Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D026206.13ON49349326280.0
NDAI0I024706.13ON47547521570.0
KNAG0E027506.13ON49847121400.0
CAGL0A01045g6.13ON48346621350.0
SAKL0E00946g6.13ON49349320920.0
KLTH0C11462g6.13ON49247520870.0
TDEL0G045806.13ON48446320670.0
Ecym_30166.13ON48948120670.0
Kwal_56.223626.13ON49348020590.0
KAFR0B065206.13ON49546920540.0
KLLA0D00902g6.13ON49249020490.0
YPL262W (FUM1)6.13ON48846120160.0
Skud_16.166.13ON48846120150.0
Smik_6.4706.13ON48846120120.0
TPHA0J002706.13ON49648320110.0
Suva_16.436.13ON48846120030.0
Kpol_1032.46.13ON46746019910.0
ZYRO0C07964g6.13ON50550519750.0
ACR013C6.13ON48848919670.0
Kpol_1045.766.13ON48548319380.0
TBLA0G010006.13ON46546119060.0
TBLA0A071306.13ON50046518480.0
Suva_15.2011.354ON4632451091e-04
Skud_8.701.354ON4632401081e-04
AEL019W1.354ON4692161072e-04
Smik_8.831.354ON4632401062e-04
KLLA0A08404g1.354ON4612371063e-04
SAKL0D09746g1.354ON4642231027e-04
Ecym_24524.197ON4821891010.001
YHR018C (ARG4)1.354ON4632401010.001
NCAS0A090101.354ON4622401000.001
KAFR0A009501.354ON4642471000.001
Kwal_47.180664.197ON482200990.002
NDAI0J019504.197ON482191990.002
Suva_10.4594.197ON482207980.002
Ecym_27491.354ON470235970.003
NCAS0J012004.197ON482191970.003
KLLA0B13189g4.197ON482192970.003
YLR359W (ADE13)4.197ON482187970.003
NDAI0G059401.354ON462247970.003
CAGL0I08987g1.354ON461280960.003
Smik_12.4464.197ON482187960.004
TDEL0D022201.354ON465247960.004
SAKL0B04972g4.197ON482191950.005
Kpol_1042.164.197ON482191940.006
KNAG0B058404.197ON482191940.006
Skud_12.4434.197ON482199930.009
TPHA0B010404.197ON482190910.013
CAGL0B02794g4.197ON482186910.014
TBLA0F034801.354ON466215900.022
ZYRO0B07964g4.197ON482193890.030
TPHA0A021901.354ON463243880.033
KNAG0I015601.354ON462222880.037
TDEL0E017604.197ON482200880.040
KLTH0A03344g4.197ON482191870.042
TBLA0A083204.197ON482191870.044
ZYRO0G00748g1.354ON462237850.081
KAFR0A062304.197ON482191840.11
ABL006C4.197ON482202800.31
Kpol_1018.1251.354ON460251780.55
KAFR0K015903.438ON110351742.1
YCR032W (BPH1)1.144ON2167174742.3
Kpol_513.235.20ON708255732.6
KLTH0G19338g1.354ON465269722.8
TDEL0D041703.205ON807119696.6
CAGL0A03344g2.419ON625101697.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02620
         (493 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...  1016   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   835   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   828   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   827   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   810   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   808   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   800   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   800   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   797   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   795   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   793   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   781   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   780   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   779   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   779   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   776   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   771   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   765   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   762   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   751   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   738   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   716   0.0  
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    47   1e-04
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    46   1e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    46   2e-04
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    45   2e-04
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    45   3e-04
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    44   7e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    44   0.001
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    44   0.001
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    43   0.001
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    43   0.001
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    43   0.002
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    43   0.002
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    42   0.002
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    42   0.003
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    42   0.003
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    42   0.003
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    42   0.003
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    42   0.003
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    42   0.003
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    42   0.004
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    42   0.004
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    41   0.005
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    41   0.006
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    41   0.006
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    40   0.009
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    40   0.013
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    40   0.014
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    39   0.022
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    39   0.030
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    39   0.033
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    39   0.037
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    39   0.040
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    38   0.042
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    38   0.044
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    37   0.081
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    37   0.11 
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    35   0.31 
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    35   0.55 
KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON} Anc_3...    33   2.1  
YCR032W Chr3 (179520..186023) [6504 bp, 2167 aa] {ON}  BPH1PProt...    33   2.3  
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...    33   2.6  
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    32   2.8  
TDEL0D04170 Chr4 complement(765368..767791) [2424 bp, 807 aa] {O...    31   6.6  
CAGL0A03344g Chr1 (340501..342378) [1878 bp, 625 aa] {ON} some s...    31   7.0  

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/493 (100%), Positives = 493/493 (100%)

Query: 1   MLKLKLANPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQN 60
           MLKLKLANPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQN
Sbjct: 1   MLKLKLANPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQN 60

Query: 61  FKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFP 120
           FKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFP
Sbjct: 61  FKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFP 120

Query: 121 LVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIA 180
           LVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIA 180

Query: 181 AVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENG 240
           AVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENG
Sbjct: 181 AVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENG 240

Query: 241 IYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAH 300
           IYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAH
Sbjct: 241 IYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAH 300

Query: 301 DAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNE 360
           DAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDL 420
           AMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDL
Sbjct: 361 AMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDL 420

Query: 421 KANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFD 480
           KANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFD
Sbjct: 421 KANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFD 480

Query: 481 EWVVPENMIGPKP 493
           EWVVPENMIGPKP
Sbjct: 481 EWVVPENMIGPKP 493

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/475 (84%), Positives = 444/475 (93%)

Query: 19  MSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAF 78
           MS ++ T +++  +R+ETDSFGEIKVP++KYWGAQTQRSFQNFKIGG RE+IP PII AF
Sbjct: 1   MSTNSKTPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAF 60

Query: 79  GILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNE 138
           GILKKSAAIVN+SLGTLDP +A PI KA+DEV+QGKL DHFPLVVFQTGSGTQTNMN NE
Sbjct: 61  GILKKSAAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANE 120

Query: 139 VISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKD 198
           VISNRA EL+G +LGSK+IHPNNH NQSQSSNDTFPSVMHIAAVLE+ N+LIP+LT+LK+
Sbjct: 121 VISNRANELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKN 180

Query: 199 ALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGG 258
           +LD KAKE+A+IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RI++SLYHLKFLAQGG
Sbjct: 181 SLDNKAKEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGG 240

Query: 259 TAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLF 318
           TAVGTGLNTK+GFDK+IA+EVSKETGI+F+TAPNKFEALAAHDAIVFAS A+ TVAGSLF
Sbjct: 241 TAVGTGLNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLF 300

Query: 319 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISI 378
           KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQV +QIMGNNQTI +
Sbjct: 301 KIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVM 360

Query: 379 AGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLV 438
           AGSQGQFELNVYKPLMIANLLNSIRLM+DAC SF+IHC+D LKAN DKINENL+KSLMLV
Sbjct: 361 AGSQGQFELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLV 420

Query: 439 TALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493
           TALNPKIGYDAASK+AKNAH KNITLKESALEL  LT EEFD+WV+PENMIGPKP
Sbjct: 421 TALNPKIGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPKP 475

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/471 (82%), Positives = 430/471 (91%)

Query: 23  TTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILK 82
           + +A + Q++R+ETDSFGEI VPAD+YWGAQTQRSFQNFKIGG RE+IP+P++ AFGILK
Sbjct: 28  SASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILK 87

Query: 83  KSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISN 142
           KSAA VNE+LGTLD  +A  IK AADEV +GKL DHFPLVVFQTGSGTQ+NMN NEVISN
Sbjct: 88  KSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISN 147

Query: 143 RAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDV 202
           RAIEL+GG+LGSKQ+HPNNH NQSQSSNDTFP+VMHIAA  EI N LIPEL  LKDAL  
Sbjct: 148 RAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQH 207

Query: 203 KAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVG 262
           K +EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R++SSLYHL FLAQGGTAVG
Sbjct: 208 KVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVG 267

