Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D02350na 1ON63463431840.0
NDAI0I02650na 1ON63860324450.0
Skud_5.24na 1ON62762421540.0
Kpol_358.4na 1ON61760721260.0
YEL065W (SIT1)na 1ON62856421250.0
TPHA0M00120singletonON61958121180.0
Suva_5.2na 1ON62755421180.0
SAKL0C12122gna 2ON61160221150.0
Smik_5.22na 1ON62860321130.0
TDEL0G04740singletonON60159419760.0
Kwal_23.5241na 2ON59155319360.0
KLTH0A01562gna 2ON61555718750.0
Kwal_23.4853na 3ON60354718300.0
KLTH0G09504gna 3ON62454618200.0
Kpol_416.6singletonON59759017490.0
Kpol_416.5singletonON60758916420.0
TPHA0G03780singletonON61255416140.0
NCAS0A11500singletonON61458415930.0
NDAI0A02050singletonON61758115260.0
Kpol_513.33singletonON62657715250.0
TPHA0B00180singletonON63357615060.0
TDEL0B00140singletonON63260214750.0
KAFR0D00930singletonON61459914590.0
CAGL0E04092gna 4ON64561813790.0
SAKL0G06600gsingletonON62960113571e-180
KAFR0C02660singletonON59157913471e-179
Suva_8.12na 4ON63362413481e-179
KNAG0J02980singletonON63661113441e-178
TBLA0C01040singletonON66959813271e-175
KAFR0I01560singletonON63264213191e-175
YHL040C (ARN1)na 4ON62760513121e-174
Smik_8.1na 4ON62761913031e-172
Skud_8.3na 4ON63162013021e-172
NDAI0H00140na 4ON63263412941e-171
SAKL0G03300gsingletonON61659012301e-161
KLLA0A10439gsingletonON63456412251e-160
KLLA0C19272gsingletonON62356412241e-160
TPHA0K02330singletonON63161812201e-160
KLTH0D00506gsingletonON61656412081e-158
ZYRO0G07414gsingletonON70756612111e-157
SAKL0F00792gsingletonON61758611891e-155
TDEL0H00130singletonON62160411561e-150
KLTH0D18150gsingletonON60757011421e-148
SAKL0E00132gsingletonON62061711401e-148
Kwal_34.15711na 4ON61858311391e-148
KLTH0A07964gsingletonON61959111361e-147
Kwal_23.2794singletonON61957011341e-147
KLLA0C00220gsingletonON62461211301e-146
KLTH0D00110gsingletonON62056111281e-146
KLTH0B10450gsingletonON62056111281e-146
Kwal_56.22298singletonON61060311261e-146
TBLA0F00470singletonON73263411211e-144
SAKL0F00110gsingletonON62062211111e-143
YHL047C (ARN2)singletonON62060511011e-142
NCAS0I00110na 4ON45245410561e-138
Skud_18.6singletonON61060410511e-135
KLLA0E14609gsingletonON63961010001e-127
YCL073C (GEX1)singletonON6155759971e-126
YKR106W (GEX2)singletonON6155769951e-126
Kwal_14.722singletonON6115599671e-122
KLTH0B00110gsingletonON6275909521e-120
KLLA0D19945gsingletonON6445769261e-115
Smik_11.370singletonON4404387819e-97
KLTH0G00198gna 4ON4584417681e-94
YOL158C (ENB1)singletonON6065416412e-74
Smik_21.4singletonON6055105731e-64
Suva_26.1singletonON5345345507e-62
TDEL0H01600singletonON6045635511e-61
Skud_6.14singletonON6366094873e-52
Smik_6.22singletonON6366114732e-50
Suva_10.9singletonON6375534531e-47
TDEL0A03210singletonON5845893353e-32
NCAS0I00100singletonON1631462892e-29
Smik_11.369singletonON1681212611e-25
Smik_17.11singletonON5443241573e-10
KNAG0K01020singletonON5993541483e-09
Skud_16.503singletonON5433391466e-09
Smik_16.81na 5ON6253681323e-07
YPR198W (SGE1)singletonON5433391313e-07
KLTH0D16962gsingletonON5713411305e-07
Skud_7.560na 5ON6423991271e-06
Kwal_26.9616singletonON5623501262e-06
SAKL0F00198gsingletonON5373471225e-06
SAKL0B12716gsingletonON6323471172e-05
Kpol_543.448.272ON6432961162e-05
KLTH0C10120gsingletonON6513611144e-05
TBLA0D032708.843ON5501451136e-05
SAKL0A08228gsingletonON5693421136e-05
TBLA0D03280singletonON5801061127e-05
NCAS0B002908.843ON5421631118e-05
SAKL0A00726gsingletonON5984251119e-05
KLTH0C10142gsingletonON5733371101e-04
KLTH0B00132gsingletonON5683551082e-04
TDEL0F039908.272ON6312291073e-04
Ecym_13888.858ON5721611064e-04
Kwal_56.237548.272ON5892971054e-04
KLLA0A04631g8.272ON5792931054e-04
ZYRO0C01430g8.272ON5902881047e-04
YKR105C (VBA5)singletonON5823621047e-04
NDAI0E002108.858ON6131471038e-04
ZYRO0A00902g8.858ON604222990.003
SAKL0H16808g8.272ON657228990.003
TPHA0A017508.272ON636297980.003
TBLA0B029408.858ON661143980.003
SAKL0A07480gsingletonON573418970.004
NCAS0C002708.858ON570145970.004
Skud_13.188.858ON585129970.005
Suva_13.208.858ON584129960.005
NCAS0B002208.858ON625129960.006
KAFR0B039408.843ON547368960.006
Kpol_541.168.843ON528437950.008
NCAS0C03460na 5ON630366950.008
Kwal_14.1585na 6ON570132940.009
KLTH0G13464g8.272ON593427940.009
SAKL0D00814g8.858ON570129940.010
AGR076C8.272ON686302930.013
Smik_13.118.858ON586129930.014
Kwal_33.142688.858ON569163920.017
CAGL0B02475g8.858ON580132910.024
Kwal_27.102458.843ON51599900.030
TDEL0B002708.858ON58197900.031
TBLA0D05810singletonON574249890.036
YML123C (PHO84)8.858ON587127890.040
ABL040W2.473ON567300890.045
KNAG0J002608.843ON550172880.047
KLTH0B00594gsingletonON618269880.049
Kpol_541.208.858ON568129880.051
TPHA0I003808.858ON578129880.054
YGR224W (AZR1)na 5ON613371880.055
KLTH0H05456gna 6ON568167880.056
YCL069W (VBA3)singletonON458285870.066
AFR442C8.858ON563129870.076
TBLA0F030408.272ON906309860.094
KAFR0A029108.858ON58697850.12
KNAG0G034308.843ON542157840.14
YNR072W (HXT17)singletonON564192840.14
Smik_13.2722.473ON561289840.16
Ecym_42988.272ON678235830.20
KNAG0E025602.473ON578421830.20
Klac_YGOB_Anc_8.8588.858ON574173830.22
YOL103W (ITR2)3.84ON609178820.27
TBLA0E01970singletonON578152810.31
Suva_2.6743.84ON579297810.31
KLTH0B10142gsingletonON568361810.35
TDEL0G03260singletonON612357810.38
SAKL0C02178gsingletonON565221810.38
Skud_18.3singletonON590283810.40
Suva_13.2652.473ON561137800.48
Smik_13.4928.843ON543168800.50
Suva_13.278.843ON55390800.50
ZYRO0A00330gsingletonON576422800.51
AFR343C3.84ON571100800.51
Suva_4.2singletonON57057790.65
Kwal_26.6697singletonON577360790.69
Skud_13.4518.843ON539168780.73
Suva_4.553na 7ON562353780.76
TPHA0C048308.858ON598142780.76
ZYRO0C00374gna 8ON564149780.76
Kpol_309.18.858ON58697780.76
KLLA0F13684g2.473ON571229780.87
Skud_13.2442.473ON562125770.97
Suva_13.4678.843ON543164771.0
TBLA0A03480singletonON574242771.1
SAKL0B00264gsingletonON519114761.4
NDAI0G015203.23ON530195761.5
ZYRO0G21868gna 6ON620251761.5
NDAI0A071103.84ON602168751.7
KLTH0F06864g8.858ON57097751.9
YJR158W (HXT16)singletonON56777752.1
YDL245C (HXT15)singletonON56777752.1
KLLA0E09021gna 8ON56683742.1
YEL069C (HXT13)na 9ON56473742.2
YMR088C (VBA1)2.473ON562125742.2
KNAG0G035308.858ON58497742.2
TBLA0A03400singletonON574197742.4
CAGL0B02079gna 5ON624194742.8
TDEL0C00120singletonON569102732.8
TBLA0F01600singletonON567287733.0
KLTH0C09372g3.84ON608308733.1
TBLA0A03450singletonON573121733.1
KAFR0C014803.84ON577124733.2
YBR293W (VBA2)na 7ON474203733.3
Smik_4.7743.84ON584239733.4
Skud_4.7713.84ON584281723.9
Smik_14.401na 10ON636195724.1
NDAI0E002808.843ON549157724.3
YML116W (ATR1)8.843ON542110714.9
CAGL0J01375g2.473ON564335715.0
SAKL0C05588gsingletonON677259715.0
Suva_15.2915.396ON592174715.5
TBLA0A01240singletonON569194715.5
Kwal_56.227243.84ON578124715.5
Skud_14.406na 10ON56477715.8
Skud_4.5singletonON57383707.1
YDR497C (ITR1)3.84ON584198707.5
Smik_5.19na 9ON56777707.5
KLLA0C12309g3.84ON569144707.5
SAKL0D01386g8.843ON521106707.5
TPHA0A006203.84ON634157708.4
NCAS0I025203.84ON587167708.4
Smik_25.4singletonON315131698.9
KLLA0E20945g3.23ON528273699.0
TPHA0B039001.432ON554107699.3
Smik_2.434na 7ON474188699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02350
         (634 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}             1231   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              946   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)   834   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   823   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...   823   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               820   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)      820   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   819   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)   818   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   765   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   750   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   726   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   709   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   705   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   678   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   637   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   626   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   618   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   592   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   592   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      584   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                572   0.0  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   566   0.0  
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   535   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   527   e-180
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              523   e-179
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   523   e-179
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             522   e-178
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              515   e-175
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     512   e-175
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   509   e-174
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   506   e-172
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   506   e-172
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      503   e-171
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   478   e-161
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   476   e-160
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   476   e-160
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             474   e-160
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   469   e-158
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   471   e-157
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   462   e-155
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      449   e-150
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   444   e-148
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   443   e-148
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   443   e-148
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   442   e-147
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   441   e-147
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   439   e-146
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   439   e-146
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   439   e-146
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   438   e-146
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              436   e-144
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   432   e-143
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   428   e-142
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        411   e-138
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   409   e-135
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   389   e-127
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   388   e-126
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   387   e-126
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   377   e-122
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   371   e-120
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   361   e-115
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   305   9e-97
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   300   1e-94
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   251   2e-74
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    225   1e-64
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       216   7e-62
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   216   1e-61
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   192   3e-52
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   186   2e-50
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   179   1e-47
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              133   3e-32
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         115   2e-29
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...   105   1e-25
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    65   3e-10
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    62   3e-09
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    61   6e-09
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    55   3e-07
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    55   3e-07
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    55   5e-07
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    54   1e-06
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    53   2e-06
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    52   5e-06
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    50   2e-05
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    49   2e-05
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    49   4e-05
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    48   6e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    48   6e-05
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    48   7e-05
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       47   8e-05
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    47   9e-05
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    47   1e-04
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    46   2e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    46   3e-04
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    45   4e-04
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    45   4e-04
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    45   4e-04
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    45   7e-04
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    45   7e-04
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    44   8e-04
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    43   0.003
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    43   0.003
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    42   0.003
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    42   0.003
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...    42   0.004
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    42   0.004
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    42   0.005
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    42   0.005
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    42   0.006
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    42   0.006
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    41   0.008
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    41   0.008
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    41   0.009
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    41   0.009
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    41   0.010
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    40   0.013
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    40   0.014
Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {...    40   0.017
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    40   0.024
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    39   0.030
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    39   0.031
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    39   0.036
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    39   0.040
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    39   0.045
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    39   0.047
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    39   0.049
Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON} (55476..5...    39   0.051
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    39   0.054
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    39   0.055
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    39   0.056
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    38   0.066
AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}...    38   0.076
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    38   0.094
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    37   0.12 
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    37   0.14 
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    37   0.14 
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    37   0.16 
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    37   0.20 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    37   0.20 
Klac_YGOB_Anc_8.858 Chr3 (1471304..1471548,1471550..1473029) [17...    37   0.22 
YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}  ITR2Myo-i...    36   0.27 
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    36   0.31 
Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {...    36   0.31 
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    36   0.35 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               36   0.38 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    36   0.38 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    36   0.40 
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    35   0.48 
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    35   0.50 
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    35   0.50 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    35   0.51 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    35   0.51 
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       35   0.65 
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    35   0.69 
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    35   0.73 
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    35   0.76 
TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON} Anc_8...    35   0.76 
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    35   0.76 
Kpol_309.1 s309 (1360..3120) [1761 bp, 586 aa] {ON} (1360..3120)...    35   0.76 
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    35   0.87 
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    34   0.97 
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    34   1.0  
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               34   1.1  
SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar ...    34   1.4  
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    34   1.5  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    34   1.5  
NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa] ...    33   1.7  
KLTH0F06864g Chr6 complement(601480..603192) [1713 bp, 570 aa] {...    33   1.9  
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    33   2.1  
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    33   2.1  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    33   2.1  
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    33   2.2  
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    33   2.2  
KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.8...    33   2.2  
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    33   2.4  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    33   2.8  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         33   2.8  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    33   3.0  
KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly...    33   3.1  
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    33   3.1  
KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {O...    33   3.2  
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    33   3.3  
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    33   3.4  
Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {...    32   3.9  
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    32   4.1  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843       32   4.3  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    32   4.9  
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    32   5.0  
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    32   5.0  
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    32   5.5  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    32   5.5  
Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {...    32   5.5  
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    32   5.8  
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    32   7.1  
YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}...    32   7.5  
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    32   7.5  
KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} high...    32   7.5  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    32   7.5  
TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.8...    32   8.4  
NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {O...    32   8.4  
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      31   8.9  
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    31   9.0  
TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432     31   9.3  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    31   9.5  

