D  ++     +Q D+P  LAR+S      R+    +  + +  
Sbjct: 71  EVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKNENAFIFH- 129

Query: 167 SGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEP-NQEDENGHGTHCAGVIGSHEY 225
           S A      YI+D+GI+  H  F  R     +     P    D +GHGT  AG++ S  +
Sbjct: 130 SHAGIGVDVYIVDSGIDSQHPAFMNRHISKLIDLTDNPIPVGDPHGHGTAIAGLVTSDTF 189

Query: 226 GVAKNTTLIAVKVLDARGDG-EMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGA 284
           GV K   L  V+V+DA  +G ++S +++ +E++       M+         SV  L    
Sbjct: 190 GVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRATMRP--------SVAVLPFSM 241

Query: 285 GKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPA---DSPHALTVGASSF--SDDRV 339
            K+  L   IE+     +   V AGN+   AC+ SPA   +S   L+VG+  +  S +  
Sbjct: 242 SKNAILNSAIESMPN-SIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDYRSSIEIA 300

Query: 340 FFSNWGPCVDVFAPGINIMSTYIGPHNNET--TSLSGTSMSAPFVTGLIAYFLSL 392
            FSN+G CVDVF  G+ + + +   +++E   + +SGTSMS     G + Y++SL
Sbjct: 301 SFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  112 bits (281), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 100/339 (29%), Positives = 163/339 (48%), Gaps = 26/339 (7%)

Query: 68  IQRETHL-ATLNSWLLNTDPQ-YTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIE 125
           +Q +T L A LNS+ L++D Q   I   F+L    + +T      +++ L  DP + +I 
Sbjct: 21  LQDKTALNAVLNSYALSSDQQGPEITDIFELG-SFRAFTGDFSGPILQKLYNDPNVLAIS 79

Query: 126 QDSYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINEN 185
           +D  +       Q ++P  L  +S    +  L  Q + Y  +G +     Y+LDTGI+  
Sbjct: 80  RDGSLKLQEIVLQNNAPSHLVGLSS---ISPLSHQPFIYRSNGGNG-VDVYLLDTGIDIK 135

Query: 186 HNEFQ--GRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARG 243
           H         +   +     P   D  GHGT  AG+I S  +GV K   L+ V+V D+ G
Sbjct: 136 HPNLSKLNILRMADLTQSPVPQGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNG 195

Query: 244 DGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVH 303
           D ++S +++ +  +TQ+H +  K+         VI L +  G +P L   I A+    V 
Sbjct: 196 DVKLSTILQALT-LTQRHIEGTKRPSVV-----VIPLEVEDGNNPILTEAI-ASFDQSVP 248

Query: 304 FAVAAGNEDDDACSTSPAD----SPHALTVGASSFSDDRVFFSNWGPCVDVFAPG---IN 356
             + AGN   DA + SPA+      + + VG+   +++   F+N+G  VDVF  G     
Sbjct: 249 IIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITT 308

Query: 357 IMSTYI---GPHNNETTSLSGTSMSAPFVTGLIAYFLSL 392
           + ST +   G  N+ T  +SGTS S+    G+I Y++SL
Sbjct: 309 LQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score =  107 bits (268), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 86/315 (27%), Positives = 150/315 (47%), Gaps = 29/315 (9%)

Query: 94  FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQRER 153
            ++ +    ++  L ++ + S+  D    +I  + Y+   G  KQ D+P  L R++ ++ 
Sbjct: 53  IEIGNSFIAFSGDLSKEQVSSVFEDNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDS 111

Query: 154 LKLLQ-----DQFYHYDDSGASSNTKCYILDTGINENHNEF-QGRAKWGAVFTPMEPNQE 207
           +K  Q     +Q+   D SG  +    YI+DTGI+  H  + Q         T       
Sbjct: 112 IKSSQYHYANNQYIFSDTSG--NGVDIYIVDTGIDIQHPIYLQNNIHKLIDLTTSPIPSG 169

Query: 208 DENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGD-GEMSAVIRGIEYVTQQHEQDMK 266
           D NGHGT  AG+I S  +GV K+  L+ V+V+DA      MS V+  +  +        +
Sbjct: 170 DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMSRVLSALSLI--------E 221

Query: 267 KQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSP---ADS 323
           K +Q   + S+I L     K+  L   IE   K  +   + AGN+  +AC  SP      
Sbjct: 222 KHEQKTMRPSIIVLPFQTEKNTILESAIENISK-KIPVIIPAGNKHQNACKLSPMGIKKL 280