Query: 263 TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQ 322
           TGLNTK+GFDKL+AEEVSKETG+ F+TAPNKFEALAAHDAIV ASGALNT+A SLFKIAQ
Sbjct: 268 TGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQ 327

Query: 323 DIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQ 382
           DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN TI+ AGSQ
Sbjct: 328 DIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQ 387

Query: 383 GQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALN 442
           GQFELNVYKPLMI+NLL+SIRL+TDA KSFRIHC++DLKANKDKI+ENLNKSLMLVTALN
Sbjct: 388 GQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALN 447

Query: 443 PKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493
           PKIGYDAA+K+AKNAH KNITLKESALEL  LT +EFDEWV+PENMI PKP
Sbjct: 448 PKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPKP 498

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/466 (82%), Positives = 433/466 (92%)

Query: 26  AASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSA 85
           +A    YR+ETD+FGEIKVPADKYWGAQTQRSFQNFKIGG+RER+P+PI+ AFG+LKKSA
Sbjct: 16  SARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSA 75

Query: 86  AIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAI 145
           AIVNE LGTLD ++A PI++AADEV +GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAI
Sbjct: 76  AIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 135

Query: 146 ELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAK 205
           EL+GG+LGSK+IHPNNHCNQ+QSSNDTFPSVMHIAAV EITNSL+PE+T+LKDAL  KA+
Sbjct: 136 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAE 195

Query: 206 EFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGL 265
           EF DIVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE++L HLK+LAQGGTAVGTGL
Sbjct: 196 EFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGL 255

Query: 266 NTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIR 325
           NTK GFDKLIAE++SKETGI+FKTAPNKFEALAAHDAIV ASGALNTVA SLFKIAQDIR
Sbjct: 256 NTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 315

Query: 326 YLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQF 385
           YLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  ++ AG+ GQF
Sbjct: 316 YLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQF 375

Query: 386 ELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKI 445
           ELNV+KP+MI+NLL+SIRL+ DAC SFR+HC++ ++AN++KIN NL+ SLMLVTALNPKI
Sbjct: 376 ELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKI 435

Query: 446 GYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491
           GYDAASKIAKNA  KNITLKESALELKYLT+EEFDEWV+PENM+GP
Sbjct: 436 GYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/493 (76%), Positives = 443/493 (89%), Gaps = 2/493 (0%)

Query: 1   MLKLKLA-NPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQ 59
           ML++  A N  +L   + RM LST+++ +QQ+YRIETD+FGEIKVPADKYWGAQTQRSF+
Sbjct: 1   MLRITAAANRNLLPSSSIRM-LSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59

Query: 60  NFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHF 119
           NFKIGG+RER+P+ ++ AFG+LKKSAAIVNESLGTLDP+++ PI+KAADEV+QGKL DHF
Sbjct: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119

Query: 120 PLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHI 179
           PLVVFQTGSGTQ+NMN NEVISNRAIE++GG+ GSKQ+HPNNHCNQ+QSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179

Query: 180 AAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLEN 239
           AAV EIT+SL+PELT L+D+   K+ EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL N
Sbjct: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239

Query: 240 GIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAA 299
           GI R+E SL+HLKFLAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAA
Sbjct: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299

Query: 300 HDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQN 359
           HDA+V  SGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDD 419
           EAMTQVCVQ+MGNN  I+ AG+ GQFELNV+KP+MI+NLL+S+RL+ DA  SFR+HC+D 
Sbjct: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419

Query: 420 LKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEF 479
           +KAN+D+I++ L++SLMLVTALNPKIGYDAASK+AKNAH K ITLKESAL+L  L  +EF
Sbjct: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479

Query: 480 DEWVVPENMIGPK 492
           DEWV+PE MIGPK
Sbjct: 480 DEWVIPEKMIGPK 492

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/475 (78%), Positives = 430/475 (90%)

Query: 18  RMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITA 77
           +  L +T++A  Q+ R+ETD+FGEI VPADKYWGAQTQRS +NFKIGG+RER+P+P++ A
Sbjct: 18  KTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRA 77

Query: 78  FGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVN 137
           FGILKKSAAIVNESLGTLDPK++ PI++AADEV+ GKL DHFPLVVFQTGSGTQ+NMN N
Sbjct: 78  FGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNAN 137

Query: 138 EVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLK 197
           EVISNRAIE+VGGK+G+K IHPNNHCNQ+QSSNDTFPSVMHIAAV EIT+SL+PELT L+
Sbjct: 138 EVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALR 197

Query: 198 DALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQG 257
           D+   K+KEF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL HLKFLAQG
Sbjct: 198 DSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQG 257

Query: 258 GTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSL 317
           GTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDAIV  SGALNT+A SL
Sbjct: 258 GTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSL 317

Query: 318 FKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTIS 377
           FKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  I+
Sbjct: 318 FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAIT 377

Query: 378 IAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLML 437
            AG+ GQFELNV+KP+MI+NLL+S+RL+ DAC SFR+HC+D ++AN+DKI + L++SLML
Sbjct: 378 FAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLML 437

Query: 438 VTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
           VTALNPKIGYDAASK+AKNAH K ITLKESALELK LT+ EFD+WVVPENM+GPK
Sbjct: 438 VTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/463 (79%), Positives = 423/463 (91%)

Query: 31  QYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNE 90
           Q+R+ETD+FGEIKV AD+YWGAQTQRS +NF+IGG RER+P+PI+ AFG+LKKSAA+VNE
Sbjct: 22  QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81

Query: 91  SLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGG 150
           SLGTLDPKVA+PIK+AADEV QGKL  HFPLVVFQTGSGTQ+NMN NEVISNRAIEL+GG
Sbjct: 82  SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141

Query: 151 KLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADI 210
           +LGSKQIHPNNHCNQ+QSSNDTFPSVMHIAAV EIT  L+PEL  L+D+LD K+KEF+DI
Sbjct: 142 ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201

Query: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIG 270
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E SL+ LK+LAQGGTAVGTGLNTKIG
Sbjct: 202 VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261

Query: 271 FDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSG 330
           F + IAE+VSKETG++FKTAPNKFEALAAHDA+V ASGALNTVA SLFKIAQDIRYLGSG
Sbjct: 262 FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321

Query: 331 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVY 390
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AG+ GQFELNV+
Sbjct: 322 PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381

Query: 391 KPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAA 450
           KP+MI+NLL+S+RL+ DA  SFR+HC+D + AN+D+I + +++SLMLVTALNPKIGYDAA
Sbjct: 382 KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441

Query: 451 SKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493
           SK+AKNAH K ITLK+SAL+L  LT  EFDEWVVPENMIGPKP
Sbjct: 442 SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPKP 484

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/481 (78%), Positives = 430/481 (89%), Gaps = 2/481 (0%)

Query: 13  RLQASRMS--LSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERI 70
           ++ A R++  + +TTA   Q++RIETD+FGEIKVPA+KYWGAQTQRS +NFKIGG RER+
Sbjct: 7   KIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERM 66

Query: 71  PDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGT 130
           P+PII AFGILKKSAAIVNESLGTLDPK++ PI++AADEV++GKL DHFPLVVFQTGSGT
Sbjct: 67  PEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGT 126

Query: 131 QTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLI 190
           Q+NMN NEVISNRAIEL+GG+LG+KQIHPNNHCNQ+QSSNDTFPSVMHIAAV EITN+L+
Sbjct: 127 QSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLL 186

Query: 191 PELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYH 250
           PELT L+D+   K +EF+ IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E SL+H
Sbjct: 187 PELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHH 246

Query: 251 LKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGAL 310
           LKFLAQGGTAVGTGLNTK+GF + IAE+VSKET IEFKTAPNKFEALAAHDA+V  SGAL
Sbjct: 247 LKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGAL 306

Query: 311 NTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIM 370
           NTVA SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ CVQ+M
Sbjct: 307 NTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVM 366

Query: 371 GNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINEN 430
           GNN TI+ AG+ GQFELNV+KP+MI+NLLNSIRL+ DA  SFR+HC+D +KAN+DKI + 
Sbjct: 367 GNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKI 426