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 1231 bits (3184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/634 (96%), Positives = 610/634 (96%)

Query: 1   MSSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQY 60
           MSSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQY
Sbjct: 1   MSSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQY 60

Query: 61  QNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQI 120
           QNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQI
Sbjct: 61  QNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQI 120

Query: 121 WFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIA 180
           WFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIA
Sbjct: 121 WFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIA 180

Query: 181 TDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCM 240
           TDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCM
Sbjct: 181 TDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCM 240

Query: 241 LHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTL 300
           LHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTL
Sbjct: 241 LHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTL 300

Query: 301 AGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFL 360
           AGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFL
Sbjct: 301 AGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFL 360

Query: 361 INFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFIL 420
           INFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFIL
Sbjct: 361 INFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFIL 420

Query: 421 FGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAV 480
           FGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFF            RSHAKMAV
Sbjct: 421 FGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQTSIQATTRSHAKMAV 480

Query: 481 ITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWET 540
           ITALYLACYNI            WTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWET
Sbjct: 481 ITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWET 540

Query: 541 AERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPI 600
           AERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPI
Sbjct: 541 AERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPI 600

Query: 601 FAFLKKCIPFYNKKNGETSTVTTSTDGNDVVEMV 634
           FAFLKKCIPFYNKKNGETSTVTTSTDGNDVVEMV
Sbjct: 601 FAFLKKCIPFYNKKNGETSTVTTSTDGNDVVEMV 634

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/603 (74%), Positives = 512/603 (84%), Gaps = 2/603 (0%)