Query: 324 PHALTVGASSFSDDRVF-----FSNWGPCVDVFAPGINIMSTYIGPHNNETT--SLSGTS 376
            + L VG+  +S+++ +     FSN+G CVD++  G++I +     +  +    +++GTS
Sbjct: 281 SNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTS 340

Query: 377 MSAPFVTGLIAYFLS 391
            S   V G++ Y++S
Sbjct: 341 YSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 150/327 (45%), Gaps = 28/327 (8%)

Query: 77  LNSWLLNTDPQYTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQ 136
           L  + +N+D     L+S  +  + Q +++ L +  +RSL  D  I +I  D  +      
Sbjct: 38  LREFGINSDEAQVELYS--VGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMI 95

Query: 137 KQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWG 196
            Q D+P  L ++ + E      D  + YD S A +    YI DTGI  N           
Sbjct: 96  VQKDAPRHLTKLLETEA----GDNEFVYD-STAGNGVDIYIFDTGIARNSPGLSASRIHD 150

Query: 197 AVFTPMEPNQEDEN-GHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIE 255
               P  P ++ E   HGT  +G+IGS  +GV K   LI V V D  G   MS V++G+ 
Sbjct: 151 MPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKGLN 210

Query: 256 YVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDA 315
            V QQH +   +        SVIN S    K+ A+L          V  AVAAGN     
Sbjct: 211 LV-QQHVKHTNRP-------SVINFSYCTLKN-AILNSAFDNFPRDVPIAVAAGNYKQPG 261

Query: 316 CSTSPAD---SPHALTVGASSFSDDRVF---FSNWGPCVDVFAPGINIMSTYI----GPH 365
           CS SP     +   L  G+   +DD +    FSN+G CV  +APG  +++  I     P+
Sbjct: 262 CSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRPN 321

Query: 366 NNETT-SLSGTSMSAPFVTGLIAYFLS 391
           + +T   +SGTS S+    G+I Y+++
Sbjct: 322 SRDTVIIISGTSGSSALGAGVIGYYMA 348

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 108/221 (48%), Gaps = 12/221 (5%)

Query: 176 YILDTGINENHNEFQGRA--KWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTL 233
           Y+ DTGI+  H   Q     K     +   P   D +GHGT  AG+I S  +GV K+ +L
Sbjct: 120 YVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRGADPHGHGTMMAGLIASETFGVLKSCSL 179

Query: 234 IAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRV 293
           + V+V D  G+ ++S +++GI   +  H +  K+        SV  L +  GK   +L  
Sbjct: 180 VDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRP-------SVFVLPMTIGKKNHILDN 231

Query: 294 IEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAP 353
              A+   +   + AGN+  DAC  SP +  + L +G+    +    FSN+G CVDV+  
Sbjct: 232 FLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYTS 291

Query: 354 GINIMSTYIGPHNNETT--SLSGTSMSAPFVTGLIAYFLSL 392
           G +I++       NE    S +GTS S     G++ Y +S+
Sbjct: 292 GTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TDEL0G02400 Chr7 (460300..460533) [234 bp, 77 aa] {ON} Anc_2.310
           YNL015W
          Length = 77

 Score = 33.9 bits (76), Expect = 0.088,   Method: Composition-based stats.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 6/45 (13%)

Query: 90  ILHSFQLAHDLQGYTSRLPEQL-IRSLAT--DPIIQSIEQDSYVH 131
           I H F L   ++GYT +LPE+L I  L    +PII ++E+D  VH
Sbjct: 33  ITHEFSL---IKGYTVKLPEELHINKLKEGFNPIIANVEEDKEVH 74

>NCAS0G03660 Chr7 complement(681457..681696) [240 bp, 79 aa] {ON}
           Anc_2.310
          Length = 79

 Score = 32.3 bits (72), Expect = 0.38,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 8/48 (16%)

Query: 89  TILHSFQLAHDLQGYTSRLPEQL----IRSLATDPIIQSIEQDSYVHA 132
           +++H F L   ++GYT +LP++L    +R    D +I++IE+D  VHA
Sbjct: 30  SVVHEFSL---IKGYTVKLPDKLKLDALRHKHGD-VIENIEEDKEVHA 73

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 90/215 (41%), Gaps = 31/215 (14%)

Query: 200 TPMEPNQEDENGHGTHCAGVIGSHE-----YGVAKNTTLIAVKVLDAR--GDGEMSAVIR 252
           TP+   +  ++ HGT CAG I + +      GVA N  +  +++L      + E ++++ 
Sbjct: 225 TPLPKPRLRDDYHGTRCAGEIAAVKNDACGVGVAYNAKVAGIRILSGEITSEDEAASLVY 284