Query: 431 LNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIG 490
           L++SLMLVTALNPKIGYD+A K+AKNAH KNITLKESALEL  L+ EEF EWVVPE MIG
Sbjct: 427 LHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIG 486

Query: 491 P 491
           P
Sbjct: 487 P 487

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/480 (77%), Positives = 429/480 (89%)

Query: 14  LQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDP 73
           +  S+  L +T+++  Q+YR+ETD+FGEIKVP DK WGAQTQRS +NFKIGG RER+P+P
Sbjct: 14  ISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEP 73

Query: 74  IITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTN 133
           I+ AFGILKKSAAIVNESLGTLDPKV+ PI+ AADEV+ GKL DHFPLVVFQTGSGTQ+N
Sbjct: 74  IVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSN 133

Query: 134 MNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPEL 193
           MN NEVISNRAI+LVGG++GSK IHPNNHCNQ+QSSNDTFPSVMHIAAV E+T+ L+PEL
Sbjct: 134 MNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPEL 193

Query: 194 TKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKF 253
             L+DA   KA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL++LKF
Sbjct: 194 IALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKF 253

Query: 254 LAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTV 313
           LAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA+V  SGALNT+
Sbjct: 254 LAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTL 313

Query: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNN 373
           A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN
Sbjct: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373

Query: 374 QTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNK 433
             I+ AG+ GQFELNV+KP+MI+NLL+SIRL+ DAC SFR+HC++ ++AN+DKI + L++
Sbjct: 374 AAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHE 433

Query: 434 SLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPKP 493
           SLMLVTALNPKIGYDAASK+AKNAH K ITLKESALEL  L++ EFDEWVVPENM+GPKP
Sbjct: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGPKP 493

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/469 (81%), Positives = 417/469 (88%)

Query: 24  TTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKK 83
           T ++ +  +R ETDSFGEI VP DKYWGAQTQRS QNFKIGG RE+IP PII AFGILKK
Sbjct: 26  TMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKK 85

Query: 84  SAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNR 143
           SAAIVNE LGTLD ++A  I  AADEV QGKL DHFPLVVFQTGSGTQ+NMN NEVISNR
Sbjct: 86  SAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNR 145

Query: 144 AIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVK 203
           AIEL+GGKLGSK +HPNNH NQSQSSNDTFP+VMHIAA+LEIT  L+PEL  LK++LD K
Sbjct: 146 AIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKK 205

Query: 204 AKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGT 263
           + EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RIE++LYHLKFLAQGGTAVGT
Sbjct: 206 SNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGT 265

Query: 264 GLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQD 323
           GLNTK GFDKLIAE++S+ETGI F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQD
Sbjct: 266 GLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQD 325

Query: 324 IRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQG 383
           IRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVC+Q+MGN+ TI+ AGSQG
Sbjct: 326 IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQG 385

Query: 384 QFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNP 443
           QFELNVYKPL+I+NLL+SIRL+TDA  SFR+HCID LKAN++ I ENLNKSLMLVTALNP
Sbjct: 386 QFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNP 445

Query: 444 KIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
            IGYD ASKIAKNAH KNITLKESALEL  LT E+F EWV+PE MIGPK
Sbjct: 446 YIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/490 (76%), Positives = 433/490 (88%), Gaps = 3/490 (0%)

Query: 6   LANPTILR-LQASRMSLSTTTAASQQ--QYRIETDSFGEIKVPADKYWGAQTQRSFQNFK 62
           L N  + R L  +R+S      AS +   YR+ETD+FGEI+VP+DKYWGAQTQRS QNFK
Sbjct: 2   LRNSIVSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFK 61

Query: 63  IGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLV 122
           IGG RER+P+PI+ AFG+LKKSAA+VNE LGTLDP++A PIK+AADEV QGKL +HFPLV
Sbjct: 62  IGGPRERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLV 121

Query: 123 VFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAV 182
           VFQTGSGTQ+NMN NEVISNRAIEL+GG+LGSK+IHPNNHCNQ+QSSNDTFPSVMHIAAV
Sbjct: 122 VFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAV 181

Query: 183 LEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIY 242
            EIT+ L+PEL  LK AL  K+ EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI 
Sbjct: 182 TEITHHLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIA 241

Query: 243 RIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDA 302
           R++ SLYHLKFLAQGGTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDA
Sbjct: 242 RVKQSLYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDA 301

Query: 303 IVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAM 362
           +V ASGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAM
Sbjct: 302 VVEASGALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAM 361

Query: 363 TQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKA 422
           TQVCVQ+MGN+  I+ AG+ GQFELNV+KP+MI+NLL+SIRL+ DA  SFRIHC++ +KA
Sbjct: 362 TQVCVQVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKA 421

Query: 423 NKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEW 482
           N+D+I + L++SLMLVTALNPKIGYDAASK+AKNAH K ITLKESALELK L++EEFD+W
Sbjct: 422 NEDRIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQW 481

Query: 483 VVPENMIGPK 492
           V+PE MIGPK
Sbjct: 482 VIPEKMIGPK 491

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/461 (80%), Positives = 415/461 (90%)

Query: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91
           +R ETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAAIVNES
Sbjct: 28  FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151
           LG LDPK++  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 88  LGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211
           +GSKQ+HPNNHCNQSQSSNDTFP+VMHIAA L+I N LIPELT LK+AL+ K+KEF  IV
Sbjct: 148 IGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIV 207

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331
           D  IAE++SKETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AGSQGQFELNV+K
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451
           P+MIANLLNSIRL+TDA  SFR+HC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPE+M+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/461 (79%), Positives = 415/461 (90%)

Query: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91
           +RIETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAA+VNES
Sbjct: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151
           LG LDPK++  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211
           +GSK++HPNNHCNQSQSSNDTFP+VMHIAA L+I N LIPELT LK+AL+ K+KEF  IV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331
           D  IAE++S ETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AGSQGQFELNV+K
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451
           P+MIANLLNSIRL+TD+  SFR+HC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/461 (79%), Positives = 414/461 (89%)

Query: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91
           +R ETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAAIVNES
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151
           LG LDPK++  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 88  LGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211
           +GSK++HPNNHCNQSQSSNDTFP+VMHIAA L+I N LIPEL  LK+AL+ K+KEF  IV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIV 207

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  SL  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331
           D  IAE++SKETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+ AGSQGQFELNV+K
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451
           P+MIANLLNSIRL+TDA  SFR+HC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/483 (75%), Positives = 426/483 (88%)

Query: 10  TILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRER 69
           ++ ++Q + M  S    + +  +RIETD FGEIKVPA+KYWGAQT+RSF+NF+IGG RER
Sbjct: 14  SVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRER 73

Query: 70  IPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSG 129
           +PDP++ AFG+LKKSAAIVNE  GTLDP+++  I++AADEV+QGKL DHFPLVVFQTGSG
Sbjct: 74  MPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSG 133

Query: 130 TQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSL 189
           TQ+NMN NEVISNRAIEL+GG LGSKQ+HPNNH NQ+QSSND+FP+VMHIAAV EIT+ L
Sbjct: 134 TQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHL 193

Query: 190 IPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLY 249
           IPE+  L+DAL+ K+K+FA IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE SL 
Sbjct: 194 IPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLI 253

Query: 250 HLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGA 309
           +LKFLAQGGTAVGTGLNT+IGF + IAE++SKETG+ FKTAPNKFEALAAHDAIV ASGA
Sbjct: 254 NLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGA 313

Query: 310 LNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQI 369
           + TVA SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQVC QI
Sbjct: 314 ITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQI 373

Query: 370 MGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINE 429
           +GNNQTI  AG+QGQFELNV+KP+MI+NLL+SIRL+ D  KSFRIHC++ +KAN+++I +
Sbjct: 374 IGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIAD 433

Query: 430 NLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMI 489
            +NKSLMLVTALNPKIGYD A+K+AKNAH K ITLKESA++L  LT  EFDEWVVPE MI
Sbjct: 434 LMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMI 493