Query: 15  STQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLF 74
           S     +++  +KET S     +SS SE S+KDAGV NIE+YAEQY+ P+ R +LFFSLF
Sbjct: 6   SHSNQGEEEIAQKETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLF 65

Query: 75  LVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTI 134
           LVAYAYGLDGNIRYT+QA ATSSYS+HSLLSTVNCIKTVIAAAGQIWFARASDIFGRLT+
Sbjct: 66  LVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTM 125

Query: 135 LGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALF 194
           L ++I+FY++GT+IESQATNVARFTAGGCFYQ+GYTGAMLI+E+IATDFSNLNWRLLALF
Sbjct: 126 LIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALF 185

Query: 195 IPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDR 254
           +PALPFIINTWISGDVT+AV G+WKWGIGMWAFIFPLACIPL CCMLHMRYLA+KN+KD+
Sbjct: 186 VPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDK 245

Query: 255 LMPSFTIPKDVSRKEYF-IDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHI 313
           L     +PKD   K YF IDV FW+LDMIGLLL+VCFFGCVL+PFTLAGGM  +W+TAHI
Sbjct: 246 LAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHI 305

Query: 314 IVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMY 373
           IVPEVIGW V LPLYILWE+KFS+HPLTPW LLKDRGV+SALIIA +INFCWYMQGDYMY
Sbjct: 306 IVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMY 365

Query: 374 TVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLL 433
           TVL+VAVHESVK+ATRITSLYSFVSV+TGT LGL L+K+RRTKPFI+FGI  WF++FGLL
Sbjct: 366 TVLVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISMWFVAFGLL 425

Query: 434 IHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXX 493
           I YRGDS +HAGIIGSLCLLGF AGFF            RSH K+AVITALYLA YNI  
Sbjct: 426 IRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIGS 485

Query: 494 XXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRET 553
                     WTNVLPDRIS+ I+NQTLAAEAYGSPFTFIIT TW T +R AVVKAYR+ 
Sbjct: 486 GLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDV 545

Query: 554 QKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKKCIP-FYN 612
           QKILCIIGL FC+PLL AAL LR+H+LEDVVAL+++ EK V++DDP+  FL K IP   N
Sbjct: 546 QKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSLRN 605

Query: 613 KKN 615
           KKN
Sbjct: 606 KKN 608

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/624 (65%), Positives = 479/624 (76%), Gaps = 10/624 (1%)

Query: 5   STTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVK-----DAGVNNIEIYAEQ 59
           ST  + +    T+    +   K+   +  +N   ++S  +       D GV+NIEIYAE 
Sbjct: 4   STASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIYAEI 63

Query: 60  YQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQ 119
           Y  P  R  LFFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLSTVNCIKTVIAA GQ
Sbjct: 64  YNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123

Query: 120 IWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEII 179
           I+FAR SDIFGR +IL +S+IFYI+GTVIESQA N+ RF  GGCFYQLG TG +LI+E+I
Sbjct: 124 IFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183

Query: 180 ATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACC 239
           A+DFSNLNWRLLALFIPALPFIINTWISG+VT+A+  NWKWGIGMWAFI PLACIPL  C
Sbjct: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPLGLC 243

Query: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFT 299
           MLHMRYLA K+AKDRL P F     +  K + ID+ FW+LD+IG+LLI  FFGCVL+PFT
Sbjct: 244 MLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLVPFT 303

Query: 300 LAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAF 359
           LAGG+KE+WRTAHIIVPEVIGW VALPLY+LWE+K+SRHPLTPW+L+KDRG++ AL+IAF
Sbjct: 304 LAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAF 363

Query: 360 LINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFI 419
            INF WYMQGDYMYTVLIVAVHES+K+ATRITSLYSFVSVI GTILG  L+K+RRTKPFI
Sbjct: 364 FINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFI 423

Query: 420 LFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMA 479
           LFGI  W +SFGLL+HYRGDSGAHAGIIGSLCLLGF AG F            ++HA+MA
Sbjct: 424 LFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMA 483

Query: 480 VITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWE 539
           ++T+LYLA YNI            WTN+LP  IS+ IS+ TLAA+AYGSPFTFIITYTW 
Sbjct: 484 IVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITYTWG 543

Query: 540 TAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQM----SEKVVE 595
           T ER A+V +YR  QKILCIIGLVFC PLL  ALMLR+HKL D +AL+      S+   E
Sbjct: 544 TPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKDAFE 603

Query: 596 DDDPIFAFLK-KCIPFYNKKNGET 618
             +    FLK K +  +  KN E 
Sbjct: 604 PKEKEETFLKSKFLSQFTGKNKEN 627

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/607 (65%), Positives = 473/607 (77%), Gaps = 6/607 (0%)

Query: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESV------KDAGVNNIEI 55
           SS S  D  I+    Q  T +DS +  +     N   S   +        KDAGVNNIE+
Sbjct: 4   SSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEV 63

Query: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIA 115
           YAEQY +P  R MLFFSLFLVAYAYGLDG++RYT+QA ATSSYS+HSLLSTVN I TVIA
Sbjct: 64  YAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITTVIA 123

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175
           AAGQI +ARASDIFGR+TIL + ++FY +GT+IESQATNV RF  G CFYQLGYTG +L 
Sbjct: 124 AAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILS 183

Query: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIP 235
           +E+IA DFSNLNWRL A F+PALPFIINTWISG+V+ AV  +WKWGIGMWAFI PL+ IP
Sbjct: 184 LELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIP 243

Query: 236 LACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVL 295
           L CC+LHMR+LAHKNAKDRL   F   +D+    Y +DVF W+LD IGLLL+   FGC+L
Sbjct: 244 LGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCIL 303

Query: 296 IPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSAL 355
           +PFTLAGG++++W+TAHIIVPEVIGWCVALP+++LWEIKFS+ PLTPW L+KDRG++ AL
Sbjct: 304 VPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFAL 363

Query: 356 IIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
           +IAF INF WYMQGDYMYTVLIV+V+ES+K+ATRITSLYSFVSVITGT+LGL ++K+RRT
Sbjct: 364 VIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRT 423

Query: 416 KPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSH 475
           KPFI+FG+  WFI+FGLL+HYRG S +H+GI+GSLCLLGF AGFF            + H
Sbjct: 424 KPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQASIQASVKYH 483

Query: 476 AKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIIT 535
           +KMAVITALYLA YNI            WTNVLP +IS+ I+N+TLAAEAYGSPFTFI+T
Sbjct: 484 SKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAYGSPFTFILT 543

Query: 536 YTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE 595
           YTW+T ERQAVV +YR TQKILCI+GL FC  LL AAL LR+HKLE VVAL ++      
Sbjct: 544 YTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNS 603

Query: 596 DDDPIFA 602
           D+   FA
Sbjct: 604 DEQGSFA 610

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/564 (69%), Positives = 456/564 (80%), Gaps = 4/564 (0%)

Query: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106
           D GV+NIEIYAE Y  P  R  LFFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLST
Sbjct: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110

Query: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166
           VNCIKTVIAA GQI+FAR SDIFGR +I+ VSIIFY +GT+IESQA N+ RF  GGCFYQ
Sbjct: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170

Query: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226
           LG TG +LI+E+IA+DFSNLNWRLLALFIPALPFIINTWISG+VT+A++ NWKWGIGMWA
Sbjct: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230

Query: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286
           FI PLACIPL  CMLHMRYLA K+AKDRL P F     +  K + ID+ FW+LD+IG+LL
Sbjct: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290

Query: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346
           I  FFGCVL+PFTLAGG+KE+W+TAHIIVPEVIGW V LPLY+LWEIK+SRHPLTPW+L+
Sbjct: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350

Query: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406
           +DRG++ AL+IAF INF WYMQGDYMYTVL+VAVHES+K+ATRITSLYSFVSVI GTILG
Sbjct: 351 QDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410

Query: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXX 466
             L+K+RRTKPFI+FGI  W +SFGLL+HYRGDSGAH+GIIGSLCLLGF AG F      
Sbjct: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470