Query: 253 GIE----YVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAA 308
           G+     Y       D  +Q Q      ++  ++  G       V+E   + G  +  A+
Sbjct: 285 GLGVNDIYSCSWGPADDGRQMQA--PDELVKKAIVKG-------VLEGRDEKGALYVFAS 335

Query: 309 GN---EDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVF----APGINIMSTY 361
           GN    DD+       +S +++TVGA         ++     V V       G +I ST 
Sbjct: 336 GNGGLYDDNCNYDGYTNSIYSITVGAIDHKGLHPPYAEACSAVLVVTYSSGSGEHIHSTD 395

Query: 362 IGPHNNETTSL-SGTSMSAPFVTGLIAYFLSLQPD 395
           +   NN+ +    GTS +AP   G+ +  L   PD
Sbjct: 396 V---NNQCSHRHGGTSAAAPLAAGIYSLVLEANPD 427

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 201 PMEPNQEDENGHGTHCAGVIGSHE-----YGVAKNTTLIAVKVLDAR--GDGEMSAVIRG 253
           PM   +  ++ HGT CAG I + +      GVA N  +  +++L A    + E +++I  
Sbjct: 196 PMPKPRLSDDYHGTRCAGEIAAVKNKACGIGVAYNAKVAGIRILSAEVTAEDEAASLIHA 255

Query: 254 IEYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGN--- 310
           ++ V   +       D     G V+       +   +  V +   + G  +  A+GN   
Sbjct: 256 LD-VNDIYSCSWGPLDD----GRVLQGPDDLVRKALVTGVTKGRNEKGALYVFASGNGGM 310

Query: 311 EDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVF----APGINIMSTYIGPHN 366
            DD+       +S +++TVGA         +S     V V       G +I ST I  H 
Sbjct: 311 YDDNCNYDGYTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDI--HG 368

Query: 367 NETTSLSGTSMSAPFVTGLIAYFLSLQPD 395
             + +  GTS +AP   G+ +  L   P+
Sbjct: 369 KCSDTHGGTSAAAPLAAGVYSLVLEANPN 397

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 25/200 (12%)

Query: 212 HGTHCAGVI--GSHEY---GVAKNTTLIAVKVLDAR--GDGEMSAVIRGIEYVTQQHEQD 264
           HGT CAG I  G +++   GVA N  +  +++L A    + E +++I  ++         
Sbjct: 208 HGTRCAGEIAAGKNQFCGVGVAYNAKVAGLRILSAEVTSEDEAASLIHALDVNDIYSCSW 267

Query: 265 MKKQDQTGFKG--SVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNE---DDDACSTS 319
               D    +G   ++  +L  G       V++   + G  +  A+GN    DD+     
Sbjct: 268 GPSDDGRSLQGPDDLVKKALVTG-------VLKGRDEKGALYVFASGNGGMFDDNCNYDG 320

Query: 320 PADSPHALTVGASSFSDDRVFFSNWGPCVDVF----APGINIMSTYIGPHNNETTSLSGT 375
             +S +++TVGA         +S     V V       G +I ST I  H   + +  GT
Sbjct: 321 YTNSIYSITVGAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDI--HGRCSDTHGGT 378

Query: 376 SMSAPFVTGLIAYFLSLQPD 395
           S +AP   G+ +  L   P+
Sbjct: 379 SAAAPLAAGVYSLVLEANPN 398

>YMR210W Chr13 (687516..688865) [1350 bp, 449 aa] {ON} Putative
           acyltransferase with similarity to Eeb1p and Eht1p, has
           a minor role in medium-chain fatty acid ethyl ester
           biosynthesis; may be involved in lipid metabolism and
           detoxification
          Length = 449

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 8/131 (6%)

Query: 277 VINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS--- 333
           +I   L  G   + +R I   +     F     N     C  S   +P     G ++   
Sbjct: 154 IILHGLTGGSRESYVRAIVHEITTKYDFEACVFNAR--GCCYSAITTPLLYNGGWTNDIR 211

Query: 334 --FSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
              +D R  F N    +  F+ G +IM+ Y+G  ++ T      S+S PF     AYF++
Sbjct: 212 YCVNDLRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTKIECAISVSNPFDLYNSAYFIN 271

Query: 392 LQPDTKSQFYT 402
             P   S+FY+
Sbjct: 272 STP-MGSRFYS 281

>ZYRO0G06710g Chr7 complement(537970..539724) [1755 bp, 584 aa] {ON}
           conserved hypothetical protein
          Length = 584