Query: 490 GPK 492
           GPK
Sbjct: 494 GPK 496

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/461 (79%), Positives = 412/461 (89%)

Query: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91
           +R ETD+FGEI VPADKYWGAQTQRSFQNFKIGG+RER+P P++ AFG+LKKSAAIVNES
Sbjct: 28  FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151
           LG LDPKV+  I++AADEV  GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAIE++GGK
Sbjct: 88  LGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211
           +GSKQ+HPNN CNQSQSSNDTFP+VMHIAA L+I   LIPELT LK+AL+ K+KEF  IV
Sbjct: 148 IGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIV 207

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+  +L  L FLAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331
           D  IAE++SKETG++F+TAPNKFEALAAHDAIV  SGALNT+A SLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQ+MGNN  I+  GSQGQFELNV+K
Sbjct: 328 RCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFK 387

Query: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451
           P+MIANLLNSIRL+ DA +SFRIHC++ +KAN+ +I+E L KSLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPENM+GPK
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/460 (79%), Positives = 415/460 (90%)

Query: 32  YRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNES 91
           +R+ETD FGEIKVPADKYWGAQTQRS++NFKIGG RER+P+P++ AFG+LKKSAAIVNE 
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 92  LGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGK 151
            G LD  ++  I++AADEV++GKL +HFPLVVFQTGSGTQ+NMN NEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 152 LGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIV 211
           +GSK+IHPNNHCN +QSSNDTFP+VMHIAAV EIT+ LIP++T+LKDAL  K+KEF  IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 212 KIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGF 271
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE SL +LKFLAQGGTAVGTGLNTKIGF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 272 DKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGP 331
            + IAE+VSKETGIEFKTAPNKFEALAAHDAIV +SGALNTVA SLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 332 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYK 391
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  I+ AG+ GQFELNV+K
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 392 PLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAAS 451
           P+MI+NLL+SIRL+ DAC SF IHC++ ++AN+DKIN+ L++SLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 452 KIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491
           K+AKNAH K ITLKESALEL  LT +EFDEWVVPE M+GP
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/505 (72%), Positives = 429/505 (84%), Gaps = 12/505 (2%)

Query: 1   MLKLK---LANPTILRLQASRMSLST---------TTAASQQQYRIETDSFGEIKVPADK 48
           ML+L    L N  + ++ + R++  T         TT    Q++R+ETD+FGEIKVPADK
Sbjct: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60

Query: 49  YWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAAD 108
           YWGAQTQRSF+NF+IGG RER+P+ ++ AFGILKK+ A VNE+ G LDPK+A  IK+AAD
Sbjct: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120

Query: 109 EVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQS 168
           EV  GKLKDHFPLVVFQTGSGTQ+NMN NEVISNRAIEL+GGKLGSK +HPNNH N SQS
Sbjct: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180

Query: 169 SNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQ 228
           SNDTFP+VMHIAAVL IT  L+P LT LKD+L  K++EFADIVKIGRTHLQDATPLTLGQ
Sbjct: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240

Query: 229 EFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFK 288
           EFSGYVQQ+ NGI R+ES+L  LK LAQGGTAVGTGLNTKIG+ + +A EV+KETGI+F+
Sbjct: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300

Query: 289 TAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSS 348
           TAPNKFEALAAHDA+V ASGALNT+A SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSS
Sbjct: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360

Query: 349 IMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDA 408
           IMPGKVNPTQNEA+TQVCVQ+ GN+  I+ AG+ GQFELNV+KP+MI+NLL+SI L++DA
Sbjct: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDA 420

Query: 409 CKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESA 468
             SFR+HC+D ++AN++ I + L++SLMLVTALNPKIGYDAASK+AKNAH   ITLKESA
Sbjct: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480

Query: 469 LELKYLTAEEFDEWVVPENMIGPKP 493
           L+L  LTAEEFD WVVPE+MIGPKP
Sbjct: 481 LQLNILTAEEFDHWVVPEHMIGPKP 505

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/489 (72%), Positives = 420/489 (85%), Gaps = 3/489 (0%)

Query: 4   LKLANPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKI 63
           L+L+   +    A R+    +TA + QQ+R+ETD+FGEI+VPADKYWGAQTQRS +NF+I
Sbjct: 2   LRLSRGCVGSSAARRL---MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRI 58

Query: 64  GGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVV 123
           GG+RER+P+P++ AFG+LKKSAA+VNE LGTL+P +A  I++AADEV QG+L +HFPLVV
Sbjct: 59  GGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVV 118

Query: 124 FQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVL 183
           FQTGSGTQ+NMN NEVISNRAIEL+GG+LGSKQ+HPNNHCNQ+QSSNDTFPSVMHIAAV 
Sbjct: 119 FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVT 178

Query: 184 EITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYR 243
           EIT SL+PEL  L+ +   K  EFA IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R
Sbjct: 179 EITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIAR 238

Query: 244 IESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAI 303
           +E +   L+FLAQGGTAVGTGLNT+ GF + IA +VS+ETG+EF+TAPNKFEALAAHDA+
Sbjct: 239 VEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAV 298

Query: 304 VFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMT 363
           V ASGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+T
Sbjct: 299 VEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALT 358

Query: 364 QVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKAN 423
           Q CVQ+MGNN  I+ AG+ GQFELNV+KP+MIANLL+S+RL+ DA +SFR+HC+D ++ N
Sbjct: 359 QACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDN 418

Query: 424 KDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWV 483
           +D+I + L++SLMLVTALNPKIGYDAAS +AKNAH K ITL+ SALEL  LT  EFDEWV
Sbjct: 419 EDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWV 478

Query: 484 VPENMIGPK 492
           VPE MIGP+
Sbjct: 479 VPEKMIGPR 487

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/483 (73%), Positives = 414/483 (85%), Gaps = 7/483 (1%)

Query: 9   PTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRE 68
           P  +R+Q   +S       + + +R+ETD FGEIKVPA+KYWGAQT+RSF+NFKIGGSRE
Sbjct: 8   PNTVRVQTRYIS-------NLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 69  RIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGS 128
           R+P+ ++ AFG+LKK AAIVN  LG LDP  +  I++AADEV  GKL DHFPLVVFQTGS
Sbjct: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 129 GTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNS 188
           GTQ+NMN NEVISNRAIEL GG LGSK+IHPNNHCN +QSSNDTFP+VMHIAAV +I+  
Sbjct: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           L+PELT L+DAL  K+ EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE + 
Sbjct: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 249 YHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASG 308
            +L+FLAQGGTAVGTGLNTK G+ + IA E+SKETG+ FKTAPNKFEALAAHDAIV ASG
Sbjct: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 309 ALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 368
           ALNTVA SLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 369 IMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKIN 428
           +MGNN  ++ AG+ GQFELNV+KP++I+NLL+S++L+ DA +SFR+HC++ +KAN+ KI+
Sbjct: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 429 ENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENM 488
           E L++SLMLVTALNPKIGYDAA+K+AKNAH K ITLKESALEL  LT +EFDEWVVPE M
Sbjct: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 489 IGP 491
           +GP
Sbjct: 481 LGP 483

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/461 (74%), Positives = 406/461 (88%)

Query: 31  QYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAAIVNE 90
           + RIE D FGE++VPA+KYWGAQTQR+  NF IGG RER+P+P+I A+GILKKS AIVNE
Sbjct: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62

Query: 91  SLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGG 150
           SLGTLDPK++  I++AADEV +G L +HFPLVVFQTGSGTQTNMNVNEVISNRAIE++GG
Sbjct: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122

Query: 151 KLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADI 210
           +LGSK +HPNNH NQSQS+ND+FP+ MHI+AV E+   L+PEL KL+DAL  K+ EF  I
Sbjct: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182

Query: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIG 270
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ENGI R+++SL +LKF+AQGGTAVGTG+NTK  
Sbjct: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242

Query: 271 FDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSG 330
           FD L+A+++S ETGIEFKTAPNKFEALA+HDAIV  SGALNT+A SLFKI+QDIR+LGSG
Sbjct: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302