Query: 467 XXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAY 526
                 ++HA+MAV+T+LYLA YNI            WTN+LP  IS+ IS+ TLAA+AY
Sbjct: 471 SIQASAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAY 530

Query: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586
           GSPFTFI TYTW T ER A+V +YR  QKILCIIGLVFC PLL  A MLR+HKL D +AL
Sbjct: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590

Query: 587 DQ----MSEKVVEDDDPIFAFLKK 606
           +      S+   E ++   +FLK 
Sbjct: 591 EGNDHLESKNTFEIEEKEESFLKN 614

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/581 (66%), Positives = 470/581 (80%), Gaps = 3/581 (0%)

Query: 21  QDDSIKKE-TVSATINSVSSLSE--ESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVA 77
            D  ++K+  +   + +VSS S+  ES  DAGV+NIE+YAEQY +P  R  LFFS+FLVA
Sbjct: 22  SDAEMQKDLDIEPKLTAVSSSSDDAESHVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVA 81

Query: 78  YAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGV 137
           YAYGLDG +RYT+Q+ ATSSY++HSLLSTVNCI TVIAAAGQI +ARASDIFGR+TIL +
Sbjct: 82  YAYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGRMTILVI 141

Query: 138 SIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPA 197
            +IFY +GT+IESQATNV+RF AG CFYQLGYTG +L +E+IA DFSNLNWRLLA F+PA
Sbjct: 142 GVIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPA 201

Query: 198 LPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMP 257
           LPFIINTWISG+VT+AVNGNWKWGIGMWAFI PL+ IPL CC+LHMRYLA KNA DRL+ 
Sbjct: 202 LPFIINTWISGNVTSAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLK 261

Query: 258 SFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPE 317
             ++   +  K++ +++ FWRLD IGLL++   FGC+LIPFTLAGG++ +W+TAHIIVPE
Sbjct: 262 EASLIGTLGWKKFIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPE 321

Query: 318 VIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLI 377
           VIGWC+ALPL++LWEIKFSRHPLTPW L+KDRG+  A+ IAF INFCWYMQGDYMYTVLI
Sbjct: 322 VIGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLI 381

Query: 378 VAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYR 437
           V+VHESVK+ATRITSLYSFVSVITGTILG+F+ K+RRTKPFI+FG+  WFI+FGLL+HYR
Sbjct: 382 VSVHESVKSATRITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYR 441

Query: 438 GDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXX 497
           GD+ +H+GIIGSLCLLGF AGFF            +SH+KMAVITALYLA YNI      
Sbjct: 442 GDNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSVGA 501

Query: 498 XXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKIL 557
                 WTN+LP  IS+ ++N+TLAA AY SP++FII YTW T ER AVV AYR TQ+IL
Sbjct: 502 AVSGAIWTNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYRYTQRIL 561

Query: 558 CIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDD 598
           CI+GL FC  LL++AL LR+HKL   V++D+   KV E  D
Sbjct: 562 CIVGLCFCTTLLISALFLRNHKLVSSVSIDKEQTKVEEVSD 602

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/554 (69%), Positives = 448/554 (80%)

Query: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106
           D GV NIEIYAEQY  P  RA LFFS+FL+AYAYGLDG IRYTFQA ATSSYS+HSLLST
Sbjct: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110

Query: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166
           VNCIKTVIAA GQI+FAR SDIFGR +IL +S+IFY +GT+IESQA  + RF  GGCFYQ
Sbjct: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170

Query: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226
           LG TG +LI+E+IA+DFSNLNWRLLALF+PALPFI+NTWISGDVT+A+  NWKWGIGMWA
Sbjct: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230

Query: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286
           FI PLACIPL  CMLHMRYLA K+AKD+L P F    ++  K + ID+ FW+LD+IGLLL
Sbjct: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290

Query: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346
           +  FFGCVL+PFTLAGG+KE+W+ AHIIVPEVIGW VALPLY++WE+K+SRHPLTPW+L+
Sbjct: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350

Query: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406
           KDRGV  AL IAF INF WYMQGDYMYTVL+VAVHES+K+ATRIT+LYSFVSVI GTILG
Sbjct: 351 KDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410

Query: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXX 466
             L+K+RRTKPFILFGI  W +SFGLL+HYRGDSGAHAGIIGSLCLLGF AG F      
Sbjct: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470

Query: 467 XXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAY 526
                  +HA+MA++T+LYLA YNI            WTN+LP  IS+ IS+ TLAAEAY
Sbjct: 471 SIQASAGTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAY 530

Query: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586
           GSPFTFI TYTW T ER A+V +YR  QKILCIIGLVFC PLL  A MLR+HKL D +AL
Sbjct: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590

Query: 587 DQMSEKVVEDDDPI 600
           +       ++D+ I
Sbjct: 591 EGNDHLESKNDNEI 604

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/602 (66%), Positives = 484/602 (80%), Gaps = 5/602 (0%)

Query: 21  QDDSIKKETVSATINSVSS----LSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLV 76
            D  IKK     ++    +     S+   KDAGV+NIEIYA+QY++P+ R  LFFS+FLV
Sbjct: 2   SDSDIKKTVTEGSVAPKDTWSIKTSDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLV 61

Query: 77  AYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILG 136
           AYAYGLDGNIRYTFQA ATSSYS+HSL+STVNCIKTVIAAAGQI FARASD+FGRL+IL 
Sbjct: 62  AYAYGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILI 121

Query: 137 VSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIP 196
           ++++FY++GTVIESQATNV+RF AG CFYQLG TG +LI+E+I  DFSNLNWRL+A F+P
Sbjct: 122 IAVLFYVVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVP 181

Query: 197 ALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLM 256
           ALPFIINTWISGDVT+A+  NW+WGI MWAFI PL+CIPL CCMLHMRYLAHKNA + LM
Sbjct: 182 ALPFIINTWISGDVTSAIGTNWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLM 241

Query: 257 PSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVP 316
             F + K +   EY +++FFW+LD +GLLL+   FG VLIPFTLAGG++ +W++A IIVP
Sbjct: 242 SEFKLYKQMPWSEYLVEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVP 301

Query: 317 EVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL 376
           EV+GWC+ALPL++LWE K++R+PLTPW+L+KDRG++SALIIAFLINF WYMQGDYMYTVL
Sbjct: 302 EVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVL 361

Query: 377 IVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHY 436
           IVAVHES+K+ATRI SLYSFVSVITGT+LG  +VK+RRTKPFILFG+C WF+SFGLL+HY
Sbjct: 362 IVAVHESIKSATRIVSLYSFVSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHY 421

Query: 437 RGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXX 496
           RGDSGAHAGI+GSLCLLGF AGFF             SH  MAVITALYLA YNI     
Sbjct: 422 RGDSGAHAGIVGSLCLLGFGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVG 481

Query: 497 XXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKI 556
                  WTNVLP ++S+ +S+  +A+ AYGSPFTFIITYTWET ERQAVV AYR  QKI
Sbjct: 482 NAVSGAIWTNVLPQQLSKRLSDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKI 541

Query: 557 LCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKKCIPFYNKKNG 616
           LC +G+ FCVPL++AAL+LR+HKLE VVALD + EK   DD+    FL K  P  ++ NG
Sbjct: 542 LCTVGVCFCVPLVLAALLLRNHKLESVVALDDLDEKNRVDDNENGNFLTKFFP-SSRSNG 600

Query: 617 ET 618
           ET
Sbjct: 601 ET 602

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/603 (66%), Positives = 471/603 (78%), Gaps = 15/603 (2%)

Query: 20  TQD---DSIKKETVSATINSVSSLSEES-------VKDAGVNNIEIYAEQYQNPFLRAML 69
           T+D   D ++KE V A ++   +L+  S       + D GV NIEIYAE Y  P  R  L
Sbjct: 15  TEDVVPDILEKE-VGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVAL 73

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
           FFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLSTVNCIKTVIAA GQI+FAR SDIF
Sbjct: 74  FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIF 133

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GR +I+ VS+IFY +GT+IESQA N+ RF  GGCFYQLG TG +LI+E+IA+DFSNLNWR
Sbjct: 134 GRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193