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 7   ISICLLTRIGYSLVIP--SIWAQTGKSPGVFNIDSDSPSNIIHHAASP 52
           I+IC+ T +G ++  P   I+ Q GK P  +  D+ +P  I+ HA +P
Sbjct: 269 IAICICTMVGVAVGGPYYGIFQQYGKGPPYYYPDTFNPLPIVKHAIAP 316

>Smik_13.418 Chr13 (671591..672937) [1347 bp, 448 aa] {ON} YMR210W
           (REAL)
          Length = 448

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 53/131 (40%), Gaps = 8/131 (6%)

Query: 277 VINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS--- 333
           +I   L  G   + +R I   +     F     N     C  S   +P     G ++   
Sbjct: 153 IILHGLTGGSRESYVRAIVHEITTKYDFEACVFNAR--GCCYSAITTPLLYNGGWTNDIR 210

Query: 334 --FSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391
              +D R  F N    +  F+ G +IM+ Y+G  ++ T      S+S PF     AYF++
Sbjct: 211 YCVNDLRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTKIECAISVSNPFDLYNSAYFIN 270

Query: 392 LQPDTKSQFYT 402
             P   S+FY+
Sbjct: 271 STP-MGSRFYS 280

>Suva_13.393 Chr13 (667909..669252) [1344 bp, 448 aa] {ON} YMR210W
           (REAL)
          Length = 448

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 282 LGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS-----FSD 336
           L  G   + +R +   +     F     N     C  S   +P     G ++      +D
Sbjct: 159 LTGGSRESYVRAVVHEITTKYDFEACVFNAR--GCCYSAITTPLLYNGGWTNDIRYCIND 216

Query: 337 DRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDT 396
            R  F N    +  F+ G +IM+ Y+G  ++ T      SMS PF     +YF++  P  
Sbjct: 217 LRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTKIECAISMSNPFDLFHSSYFINNTP-M 275

Query: 397 KSQFYTGI 404
            S+FY+ +
Sbjct: 276 GSRFYSPV 283

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 83/205 (40%), Gaps = 34/205 (16%)

Query: 212 HGTHCAGVIGSHE------YGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDM 265
           HGT CAG I + +       GVA N  +  +++L     GE++A       V      D+
Sbjct: 227 HGTRCAGEIAATKDNGFCGIGVAYNAKVAGIRILS----GELTAEDEAASLVHALDVNDI 282

Query: 266 ------KKQDQTGFKG--SVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACS 317
                  K D T  +G   ++  ++  G S    R  + A+ +   FA   G    D C+
Sbjct: 283 YSCSWGPKDDGTHLQGPTDLVKKAMIRGTSDG--RDKKGAIYV---FASGNGGAFGDNCN 337

Query: 318 TSP-ADSPHALTVGASSFSDDRVFFSNWGPCVDVFA------PGINIMSTYIGPHNNETT 370
                +S +++T+GA         +S    C  V A       G  I ST IG  N  + 
Sbjct: 338 YDGYTNSIYSITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIG--NKCSD 393

Query: 371 SLSGTSMSAPFVTGLIAYFLSLQPD 395
              GTS +AP   G+ +  L + P+
Sbjct: 394 HHGGTSAAAPLAAGIFSLVLQVNPN 418

>Skud_13.379 Chr13 (661288..662640) [1353 bp, 450 aa] {ON} YMR210W
           (REAL)
          Length = 450

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 51/126 (40%), Gaps = 8/126 (6%)

Query: 282 LGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGASS-----FSD 336
           L  G   + +R I   +     F     N     C  S   +P     G ++      +D
Sbjct: 160 LTGGSRESYVRAIVHEITTKYDFEACVFNAR--GCCYSAITTPLLYNGGWTNDIRYCVND 217

Query: 337 DRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDT 396
            R  F N    +  F+ G +IM+ Y+G  ++ T      S+S PF     AYF++  P  
Sbjct: 218 LRKRFPNRKFYMMGFSLGASIMTNYLGEESDRTKIECAISVSNPFDLYNSAYFINSTP-M 276

Query: 397 KSQFYT 402
            S+FY+
Sbjct: 277 GSRFYS 282

>SAKL0D14234g Chr4 complement(1173584..1174828) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39727 Saccharomyces cerevisiae
           YAL042W ERV46 Protein localized to COPII-coated vesicles
           forms a complex with Erv41p involved in the membrane
           fusion stage of transport
          Length = 414