Query: 331 PRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFELNVY 390
           PRCGYGEL LPENEPGSSIMPGKVNPTQNEAM Q C+Q+MGNN  I+ AG+ GQFELN Y
Sbjct: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362

Query: 391 KPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIGYDAA 450
           KPLMI+NLLNSIRL+TD+C SFRIHCI  ++AN+DKIN+ LN+SLMLVTALNPKIGYDAA
Sbjct: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422

Query: 451 SKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491
           + IAK+AH   +TLKE+AL+ K LTAE+FDEW+VPE+M+ P
Sbjct: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/465 (73%), Positives = 393/465 (84%)

Query: 27  ASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAA 86
           A  Q  R ETDSFGEI+VPA+KYWGAQTQRSF NFKIGG RER+P+PII AFG  KK+AA
Sbjct: 35  ADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAA 94

Query: 87  IVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIE 146
           IVN SLGTLD  + D I +AA+EV QG L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE
Sbjct: 95  IVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 154

Query: 147 LVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKE 206
           L+GG LGSKQ+HPNNH NQSQSSNDTFP+VMHIAA+ EITN+L+P L  L++ LD KAKE
Sbjct: 155 LLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKE 214

Query: 207 FADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLN 266
           F  I+KIGRTHLQDATPLTLGQEFSGY QQL N I RIE +L  L+++AQGGTAVGTGLN
Sbjct: 215 FEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLN 274

Query: 267 TKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRY 326
           TKIGF +  A ++S +T + F T+PNKFE+LAAHDAIV    +LNT+A SLFKI+QDIRY
Sbjct: 275 TKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRY 334

Query: 327 LGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFE 386
           L SGPRCGYGEL +PENEPGSSIMPGKVNPTQNEAM Q CVQ+MGNN TIS AG+ GQFE
Sbjct: 335 LASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFE 394

Query: 387 LNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIG 446
           LN YKPLMIANLL+S RL++DA  SF +HC   ++ANKDKI+  L++SLMLVT+LNPKIG
Sbjct: 395 LNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIG 454

Query: 447 YDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491
           YDAASK+AKNAH K ITLK+SALEL  L++++FDEWV PENM+GP
Sbjct: 455 YDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 95/245 (38%), Gaps = 30/245 (12%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  EL+G  +  K        +  +S ND   + + I     + +SL P + 
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L D L  +A+   DI+  G THLQ A P+      S Y         R+   L+ L   
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLN-- 197

Query: 255 AQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTA-PNKFEALAAHDAIVFASGALNTV 313
            Q     G       G D+    E     G+ F +   N   A++  D IV         
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVEL-----MF 246

Query: 314 AGSLF-----KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCV 367
            G+LF     + A+D+    +     +G +QL +    GSS+MP K N    E +     
Sbjct: 247 WGTLFMNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSG 303

Query: 368 QIMGN 372
           ++ G+
Sbjct: 304 RVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 93/240 (38%), Gaps = 20/240 (8%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  E++G  +  K        +  +S ND   + + I     + ++L P L 
Sbjct: 87  DIHTANERRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALK 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L D L  +AK   +I+  G THLQ A P+      S Y         R++  L+ L   
Sbjct: 140 GLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLN-- 197

Query: 255 AQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTA-PNKFEALAAHDAIVFASGALNTV 313
            Q     G       G D+    E     G+ F +   N   A++  D IV         
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSMVAVSDRDFIVELMFWGTLF 251

Query: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
              + + A+D+    +     +G +QL +    GSS+MP K N    E +     ++ G+
Sbjct: 252 MNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 87/216 (40%), Gaps = 11/216 (5%)

Query: 158 HPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTH 217
           H +   +  +S ND   + M +     + + + P L +L   L  +A+E  D++  G TH
Sbjct: 103 HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLLHRAREEIDVLMPGYTH 162

Query: 218 LQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAE 277
           LQ A P+      S Y         R++  +  L    Q     G       G D+   E
Sbjct: 163 LQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN---QSPLGAGALAGHPYGIDR---E 216

Query: 278 EVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGE 337
            ++ E G +     N   A++  D +V      +     + ++A+D+    +     +G 
Sbjct: 217 YLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRLAEDLIIYSTAE---FGF 272

Query: 338 LQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
           ++L +    GSS+MP K NP   E +     ++ G 
Sbjct: 273 VKLADAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQ 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 91/240 (37%), Gaps = 20/240 (8%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  EL+G  +  K        +  +S ND   + + I     +  +L P L 
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALK 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L D L  +A+   DI+  G THLQ A P+      S Y         R+   L+ L   
Sbjct: 140 GLVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN-- 197

Query: 255 AQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTA-PNKFEALAAHDAIVFASGALNTV 313
            Q     G       G D+    E     G+ F +   N   A++  D IV         
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
              + + A+D+    +     +G +QL +    GSS+MP K N    E +     ++ G+
Sbjct: 252 MNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 92/237 (38%), Gaps = 30/237 (12%)

Query: 142 NRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALD 201
            R  E++G  +  K        +  +S ND   + M I     +  +++P L+ L   + 
Sbjct: 93  RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVIL 145

Query: 202 VKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAV 261
            +A+E  D++  G THLQ A P+      S Y         R++  +  L     G  A+
Sbjct: 146 QRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGAL 205

Query: 262 GTGLNTKIGFDKLIAEEVSKETGIEFK-TAPNKFEALAAHDAIVFASGALNTVAGSLF-- 318
                   G D+          G+ F     N   A+A  D +V          GSLF  
Sbjct: 206 A---GHPYGIDREFLA-----AGLNFNGVIGNSLTAVADRDFVVEI-----MFWGSLFMN 252

Query: 319 ---KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMG 371
              + A+D+    +     +G +QL +    GSS+MP K NP   E +     ++ G
Sbjct: 253 HISRFAEDLIIYSTAE---FGFIQLSDAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 89/223 (39%), Gaps = 13/223 (5%)

Query: 150 GKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFAD 209
           G++  ++I    H  +S+  ND   + M I     +   L+P L      L  +AKE  D
Sbjct: 98  GEIIGREISGKVHTGRSR--NDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEID 155

Query: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKI 269
           ++  G THLQ A P+      S Y         R++  +  L     G  A+        
Sbjct: 156 VLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA---GHPY 212

Query: 270 GFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGS 329
           G D+   E +++  G +     N   A++  D +V            + + ++D+    +
Sbjct: 213 GIDR---EFLARGLGFQ-GVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDLIIYST 268

Query: 330 GPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMG 371
                +G ++L +    GSS+MP K NP   E +     ++ G
Sbjct: 269 AE---FGFIKLSDAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 84/189 (44%), Gaps = 25/189 (13%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + + L   A ++ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKETGIEFKTAPNKFEALAA 299
             + F    GT        A+  G + K+   DK +AE    +  I +      +     
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSGFD--IIYPVTGQTYSRKVD 245

Query: 300 HDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPT 357
            D +    G L++ A +  K+A DIR L +       EL+ P   ++ GSS M  K NP 
Sbjct: 246 IDVL----GPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRNPM 296

Query: 358 QNEAMTQVC 366
           + E   +VC
Sbjct: 297 RCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 92/240 (38%), Gaps = 20/240 (8%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  EL+G  +  K        +  +S ND   + + I     + ++L P L 
Sbjct: 87  DIHTANERRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L + L  +A+   D++  G THLQ A P+      S Y         R+   L+ L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN-- 197

Query: 255 AQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTA-PNKFEALAAHDAIVFASGALNTV 313
            Q     G       G D+    E     G+ F +   N   A++  D IV         
Sbjct: 198 -QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
              + + A+D+    +     +G +QL +    GSS+MP K N    E +     ++ G+
Sbjct: 252 MNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 91/240 (37%), Gaps = 20/240 (8%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  E++G  +  K        +  +S ND   + + I     +   L P LT
Sbjct: 87  DIHTANERRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALT 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L   L  + +E  DI+  G THLQ A P+      S Y       + R++  L      
Sbjct: 140 SLIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKS 199