Query: 190 LLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHK 249
           LLALFIPALPFIINTWISGDVT+A+  NWKWGIGMWAFI PLACIPL  CMLHMRYLA K
Sbjct: 194 LLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARK 253

Query: 250 NAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWR 309
           +AKDRL P F     +  K + ID+ FW+LD+IG+LLI  FFGCVL+PFTLAGG+KE+W+
Sbjct: 254 HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWK 313

Query: 310 TAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQG 369
           +AHIIVPEVIGW V LPLY+LWE+K+SRHPLTPW+L+KDRG++ AL+IAF INF WYMQG
Sbjct: 314 SAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALLIAFFINFNWYMQG 373

Query: 370 DYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFIS 429
           DYMYTVL+VAVHES+K+ATRITSLYSFVSVI GTILG  L+K+RRTKPFI+FGI  W +S
Sbjct: 374 DYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVS 433

Query: 430 FGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACY 489
           FGLL+HYRGDSGAH+GIIGSLCLLGF AG F            ++HA+MAV+T+LYLA Y
Sbjct: 434 FGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATY 493

Query: 490 NIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKA 549
           NI            WTN+LP  IS+ IS+ TLAA+AY +PFTFI TYTW T ER A+V +
Sbjct: 494 NIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMS 553

Query: 550 YRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQ----MSEKVVEDDDPIFAFLK 605
           YR  QKILCIIGLVFC PLL  A MLR+H+L D +AL+      S+   E ++   +FLK
Sbjct: 554 YRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLK 613

Query: 606 KCI 608
             I
Sbjct: 614 SMI 616

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/594 (62%), Positives = 456/594 (76%)

Query: 22  DDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYG 81
            +  K ET ++ ++S +       KDAGV+NIE++  QY +   R MLFFS+FL++YAYG
Sbjct: 7   KEQTKFETANSELSSHTHEDAGEEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYG 66

Query: 82  LDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIF 141
           LD NIRYT Q  AT+SYS+HSLL+TVNCI  VIAA GQ+ FARA+DIFGR T+L V++IF
Sbjct: 67  LDQNIRYTLQTYATNSYSQHSLLATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIF 126

Query: 142 YIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFI 201
           Y++GT+IESQATNV+RF AG CFY+LG TG ML++E+IA DFSNLNWRLLA F+PALPFI
Sbjct: 127 YVMGTIIESQATNVSRFAAGACFYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFI 186

Query: 202 INTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTI 261
           INTWISG+V  A+  NWKWGIGMWAFI PL+CIPL  CMLHMRYLAHKNAKD+L   F +
Sbjct: 187 INTWISGNVLTAIGTNWKWGIGMWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKL 246

Query: 262 PKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGW 321
            K +S  EY ++VFFWRLD  GL+LI   FGC+LIPFTL GG+ E+W+TA IIVPEVIGW
Sbjct: 247 FKTMSWYEYIVEVFFWRLDFPGLILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGW 306

Query: 322 CVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVH 381
            VALPLY++WE K++RHPLTPW+L+KDRG++SALIIAF INF WYMQGDYM+TVL VAV+
Sbjct: 307 VVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVN 366

Query: 382 ESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSG 441
           ES  +A RITSLYSFVSVITGT+LGL +VK+RRTK FILFGI  WFISFGLL+H+RGDS 
Sbjct: 367 ESNSSAQRITSLYSFVSVITGTLLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSS 426

Query: 442 AHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXX 501
           +H+GIIGSLCL+GF AGFF            + H  +AVIT+LYLA YNI          
Sbjct: 427 SHSGIIGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSG 486

Query: 502 XXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIG 561
             WTNVLP  I + +++ TL  +AY  P TFI+TYTWET ERQAVV AYR TQK+LCI+G
Sbjct: 487 AIWTNVLPKEIGKRLNDATLTQQAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVG 546

Query: 562 LVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKKCIPFYNKKN 615
           L FC PLL +A +LRDH+L DV+AL+ + EK + +D+    F  K   F  K  
Sbjct: 547 LCFCAPLLFSAFLLRDHRLGDVIALEDLDEKNLAEDEESGKFWGKYFRFARKHE 600

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/553 (63%), Positives = 434/553 (78%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           KDAGVNNIE+YA+QY +   R +LFFSLFLVAYAYGLDG +RY FQA AT+SY  HSLLS
Sbjct: 23  KDAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLS 82

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
           TVNCIK VIAAAGQ+ FARA+DIFGR++I+ VSI+FY++GT+I+SQAT V+++ AG C Y
Sbjct: 83  TVNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIY 142

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMW 225
           QLGYTG +LI+EIIA DFSNLNWRLLA F+PA+PFIINTWISGDV +AV  NWKWGIGMW
Sbjct: 143 QLGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMW 202

Query: 226 AFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLL 285
           AFIFPL+ +PL  CM HMRYLA + A DRL+   ++ K +S   Y  +VFFWRLD +GL+
Sbjct: 203 AFIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLI 262

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           ++   FGC+LIPFTLAG +K++W+TA IIVPEVIGWCVALPL++LWE+KF++HPL PW +
Sbjct: 263 MVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNV 322

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           +KDRG++SALIIA  INF WYMQG +MYTVLI+AV+ESVK+ATRITSLYSFVSV+TG  L
Sbjct: 323 IKDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGL 382

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           G  +  +R+TK FI+FGI  W +SFGLLIHYRGDS +H+GIIG+ CLLGF AGFF     
Sbjct: 383 GFVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTTQ 442

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                  ++H  MAVITALYL+ YNI            WTN+LP  + + I++ T  A A
Sbjct: 443 TSIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALA 502

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           YGSPFTFIITY W T ER+AVVK+Y+  QK+LC++G+ FC  L+ +AL LRDH+L D VA
Sbjct: 503 YGSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSVA 562

Query: 586 LDQMSEKVVEDDD 598
           L+   EK   + D
Sbjct: 563 LEDEDEKFSINSD 575

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/557 (62%), Positives = 425/557 (76%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           KDAGVNNIE+YA QY +   R  LFFSLFLVAYAYGLDG +R + QA ATSSY  HSLL+
Sbjct: 43  KDAGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLA 102

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
           T+NC+K VIAAAGQI FARASDIFGR+TIL ++++ Y +GT+I+SQATN+ R+ AG C Y
Sbjct: 103 TINCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIY 162

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMW 225
           QLGYTG +LI+EIIA DFSNLNWRL+A F+PALPFIINTWISG+   A+  NWKWGIGMW
Sbjct: 163 QLGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMW 222

Query: 226 AFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLL 285
           AFI PL+C+PL  C+LHMR+LAHKNAKD+L     + K +   +Y ++VFFWRLD++GLL
Sbjct: 223 AFIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLL 282

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           L+   FGC+L+PFTLAG ++ +W+ A IIVPEVIGWCVALPL++LWE K+SRHPL PW L
Sbjct: 283 LVCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSL 342

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           +KDRG++SALIIA  INF WYMQGDYMYTVL+VAV+E+ K+A RITSLYSFVSVITG +L
Sbjct: 343 VKDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLL 402

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           G  +V  RRTK FILFGI  WF++FGLL+HYRGDS +H+GI+GSLCLLGF AGFF     
Sbjct: 403 GGVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQ 462

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                  +SH  MAVITALYL+ YNI            WTN+LP  + + I++      A
Sbjct: 463 TSIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVATYTLA 522

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           YGSPF FI  Y W T ER  VV AYR  Q+IL I+GL FCV LL++A  LRDH+LE+ VA
Sbjct: 523 YGSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVA 582

Query: 586 LDQMSEKVVEDDDPIFA 602
           L+ + EK     D + A
Sbjct: 583 LEDVDEKSSRKSDELEA 599

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/547 (60%), Positives = 418/547 (76%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           KDAGV NI++YA+QY N F R  LFFSLFLVAY+Y LDG +R   +  AT SY  HSLLS
Sbjct: 26  KDAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLS 85