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 38  DSDSPSNIIHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSWLLNT 84
           D D PS  I HAA+ IP  +I    S    I RE H  T + +LLN 
Sbjct: 339 DEDHPS--IMHAATGIPGLFINFEMSALKVINREQHKLTWSGFLLNC 383

>CAGL0L08624g Chr12 (940058..946312) [6255 bp, 2084 aa] {ON} similar
           to uniprot|P43583 Saccharomyces cerevisiae YFL007w
          Length = 2084

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 12/60 (20%)

Query: 345 GPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGI 404
           G  VD+F P I I S       N+ + ++ + +S+      +AY LS QP   SQ Y G+
Sbjct: 528 GDIVDIFLPLIKIGS------QNKNSDITNSYISS------LAYLLSTQPPNSSQIYDGV 575

>SAKL0G12694g Chr7 (1081452..1084490) [3039 bp, 1012 aa] {ON} some
           similarities with uniprot|Q07798 Saccharomyces
           cerevisiae YLL005C SPO75 Meiosis-specific protein of
           unknown function required for spore wall formation
           during sporulation dispensable for both nuclear
           divisions during meiosis
          Length = 1012

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 88  YTILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSI---EQDSYVHALGRQKQ--IDSP 142
           +TI+  FQ+++    Y + +P      +  +  I++    E+D +     R+K   I  P
Sbjct: 908 FTIIAHFQISNTYNNYLNNIPASFFLKVKNNKKIENRPENEEDEFYCPQLRKKDRVIWIP 967

Query: 143 WGLARISQRERLKL 156
           W +A IS  E+L L
Sbjct: 968 WDIAGISDEEKLHL 981

>Kwal_33.15618 s33 (1189375..1190763) [1389 bp, 462 aa] {ON} YLR438W
           (CAR2) - ornithine aminotransferase [contig 290] FULL
          Length = 462

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 294 IEAAVKLGVHFA-VAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVD--- 349
           +E A+KLG  +  +  G  +++A     A + H  T+GA S S D      +GP VD   
Sbjct: 144 VETAIKLGRRWGYMKKGIPENEAIIIGAAGNFHGRTLGAISLSTDEDCRKGFGPFVDNIT 203

Query: 350 VFAPG 354
            + PG
Sbjct: 204 AYIPG 208

>TDEL0G04010 Chr7 complement(728724..730991) [2268 bp, 755 aa] {ON}
           Anc_6.71 YLR274W
          Length = 755

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 5/75 (6%)

Query: 46  IHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSWLLNTDPQYTILHSFQLAHDLQGYTS 105
           ++   S  P+  + LF+S  T + +   + T  S     D + T+  +FQL        S
Sbjct: 75  VYKRLSDEPSDVVPLFESAITQVAKRIAVLTKTSRDAGVDEELTVFPTFQLV-----LNS 129

Query: 106 RLPEQLIRSLATDPI 120
           R  E L+R L +D +
Sbjct: 130 RANETLLRQLDSDHV 144

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 83/206 (40%), Gaps = 29/206 (14%)

Query: 208 DENGHGTHCAGVIGS-----HEYGVAKNTTLIAVKVLDAR--GDGEMSAVIRGIEYVTQQ 260
           D++ HGT CAG I +        GVA N  L  +++L      + E +++I G++     
Sbjct: 202 DDDYHGTRCAGEIAAVPNDFCAVGVAFNAKLSGIRILSGEITAEQEAASLIYGLDINDIY 261

Query: 261 HEQDMKKQDQTGFKG--SVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNE---DDDA 315
                   D    +G   ++  +L  G       V E   K G  +  A+GN     D+ 
Sbjct: 262 SCSWGPADDGRHLQGPTDLVRKALVKG-------VQEGRDKKGALYVFASGNGGAFGDNC 314

Query: 316 CSTSPADSPHALTVGASSFSDDRVFFSNWGPC----VDVFAPGIN--IMSTYIGPHNNET 369
                 +S +++TVGA         +S    C    V  ++ G    I +T I    +ET
Sbjct: 315 NYDGYTNSIYSITVGALDHKGLHPSYSE--SCSALMVTTYSSGSGEFIHTTDIKGQCSET 372

Query: 370 TSLSGTSMSAPFVTGLIAYFLSLQPD 395
               GTS +AP   G+ A  L   P+
Sbjct: 373 H--GGTSAAAPLAAGIYALILEANPN 396

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,744,133
Number of extensions: 2302443
Number of successful extensions: 5759
Number of sequences better than 10.0: 83
Number of HSP's gapped: 5610
Number of HSP's successfully gapped: 83
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)