Query: 255 AQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFK-TAPNKFEALAAHDAIVFASGALNTV 313
             G  A+        G D+    E     G+EF     N   A++  D +V         
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE-----GLEFNGVIGNSLVAVSDRDFVVELMFWSTLF 251

Query: 314 AGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
              + + A+D+    +     +G ++L +    GSS+MP K N    E +     ++ G+
Sbjct: 252 MNHISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 100/247 (40%), Gaps = 28/247 (11%)

Query: 132 TNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIP 191
           ++ +++     R  E++G  +  K        +  +S ND   + M I     +TN+L+ 
Sbjct: 85  SDEDIHTANERRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLT 137

Query: 192 ELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHL 251
            L +L   +  +A E  DI+  G THLQ A P+      S Y         R++  L  L
Sbjct: 138 YLKELISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARL 197

Query: 252 KFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALN 311
                G  A+        G D+   E ++++ G       N   A++  D +V       
Sbjct: 198 NVSPLGAGALA---GHPYGIDR---EFLAQDLGFS-GVIGNSLVAVSDRDFVVEI----- 245

Query: 312 TVAGSLF-----KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQV 365
              GSLF     + ++D+    +     +G ++L +    GSS+MP K N    E +   
Sbjct: 246 MFWGSLFMNHISRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGK 302

Query: 366 CVQIMGN 372
             ++ G+
Sbjct: 303 SGRVFGD 309

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 84/200 (42%), Gaps = 47/200 (23%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + D L   A E+ D+  +G TH Q A   TLG+  + ++Q+L          L
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQEL----------L 177

Query: 249 YHLKFLAQGGTAVG-------TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHD 301
           + L+   +    +G       TG  T+  F  L   +  K   ++      +   L   D
Sbjct: 178 WDLRNFVRARNDIGLRGVKGTTG--TQGSFLALFHSDHDKVEALD-----KRVTELLGFD 230

Query: 302 AIVFASGA-------------LNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPG 346
            +   +G              L++ A +  K+A DIR L +       E++ P  +++ G
Sbjct: 231 TVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIG 285

Query: 347 SSIMPGKVNPTQNEAMTQVC 366
           SS M  K NP + E   +VC
Sbjct: 286 SSAMAYKRNPMRCE---RVC 302

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + D L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L++ A +  K+A DIR L +       EL+ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 97/207 (46%), Gaps = 25/207 (12%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGTAVGTGLNTKIGF----DKLIA--EEVSKETGIEFKTAPNKFEALAAH-D 301
             +      GT  GT  +    F    DK+ A  E V++  G + K  P   +  +   D
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTYSRKID 245

Query: 302 AIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQN 359
             V A   L++ A +  K+A DIR L +       E++ P  +++ GSS M  K NP + 
Sbjct: 246 IDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC--VQIMGN--NQTISIAGSQ 382
           E   +VC   + +G+  N T+  A  Q
Sbjct: 299 E---RVCSLARHLGSLFNDTVQTASVQ 322

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 87/235 (37%), Gaps = 28/235 (11%)

Query: 143 RAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDV 202
           R  EL+G  +  K        +  +S ND   + M I     +   ++P ++     L  
Sbjct: 95  RLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLIN 147

Query: 203 KAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVG 262
           +A+E  D++  G THLQ A P+      S Y         R+   +  L    Q     G
Sbjct: 148 RAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAG 204

Query: 263 TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLF---- 318
                  G D+    E     GI      N   A++  D ++          GSLF    
Sbjct: 205 ALAGHPYGIDRKYLAEQLGFNGI----IGNSLVAVSDRDFVIEI-----MFWGSLFMNHI 255

Query: 319 -KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMG 371
            + A+D+    +     +G + L +    GSS+MP K NP   E +     ++ G
Sbjct: 256 SRFAEDLIIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + D L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L + A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LASFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGTAVGT---------GLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEA 296
             +      GT  GT         G + K+   DK +AE +   T   +  +T   K   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKI-- 244

Query: 297 LAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKV 354
               D  V A   L++ A +  K+A DIR L +       EL+ P  +++ GSS M  K 
Sbjct: 245 ----DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 88/187 (47%), Gaps = 21/187 (11%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGTAVGTGLNTKIGF----DKLIA--EEVSKETGIEFKTAPNKFEALAAH-D 301
             +      GT  GT  +    F    DK+ A  E V++  G + K  P   +  +   D
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTYSRKID 245

Query: 302 AIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQN 359
             V A   L++ A +  K+A DIR L +       E++ P  +++ GSS M  K NP + 
Sbjct: 246 IDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC 366
           E   +VC
Sbjct: 299 E---RVC 302

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 95/247 (38%), Gaps = 34/247 (13%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  E++G  +  K        +  +S ND   + + I     +   L P +T
Sbjct: 87  DIHTANERRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L + L  +A+E  DI+  G THLQ A P+      S Y       + R++  L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 255 AQGGTAVG---TGLNTK-----IGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFA 306
             G  A+     G++ +     +GFD +I                N   A++  D +V  
Sbjct: 200 PLGAGALAGHPYGIDREFLAEGLGFDGVIG---------------NSLVAVSDRDFVVEL 244

Query: 307 SGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQV 365
                     + + A+D+    +     +G ++L +    GSS+MP K N    E +   
Sbjct: 245 MFWGTLFMNHISRFAEDLVIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGK 301

Query: 366 CVQIMGN 372
             ++ G+
Sbjct: 302 SGRVFGD 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 109/280 (38%), Gaps = 40/280 (14%)

Query: 98  KVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQI 157
           K+   +K   +E  +GK   H            +++ +++     R  EL+G  +  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 158 HPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTH 217
                 +  +S ND   + M I     +   + P +  L + L  +A++  DI+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 218 LQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAE 277
           LQ A P+      S Y       + R+E     L     G  A+        G D+    
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALA---GHPYGIDRQFLA 220

Query: 278 EVSKETGIEFK-TAPNKFEALAAHDAIV----FASGALNTVAGSLFKIAQDIRYLGSGPR 332
           E     G+ F     N   A++  D +V    +A+  +N V+    + ++D+    +   
Sbjct: 221 E-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVS----RFSEDLIIYSTAE- 270

Query: 333 CGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMG 371
             +G ++L +    GSS+MP K N    E +     ++ G
Sbjct: 271 --FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 87/187 (46%), Gaps = 21/187 (11%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGTAVGTGLNTKIGF----DKLIA--EEVSKETGIEFKTAPNKFEALAAH-D 301
             +      GT  GT  +    F    DK+ A  E V++  G + K  P   +  +   D
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTYSRKID 245

Query: 302 AIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQN 359
             V A   L++ A +  K+A DIR L +       E++ P  + + GSS M  K NP + 
Sbjct: 246 IDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKTQIGSSAMAYKRNPMRC 298

Query: 360 EAMTQVC 366
           E   +VC
Sbjct: 299 E---RVC 302

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 94/247 (38%), Gaps = 34/247 (13%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  E++G  +  K        +  +S ND   + + I     + + L P+L 
Sbjct: 87  DIHTANERRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQ 139

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L D +  + KE  D++  G THLQ A P+      S Y         R+   +  +   
Sbjct: 140 ALVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQS 199

Query: 255 AQGGTAVG---TGLNTK-----IGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFA 306
             G  A+     G++ +     +GFD +I                N   A++  D IV  
Sbjct: 200 PLGAGALAGHPYGIDREFLAAGLGFDGVIG---------------NSLVAVSDRDFIVEL 244

Query: 307 SGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQV 365
                     + + A+D+    +     +G ++L +    GSS+MP K N    E +   
Sbjct: 245 MFWGTLFMNHISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGK 301

Query: 366 CVQIMGN 372
             ++ G+
Sbjct: 302 SGRVFGD 308

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLA--PLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + D L   A E+ D+  +G TH Q A   T+G+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 86/191 (45%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + D L   A ++ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L++ A S  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LSSFAASAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 84/199 (42%), Gaps = 45/199 (22%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGT-------------------AVGTGLNTKIGFDKLIAEEVSKETGIEFKT 289
             +      GT                   A+   +   +GFDK     V   TG   +T
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDARVTELLGFDK-----VYPVTG---QT 239