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
           TVNCIKTVI AAG I +ARASDIFGR+T+L ++++ Y++GT++E Q+  V++F  G   +
Sbjct: 86  TVNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIF 145

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMW 225
           QLG  G +L++++IA DFS LNWR++AL++PALP IINTW+SGD+  A+NGNWKWGIGMW
Sbjct: 146 QLGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMW 205

Query: 226 AFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLL 285
           AFI PLAC+PL  C++HMRYLAHKN KD+L+  + + K+ S   Y  +VFFWRLD++GL+
Sbjct: 206 AFILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLDILGLI 265

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           LI    GCVLIPFTLAGG+ ++W++AHIIVPEVIGWCVA PL++LWE K++RHPLTPW L
Sbjct: 266 LITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRL 325

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           LKDRGV SA+II F I+F  YMQ DYMYTVL+VAV+ESVK+A RIT+L++FV++ITGT+L
Sbjct: 326 LKDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTLL 385

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           G  +  ++RTK FILFGIC WF++FGLLI YRGDS +H+GI+G+LCLLGF  GFF     
Sbjct: 386 GFVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYATQ 445

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                   SH  MAVIT+LYLA YN+            WTNVLP ++ + IS+ ++A  A
Sbjct: 446 VSLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANIA 505

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           Y SPF FI  Y W + ER AV++AY+  QKILC +GL FCV LL+AAL LRD KLE VVA
Sbjct: 506 YSSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVVA 565

Query: 586 LDQMSEK 592
           L+   EK
Sbjct: 566 LEDAEEK 572

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/546 (58%), Positives = 414/546 (75%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           KD GV NIE+YA QY +   R  LFFSLFL+AYAY LDG +R   +A AT SY  HSLLS
Sbjct: 35  KDVGVKNIEVYAAQYDHVAYRVALFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLS 94

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
           TVNCIKTV+AA G + +ARASD+FGR+ +L +SI+  ++GT++E Q+  V++F  G C Y
Sbjct: 95  TVNCIKTVMAAGGMVAYARASDMFGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLY 154

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMW 225
           QLG  G  LI+++IA DFSNLNWR++AL++PALP IINTW+SGDV +A+  +W+WGIGMW
Sbjct: 155 QLGKAGLALILQVIAVDFSNLNWRMVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMW 214

Query: 226 AFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLL 285
           AFI PL+CIPL CC++HMRYLAHK+A ++L     +    S  EY I+VFFWRLD +GL+
Sbjct: 215 AFIIPLSCIPLFCCLVHMRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLI 274

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           L+V   GCVL+PFTLAGG+ ++WRTA IIVPEVIGWCVALPL++LWE KF+R PLTP  +
Sbjct: 275 LVVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSV 334

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           LKDRGV +AL+IAF I+FC YMQ DYMYTVL++AVHESVKAA RIT+L++FVS+ITGT+L
Sbjct: 335 LKDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLL 394

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           G  +V ++RTK FILFG+C WF++FGLL+H+RGD  +H+GIIG+LCLLGF  GFF     
Sbjct: 395 GFVIVYVKRTKKFILFGVCVWFVAFGLLVHFRGDESSHSGIIGALCLLGFGGGFFNYSAQ 454

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                   +H  +AV+T+LYLACYNI            WTNVLP  +++ I+ + +A  A
Sbjct: 455 VSMQASTAAHQDLAVVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLA 514

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           Y SPF FII Y W T +R AVV AY++ Q+ILCI+ L FCV LL+AA +LRD KL +VVA
Sbjct: 515 YSSPFKFIIKYKWGTPQRVAVVHAYQKVQRILCIVPLCFCVTLLIAAFLLRDKKLSEVVA 574

Query: 586 LDQMSE 591
           L ++  
Sbjct: 575 LGELEH 580

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/590 (53%), Positives = 429/590 (72%), Gaps = 3/590 (0%)

Query: 4   VSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKD-AGVNNIEIYAEQYQN 62
           ++  D++I    T  H+++ S      S T NS++   E  +++ AGV N E+YA+ Y +
Sbjct: 2   ITDKDENIKQNET-IHSEEFSSNITVSSITTNSLNGEKEPHLEESAGVYNSEVYAKYYSS 60

Query: 63  PFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWF 122
           P  R+++F  LF + YAYGLD  +R  +Q LATSSY +HSLLSTVN IK+VI+AAGQIWF
Sbjct: 61  PTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVISAAGQIWF 120

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
           ARASD+FGR TIL V+++FY++GT++ESQA +V++F AG C +QLGY G +++++I+ +D
Sbjct: 121 ARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVMMVQILVSD 180

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
           FSNLNWR+ A+  P LP +INTW+SGD+ +AV+ NWKWGIGMWAFIFPL+CIP    +LH
Sbjct: 181 FSNLNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFIFPLSCIPFGILLLH 240

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAG 302
           M+YLA KN  D L  SF  P+D++ K+Y  ++F W+LD IGLLL V FFG VL+PFTLAG
Sbjct: 241 MKYLARKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAVAFFGLVLVPFTLAG 299

Query: 303 GMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLIN 362
           G+ ++W+TA IIVPEV+GW VA P ++ WEIKF+++PLTPW+ +KDRGV+SALIIA  + 
Sbjct: 300 GLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSALIIAIFLQ 359

Query: 363 FCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFG 422
             +YMQ  YMYT+L+VAV+++ K+ATRI SL++FV+ ++GT+LGL +VK+RRTK FI FG
Sbjct: 360 TAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRTKEFIFFG 419

Query: 423 ICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVIT 482
           I  WF+SFGLL  Y G + A+AGII +LCLLGF  GF              +H  MA+IT
Sbjct: 420 IAVWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASMQASALTHEMMAIIT 479

Query: 483 ALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAE 542
           +L++A   I            WTNVLPD+I +G++N TLA  AY SP  FI+ Y WE+ E
Sbjct: 480 SLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNSPTKFILQYNWESPE 539

Query: 543 RQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEK 592
           RQ VV AY+  +KIL I+GL F VPLL  A +LR+ +LED VALD++  K
Sbjct: 540 RQIVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVALDKVEPK 589

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/589 (53%), Positives = 419/589 (71%), Gaps = 6/589 (1%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINS--VSSLSEESVKDAGVNNIEIYAEQYQNPFLRAML 69
           HN   Q    +    +E  S+T  S  +SS S+      GV+N+EIYA+ Y  P  R ++
Sbjct: 7   HN---QKENTEFEYSEELPSSTSESDHISSHSDAESDKFGVHNVEIYAKYYSTPVKRFLI 63

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
           FFSLF +AYAYGLD ++R T+Q LATSSY++HSLLSTV+CIK VI+AA QIWFAR++D+F
Sbjct: 64  FFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSADMF 123

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GR TIL +SI+FY++GTV+ESQA +V++F AG C Y +G++  +L  E+   DFSNLNWR
Sbjct: 124 GRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVGHSAIVLFSEVYVADFSNLNWR 183

Query: 190 LLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHK 249
           + A   P LP +INTWISGD+TAA++ NWKWGIGMWAFIFPL+CIP+  C+LHM+YLA K
Sbjct: 184 VTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFIFPLSCIPMGACILHMKYLAKK 243

Query: 250 NAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWR 309
           N KD L  +F  P+  +  +Y +DVFFW+LD++GLLL+V  FG +LIPFTLAGG ++ W 
Sbjct: 244 N-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLVAIFGMILIPFTLAGGEEKVWS 302

Query: 310 TAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQG 369
           TA IIVPEV+GW  ALPL+++WEIKF+R+PLTP + LK+RG+ SAL++   + F + MQ 
Sbjct: 303 TARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQMQS 362

Query: 370 DYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFIS 429
            Y+YTVL+VAV ES K+ATRI  L+SFVSVITG + G  + K+RRTK FI FGI  WFIS
Sbjct: 363 TYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGVWFIS 422

Query: 430 FGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACY 489
           FGL+I Y G   +H GII + C+LGF  GF              SH  MAV+T+L+LA  
Sbjct: 423 FGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASIQASAYSHEMMAVMTSLFLAVS 482