Query: 290 APNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGS 347
              K       D  V A   L++ A +  K+A DIR L +       E++ P  +++ GS
Sbjct: 240 YSRKI------DIDVLAP--LSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGS 286

Query: 348 SIMPGKVNPTQNEAMTQVC 366
           S M  K NP + E   +VC
Sbjct: 287 SAMAYKRNPMRCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 85/190 (44%), Gaps = 27/190 (14%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + D L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   ++ + + +
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQEL---LWDLRNFV 184

Query: 249 YHLKFLAQGGTAVGTGLNTKIGF--------DKL--IAEEVSKETGIEFKTAPNKFEALA 298
                L   G    TG  T+  F        DK+  + E V++  G  F T         
Sbjct: 185 RARNDLGLRGVKGTTG--TQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTY 240

Query: 299 AHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNP 356
           +    +     L + A +  K+A DIR L +       E++ P  +++ GSS M  K NP
Sbjct: 241 SRKIDIDVLAPLASFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNP 295

Query: 357 TQNEAMTQVC 366
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 84/186 (45%), Gaps = 19/186 (10%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGTAVGTGLNTKIGF----DKL--IAEEVSKETGIEFKTAPNKFEALAAHDA 302
             +      GT  GT  +    F    DK+  + E V++  G  F T         +   
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 303 IVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVNPTQNE 360
            +     L++ A S  K+A DIR L +       E++ P  +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLSSFAASAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 81/215 (37%), Gaps = 11/215 (5%)

Query: 158 HPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTH 217
           H     +  +S ND   + + I     +   L+P +  L   +  +A+   DI+  G TH
Sbjct: 103 HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTH 162

Query: 218 LQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAE 277
           LQ A P+      S Y         R++  L  L     G  A+        G D+   +
Sbjct: 163 LQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA---GHPYGIDR---Q 216

Query: 278 EVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGE 337
            +S E G       N   A++  D IV            + + ++D+    +     +G 
Sbjct: 217 YLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDLIIYSTAE---FGF 272

Query: 338 LQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMG 371
           ++L +    GSS+MP K N    E +     ++ G
Sbjct: 273 IKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 84/193 (43%), Gaps = 29/193 (15%)

Query: 187 NSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIES 246
           + +IP+L  + D L   A  + D+  +G TH Q A   TLG+  + ++Q L   +   + 
Sbjct: 126 DVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDR 185

Query: 247 SLYHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFE 295
           +   +      GT        A+  G + K+   D+ + E +  ET   +  +T   K  
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKI- 244

Query: 296 ALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGK 353
                D  V A   L + A +  K+A DIR L +       E++ P  + + GSS M  K
Sbjct: 245 -----DIDVLAP--LASFAATAHKMATDIRLLAN-----LKEVEEPFEKTQIGSSAMAYK 292

Query: 354 VNPTQNEAMTQVC 366
            NP + E   +VC
Sbjct: 293 RNPMRCE---RVC 302

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 95/243 (39%), Gaps = 42/243 (17%)

Query: 143 RAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDV 202
           R  E++G K+  K        +  +S ND   + + I     +++ L+  L  L + L  
Sbjct: 95  RLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLIN 147

Query: 203 KAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVG 262
           +A+E  + +  G THLQ A P+      S Y         R+      L     G  A+ 
Sbjct: 148 RAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGALA 207

Query: 263 --------TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIV----FASGAL 310
                     L  K+GFD +I                N   A++  D +V    +++  +
Sbjct: 208 GHPYGIDREYLAEKLGFDSVIG---------------NSLVAVSDRDFVVEILFWSTLFM 252

Query: 311 NTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQI 369
           N ++    + A+D+    +     +G ++L +    GSS+MP K N    E +     ++
Sbjct: 253 NHIS----RFAEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRV 305

Query: 370 MGN 372
            GN
Sbjct: 306 FGN 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 84/222 (37%), Gaps = 23/222 (10%)

Query: 158 HPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTH 217
           H     +  +S ND   + M I     +   L+P +  L   L  +A+   D +  G TH
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMPGYTH 162

Query: 218 LQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAE 277
           LQ A P+      S Y         R++  L  L     G  A+        G D+    
Sbjct: 163 LQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA---GHPYGIDREFLA 219

Query: 278 EVSKETGIEF-KTAPNKFEALAAHDAIVFASGALNTVAGSLF-----KIAQDIRYLGSGP 331
           E     G+ F     N   A++  D +V          G+LF     + A+D+    +  
Sbjct: 220 E-----GLNFGGVIGNSLVAVSDRDFVVEL-----MFWGTLFMNHISRFAEDLIIYSTAE 269

Query: 332 RCGYGELQLPEN-EPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
              +G ++L ++   GSS+MP K N    E +     ++ G+
Sbjct: 270 ---FGFVKLSDSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 84/200 (42%), Gaps = 47/200 (23%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A ++ D+  +G TH Q A   TLG+  + ++Q+L          L
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQEL----------L 177

Query: 249 YHLKFLAQGGTAVG-------TGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHD 301
           + L+   +    +G       TG  T+  F  L   +  K   ++      +   L   D
Sbjct: 178 WDLRNFVRARNDIGLRGVKGTTG--TQASFLALFHGDHDKVEALD-----KRVTELLGFD 230

Query: 302 AIVFASGA-------------LNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPG 346
            +   +G              L++ A +  K+A DIR L +       E++ P  +++ G
Sbjct: 231 TVYPVTGQTYSRKIDIDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIG 285

Query: 347 SSIMPGKVNPTQNEAMTQVC 366
           SS M  K NP + E   +VC
Sbjct: 286 SSAMAYKRNPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + + L   A ++ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   DK + E +  +T   +  +T   K    
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKI--- 244

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
              D  V A   L + A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 245 ---DIDVLAP--LCSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   D+ + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKIDID 247

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
                + FA+ A         K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 248 VVSPLVSFAATA--------HKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 91/237 (38%), Gaps = 30/237 (12%)

Query: 143 RAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDV 202
           R  E++G  +  K        +  +S ND   + M I     +   L+P L +L   +  
Sbjct: 95  RLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVK 147

Query: 203 KAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVG 262
           +A++    +  G THLQ A P+      S Y       + R+   L       Q     G
Sbjct: 148 RAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN---QSPLGAG 204

Query: 263 TGLNTKIGFDK-LIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLF--- 318
                  G D+  +AEE+  +  I      N   A++  D +V          G+LF   
Sbjct: 205 ALAGHPYGIDREFLAEELGFQGVI-----GNSLVAVSDRDFVVEL-----MFWGTLFMNH 254

Query: 319 --KIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
             + A+D+    +     +G ++L +    GSS+MP K N    E +     ++ G+
Sbjct: 255 ISRFAEDLIIYSTAE---FGFIKLNDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           LIP+L  + + L   A    D+  +G TH Q A   TLG+  + ++Q+L   +   E + 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 YHLKFLAQGGT--------AVGTGLNTKI-GFDKLIAEEVSKET--GIEFKTAPNKFEAL 297
             +      GT        A+  G + K+   D+ + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 298 AAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENEPGSSIMPGKVN 355
                 + A   L++ A +  K+A DIR L +       E++ P  +++ GSS M  K N
Sbjct: 246 ------IDAFAPLSSFAATAHKMATDIRLLAN-----LKEVEEPFEKSQIGSSAMAYKRN 294

Query: 356 PTQNEAMTQVC 366
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 81/202 (40%), Gaps = 51/202 (25%)

Query: 189 LIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSL 248
           +IP+L  + + L   A E+ D+  +G TH Q A   TLG+  + ++Q+L   +     + 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 YHLKFLAQGGT-------------------AVGTGLNTKIGFD---KLIAEEVSKETGIE 286
             +      GT                   A+   +   +GFD    +  +  S++  I+
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKIDID 247