Query: 490 NIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKA 549
           +I            WTNVLP +IS GI+N+TLA  AYGSP  FI+ Y W+T ERQAVV+A
Sbjct: 483 SIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGSPTKFILKYKWDTPERQAVVEA 542

Query: 550 YRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDD 598
           Y+   ++L I+G+   VPLL++A  L++ +LEDVV+ D+  +   E+ +
Sbjct: 543 YKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDKFDKMNSENAE 591

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/554 (54%), Positives = 392/554 (70%), Gaps = 1/554 (0%)

Query: 38  SSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSS 97
           +S SE  V   GV+N +IY + Y  P+ R M+FFSLFL+ YAYGLD   R T+  LATSS
Sbjct: 37  TSDSENEVLSPGVHNAKIYGKYYTEPYQRIMIFFSLFLICYAYGLDKKTRTTYVTLATSS 96

Query: 98  YSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVAR 157
           Y EHSL+STV CI  VI+AAGQIWFARASDIFGR  I G+S+IFY+IGTVIESQAT ++R
Sbjct: 97  YKEHSLMSTVTCITKVISAAGQIWFARASDIFGRKLIFGLSVIFYVIGTVIESQATEISR 156

Query: 158 FTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGN 217
           +  G C Y LG+ G +L  E+ A DFSNLNWR++A   P LP IINTW+SG++TA V+ N
Sbjct: 157 YAGGECLYGLGHAGIVLTTELYAADFSNLNWRVVAAAAPMLPNIINTWVSGNITADVDEN 216

Query: 218 WKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFW 277
           WKWGIGMWAFIFP++C+PL  C+LHMRY A KN  + L P F  P ++S KEY +DVFFW
Sbjct: 217 WKWGIGMWAFIFPISCLPLIGCLLHMRYKAQKN-NEELKPVFVKPSNMSYKEYLVDVFFW 275

Query: 278 RLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR 337
           + D+IGL+L+V  FG VL+P TLAGG+ ++W  A IIVPEV+GW +ALPLY+ WE KF++
Sbjct: 276 KSDIIGLILLVGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFAK 335

Query: 338 HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFV 397
           +P+   E ++D G++SAL I+  I+FC+YM   Y+ T L+VAV+ES K+ATRI SL +FV
Sbjct: 336 YPIIKLETVRDSGIWSALSISLFIDFCFYMHETYLVTFLLVAVNESKKSATRINSLSTFV 395

Query: 398 SVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCA 457
           +VITG  LGL +V++RRTK  I+FG   WF++ GL I Y G   +H+G+IG++CLLGF  
Sbjct: 396 TVITGFFLGLAIVRIRRTKISIVFGTLVWFVAHGLFIEYNGGLRSHSGLIGAICLLGFGN 455

Query: 458 GFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGIS 517
           GF              +H K+A++T+L+LA  +I            W+NVLP +I   IS
Sbjct: 456 GFIRFPVRASIQVSVGTHEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNVLPGQIESRIS 515

Query: 518 NQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRD 577
           N T+AA AY SP TFI  Y W T  R AVV AY    KIL I GLV  +PLL++AL LRD
Sbjct: 516 NATIAASAYSSPTTFIKKYKWGTEYRTAVVSAYGYVWKILNITGLVLVLPLLISALFLRD 575

Query: 578 HKLEDVVALDQMSE 591
            KLE V+A D++++
Sbjct: 576 RKLESVLAFDEVTD 589

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/584 (50%), Positives = 410/584 (70%), Gaps = 8/584 (1%)

Query: 21  QDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAY 80
           +  +IK   +S++  S S++  E ++++GV+N EIY + Y +P  R M+F SLFL+A+AY
Sbjct: 30  KASAIKINELSSSAAS-STIGSEYIENSGVHNAEIYCKYYSHPIKRIMVFSSLFLIAFAY 88

Query: 81  GLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSII 140
           GLD ++R T+Q +ATSSYS+HSLLSTV CIK VI+AA Q+WFAR++D+FGR TIL +SII
Sbjct: 89  GLDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSADMFGRPTILTISII 148

Query: 141 FYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPF 200
           FY+IGT+IE +A +V+R+ AG C + LG+ G +L+ E+   DFSNLNWR+ A     LP 
Sbjct: 149 FYVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPN 208

Query: 201 IINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFT 260
           +I TWISG++T A++ NW+WGIGMWAFIFPL+C+PL  C++HMRYLA KN  + L   F 
Sbjct: 209 VITTWISGNITGAIDKNWEWGIGMWAFIFPLSCVPLIICIIHMRYLARKN-NENLKVVFQ 267

Query: 261 IPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIG 320
            P  ++ KEY ID+FFW+LD+IGL+L+V FF  +L+PFTLAG +   W++  IIVPEV+G
Sbjct: 268 KPNYMTWKEYCIDIFFWKLDIIGLILLVAFFSLILVPFTLAGSL--TWKSPKIIVPEVLG 325

Query: 321 WCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAV 380
           W +A+PLY++WE+K++R+PLTPW  +KDRG+++ LII     F +YMQ  YM TVL+VAV
Sbjct: 326 WVLAIPLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAV 385

Query: 381 HESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
            +S K+ATRI   YSFV V+T   LG  + K+RRTK FI  GI  WF++FGLL HY G  
Sbjct: 386 GQSKKSATRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIALGIGIWFVAFGLLEHYEGGL 445

Query: 441 GAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXX 500
           GA AGII ++C+LGF  GF              SHA M + T+L+ A  +I         
Sbjct: 446 GARAGIIAAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVA 505

Query: 501 XXXWTNVLPDRISRGISNQ-TLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCI 559
              W+NVLP  I++ I+N  TLA  AYGSP  FI  Y WET ERQAVV AY+  ++++ I
Sbjct: 506 GGIWSNVLPGEINKRITNNSTLATYAYGSPTKFIKQYGWETTERQAVVSAYKVVERLMAI 565

Query: 560 IGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE---DDDPI 600
           +GL   VP+L+A++ LR+ +LEDVV+ D++ E   E   DD+ +
Sbjct: 566 VGLCLLVPMLVASIFLRNRRLEDVVSFDKLDETFDEKSTDDEEV 609

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/581 (50%), Positives = 390/581 (67%), Gaps = 5/581 (0%)

Query: 23  DSIKKETVSATINSVSSLSEESVK-DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYG 81
            + K E     I+SVSS  E  +  D GV NIE+Y+E Y     R + FFS+FL  Y Y 
Sbjct: 14  KTTKDEIHEQEIDSVSSTEESQINYDTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYT 73

Query: 82  LDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIF 141
           LD  +R TFQ  ATSSY  HSL+STV CI TVI+AAGQI +ARA+DIFGR +++  +I F
Sbjct: 74  LDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGRTSLVFTAIFF 133

Query: 142 YIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFI 201
           Y+IGTV+ESQATN+ R+  G CFY LG+   +L +E++A DFSNLN+R+LA   P LP +
Sbjct: 134 YVIGTVVESQATNITRYAVGACFYSLGHAAIVLALEVLAADFSNLNYRILASAAPMLPNV 193

Query: 202 INTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSF-T 260
           INTWISG++T+ +  +W+WGIGMWA IFP+ CIPL  C+ HMRYLA      R + SF T
Sbjct: 194 INTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNRRELRSFST 253

Query: 261 IPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIG 320
           IP +++R EYFIDVFFWRLD++GLLL V FF CVLIPFTLA    ++W++A IIVPEVIG
Sbjct: 254 IPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEVIG 313

Query: 321 WCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAV 380
           W VALPLYI WE KF++ PLTPW L+KDRGVY  L+IA  ++F +Y+Q  Y YTVL+V+ 
Sbjct: 314 WLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLVSF 373

Query: 381 HESVKAATRITSLYSFVSVITGTILGLFLV-KLRRTKPFILFGICGWFISFGLLIHYRGD 439
             +V AATR  ++++FV VIT  +LG+F+  KLRRTK FI FGI  + +S GLL  YR  
Sbjct: 374 DTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYRIG 433