Query: 287 FKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLP--ENE 344
              + + FEA  AH                  K+A DIR L +       E++ P  + +
Sbjct: 248 ILGSGSSFEA-TAH------------------KMATDIRLLAN-----LKEVEEPFEKTQ 283

Query: 345 PGSSIMPGKVNPTQNEAMTQVC 366
            GSS M  K NP + E   +VC
Sbjct: 284 IGSSAMAYKRNPMRCE---RVC 302

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 96/251 (38%), Gaps = 42/251 (16%)

Query: 135 NVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELT 194
           +++     R  EL+G  +  K        +  +S ND   + + I     I + L+P L 
Sbjct: 85  DIHTANERRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLK 137

Query: 195 KLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFL 254
            L   L  + +    I+  G THLQ A P+      S Y         R++  L  L   
Sbjct: 138 SLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVS 197

Query: 255 AQGGTAVG---TGLNTK-----IGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIV-- 304
             G  A+     G++ +     +GF+ +I                N   A++  D +V  
Sbjct: 198 PLGAGALAGHPYGIDREFLANGLGFNGVIG---------------NSLVAVSDRDFVVEL 242

Query: 305 --FASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-NEPGSSIMPGKVNPTQNEA 361
             + +  +N ++    + A+D+    +     +G + L +    GSS+MP K N    E 
Sbjct: 243 LFWGTLFMNHIS----RFAEDLIIYSTAE---FGFITLSDAYSTGSSLMPQKKNSDSLEL 295

Query: 362 MTQVCVQIMGN 372
           +     ++ GN
Sbjct: 296 LRGKSGRVFGN 306

>KAFR0K01590 Chr11 (330408..333719) [3312 bp, 1103 aa] {ON}
           Anc_3.438 YPR115W
          Length = 1103

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 184 EITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYV 234
           EI NSLIP L  L+  L  K K+  D+    RT++     LT GQ  + Y+
Sbjct: 277 EIVNSLIPNLENLRKDLQFKIKDIKDLHNDFRTNINAHIKLT-GQLLNKYI 326

>YCR032W Chr3 (179520..186023) [6504 bp, 2167 aa] {ON}  BPH1PProtein
            homologous to human Chediak-Higashi syndrome and murine
            Beige proteins, which are implicated in disease syndromes
            due to defective lysosomal trafficking; mutant phenotype
            and genetic interactions suggest a role in protein
            sorting
          Length = 2167

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 15/174 (8%)

Query: 169  SNDTFPSVMHIAAVL-EITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLG 227
            +N ++  +  I  +L EI N L+     L   +       ++++   R    D + + + 
Sbjct: 949  NNSSYLELSFIVTLLPEILNDLVDSNNNLNLMMLKHPYTMSNLLYFLRKFRPDTSQIVMP 1008

Query: 228  QEF--SGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGI 285
            ++F  S Y   L   I   +SS YH K +++         + KI    LI     K+   
Sbjct: 1009 KDFYFSSYTCLLHCVIQIDKSSFYHFKNVSKSQLLQ----DFKICIMNLIYSNTLKQIIW 1064

Query: 286  EFKTAPNKFEALAAHDAIVFASGALN--TVAGSLFKIAQDIRYLGSGPRCGYGE 337
            E +      E+L AH  ++FA GA +  TV   L   A  +R       CGY +
Sbjct: 1065 EKEEYEMFSESLMAHQEVLFAHGACDNETVGLLLIFFANRLR------DCGYNK 1112

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 92/255 (36%), Gaps = 71/255 (27%)

Query: 226 LGQEFSG--YVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKET 283
            G  F+G  +   L   I+ I ++ +  +F      A   G    I  D LI  E  K  
Sbjct: 267 FGASFAGITFTTMLLYAIFTIRTTAWRTEFRRAANRADNKG--ASIALDSLINFEAVKYF 324

Query: 284 GIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPEN 343
             E   A   + +L  +               S  K+AQ + +L SG             
Sbjct: 325 NNEQYLANKYYSSLVDYR-------------NSQVKVAQSLAFLNSGQ------------ 359

Query: 344 EPGSSIMPGKVNPTQNEAMTQV----CVQIMGNNQTIS--IAGSQGQFELNVYKPLMIAN 397
                      N     A+T +    C  ++G N T+   +  +Q  F+L+V  PL   N
Sbjct: 360 -----------NLIFTSALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSV--PL---N 403

Query: 398 LLNSIRLMTDACKSFRIHCID-----DLKANKDKINENLNKSLMLVTALNP--------K 444
            L S+       +  +   ID      L+ N+ KI +N+++ LML   L P         
Sbjct: 404 FLGSV------YRELKQSLIDMESLFKLRKNEIKI-QNVHRPLMLPNELTPFEIKFENVT 456

Query: 445 IGYDAASKIAKNAHL 459
            GYD   KI KNA  
Sbjct: 457 FGYDKERKILKNASF 471

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 54/269 (20%), Positives = 104/269 (38%), Gaps = 37/269 (13%)

Query: 128 SGTQTNMNVNEVISNRAIELVGG---------KLGSKQIHPNNH--------------CN 164
           +G  T   ++E+  +R +E++ G         K G + IH  N                +
Sbjct: 54  AGLLTQEELDEI--HRGLEIIRGEWASNSFVEKDGDEDIHTANERRLGEIIGRHIAGKVH 111

Query: 165 QSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPL 224
             +S ND   + M I    E  +++   L  L  A+  +A++  D +  G THLQ A P+
Sbjct: 112 TGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPI 170

Query: 225 TLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETG 284
                 + Y         R++     L     G  A+        G D+   E +++  G
Sbjct: 171 RWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA---GHPYGIDR---EHIAERLG 224

Query: 285 IEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPE-N 343
            +     N  +A++  D +V      +     + + ++D+    +     +  ++L +  
Sbjct: 225 FD-GVIGNSLQAVSDRDFVVEILFWCSLFMNHISRFSEDLIIYSTAE---FNFVKLSDAY 280

Query: 344 EPGSSIMPGKVNPTQNEAMTQVCVQIMGN 372
             GSS+MP K NP   E +     ++ G+
Sbjct: 281 STGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>TDEL0D04170 Chr4 complement(765368..767791) [2424 bp, 807 aa] {ON}
           Anc_3.205 YDR001C
          Length = 807

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 13/119 (10%)

Query: 376 ISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSL 435
           I  A S G   +NV    M++NLL  + +     KSFR H I     ++ +INEN    L
Sbjct: 189 IGTANSNGYKYVNVRGTYMLSNLLQELTI----AKSFRRHQI---ILDEARINENPVSRL 241

Query: 436 ------MLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENM 488
                    T L  +I  +   +IAK+  +     +   + + Y  A++++ ++    M
Sbjct: 242 ERLIANQFWTNLTRRIDLNNIGEIAKDTKIDTPGAQNPRIYVPYNCADQYEFYIQASQM 300

>CAGL0A03344g Chr1 (340501..342378) [1878 bp, 625 aa] {ON} some
           similarities with uniprot|P53983 Saccharomyces
           cerevisiae YNL008c or uniprot|P54074 Saccharomyces
           cerevisiae YMR119w
          Length = 625

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 5/101 (4%)

Query: 337 ELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFE-LNVYKPLMI 395
           ELQLP     S ++ G +NP +      +   +  N+    ++G +  F  L  Y PL+ 
Sbjct: 300 ELQLPNKISHSYVISGYLNPIKGAPEDVIKGDVTDNDGKAPVSGVEKAFSILPFYSPLLF 359

Query: 396 AN---LLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNK 433
           AN   + + I  +    +SF     +D+++ ++K   +LNK
Sbjct: 360 ANVKTIKSVISWIFMKVRSFY-KTTEDIESTEEKRKNDLNK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,777,995
Number of extensions: 2125297
Number of successful extensions: 6533
Number of sequences better than 10.0: 84
Number of HSP's gapped: 6737
Number of HSP's successfully gapped: 84
Length of query: 493
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 379
Effective length of database: 40,409,475
Effective search space: 15315191025
Effective search space used: 15315191025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)