Query: 440 SGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXX 499
           + A  G I + CLLGF  GF              +H  +A+IT+L+LA  +I        
Sbjct: 434 AHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAIITSLFLALGSIGEGFGSSV 493

Query: 500 XXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCI 559
               W+N +   +S+ ISNQT  + AY SP  FI +Y WE+ ER  +V+AY     IL I
Sbjct: 494 AGAIWSNRMEVELSKYISNQTAVSLAYESPTKFIKSYKWESPERIGLVQAYSHVTNILYI 553

Query: 560 IGLVFCVPLLMAALMLRDHKLEDVVALDQM--SEKVVEDDD 598
           + +  C+PL + AL+LRD +L DVVA +Q+   ++++++  
Sbjct: 554 VTICLCIPLYVFALLLRDRELADVVAFEQLDGQDEIIQEKK 594

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/577 (48%), Positives = 397/577 (68%), Gaps = 8/577 (1%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFF 71
            NL T+  T D+  K E++S     V + SE  V +   +N  IY + Y  P    +L+F
Sbjct: 8   ENLKTK--TFDEDAKIESIS-----VHTDSENIVTNIAAHNARIYVKYYSTPLRVTILYF 60

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           SLFL+AYAY L  ++R T+Q LATSSYS+HSLL+TV CI  VI+AAGQIW+ARASDIFGR
Sbjct: 61  SLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQCINQVISAAGQIWYARASDIFGR 120

Query: 132 LTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLL 191
             IL +SI+FY IGT+IESQAT+++++ AG C Y LGY G++L+ +++ +D+S L WRL+
Sbjct: 121 TPILILSILFYFIGTLIESQATDISKYAAGSCIYALGYAGSVLVTQVLVSDYSTLKWRLV 180

Query: 192 ALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNA 251
           +  +  LP IINTW+ G++T  V   W+WG GMWAFIFPLA IPL CC+ HM+YLA KN 
Sbjct: 181 SSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFIFPLASIPLLCCLAHMKYLAIKNK 240

Query: 252 KDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTA 311
           +D  + + + P+ +S   +  D+FFW+LDM+GL+L+V FF  +L+P TLA G+ E W +A
Sbjct: 241 EDVKL-TISKPRSISWARHLYDIFFWKLDMLGLILLVAFFALILVPLTLAKGLHEGWGSA 299

Query: 312 HIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDY 371
             IVPEV+GW +ALPL++ WE+KF+ +P+TP +L+KDRG+Y  + ++  + F + +   Y
Sbjct: 300 KFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKDRGIYGGIGVSLFLEFVYDIGSTY 359

Query: 372 MYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFG 431
           +YTVL+VAV+ES K+ATRITSL++FVSV+T   LG  +VK+RRTK FI+FGI  W+I++G
Sbjct: 360 LYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFVVVKVRRTKEFIIFGIAMWYIAYG 419

Query: 432 LLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNI 491
           L  HYRG + +HAGII ++C+ GF  GF             ++H ++A+ T+LYLA  +I
Sbjct: 420 LFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVSTQASAKTHDRLAIATSLYLAAGDI 479

Query: 492 XXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYR 551
                       WTN+LP +I   I N TLA  AY SP  FI T+ W++ ERQA+V AYR
Sbjct: 480 GMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYESPIKFIRTHKWDSPERQALVVAYR 539

Query: 552 ETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQ 588
             Q++L I+ L   +PLL+++  LR+  L D VA +Q
Sbjct: 540 YIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/576 (48%), Positives = 389/576 (67%), Gaps = 9/576 (1%)

Query: 21  QDDSIKKETVSATINSVSSLSEE--------SVKDAGVNNIEIYAEQYQNPFLRAMLFFS 72
           +D  I+ + +S    + S+ SEE        +V   GV N+EIYA+ Y NPF + +++FS
Sbjct: 22  EDYQIRNKILSDKDATESNASEEITTNKLKPAVSSTGVYNMEIYAKYYANPFQKFLIYFS 81

Query: 73  LFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRL 132
           LF++ YAYGLDGN+R T+Q LATSS++ HSL STV CI  V ++AGQIWFARASDIF R 
Sbjct: 82  LFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSRE 141

Query: 133 TILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLA 192
             + +SI+FY++GT+I SQAT+VA++  G C Y +G+ G +L+ EI   DFSNLNWR++A
Sbjct: 142 FSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVA 201

Query: 193 LFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAK 252
              P LP IINTW+SG++T+ +   W+WG+GMWA IFP +CIPL  C+ HMRY+A KN  
Sbjct: 202 ENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKN-N 260

Query: 253 DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAH 312
           +++   F  P +++ K+Y ID+F W+LD IGL+L+V  F  +L+PFT +GG+  +W +A+
Sbjct: 261 EKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSAN 320

Query: 313 IIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYM 372
            IVPEV+GW VALP++ +WE KFSR+P+   +L+ DRG+YSAL I+F I FC Y+   Y+
Sbjct: 321 FIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTYL 380

Query: 373 YTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGL 432
           YT L+VAV ++ K+ TRI SL SFV+VIT   LGLF+VK+RRT+ FI+ G   WF+ +GL
Sbjct: 381 YTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYGL 440

Query: 433 LIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIX 492
            +HY G  G+ +GII + CL GF  GF              SH  +A++TAL+LA  NI 
Sbjct: 441 YVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLAIGNIG 500

Query: 493 XXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRE 552
                      W+N+LP R+ + I N TLA  A+ SP  FI  Y W TA RQ +V +Y  
Sbjct: 501 TAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLVSSYGS 560

Query: 553 TQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQ 588
             +IL I+ LV  +P+L+++ +LRD KL + VA DQ
Sbjct: 561 VWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQ 596

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/602 (48%), Positives = 403/602 (66%), Gaps = 9/602 (1%)

Query: 5   STTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEES--------VKDAGVNNIEIY 56
           + T  DI +L       D      T  +  N   +   ES        +K +GV NIE+Y
Sbjct: 9   TATPVDISDLEEGLKALDSGKDGHTSDSNSNVPDAYEHESDCVGDKKYIKGSGVINIELY 68

Query: 57  AEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAA 116
            +QY  P  + ML+FS+FLVAY Y LD  +R+T+Q   TS + + + L TVNCIKTV+  
Sbjct: 69  KQQYHKPIYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNCIKTVMGT 128

Query: 117 AGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLII 176
           AGQ  FAR SDIFGR T+L  SII YIIGT+I+ +AT++++F+AG   YQLG  G  +++
Sbjct: 129 AGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLGLIGIQIML 188

Query: 177 EIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPL 236
            +IA+DFS+LNWRL A F+PALPF+IN WI G +T  +   W+WGIGM+AFI P ACIPL
Sbjct: 189 GVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFIMPCACIPL 248

Query: 237 ACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLI 296
           A C+LHMRYLA+KN + ++   F + + ++ ++Y +D+FFWRLD++G  L+   FGC+LI
Sbjct: 249 AFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLCALFGCILI 308

Query: 297 PFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALI 356
           P  LAGG    WR   IIVPEV+GW V LP+++ WE K ++HPL  W+ ++DRG+ +ALI
Sbjct: 309 PLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDRGILAALI 368

Query: 357 IAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTK 416
           IAF INF +++ GDY++TVL++ + +SV A+TRITS YSFV +I GT++GL +++ RRTK
Sbjct: 369 IAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLVIIRARRTK 428

Query: 417 PFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHA 476
           PFI+FGI  WF++ GLL+H+ G+     G+ GSLCLLG  AGFF            ++HA
Sbjct: 429 PFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASIQAAIKTHA 488

Query: 477 KMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITY 536
           KMAV+TALYL+ Y+I            WTN+LP +I R + N + A  AY SP  FI+  
Sbjct: 489 KMAVVTALYLSIYSIGSAVGSAISGAIWTNLLPRKIFRTM-NHSDATAAYDSPQLFILNN 547

Query: 537 TWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVED 596
            W +  R  + +AY   QK+LC++ L FCVPLL AAL LR+HKL+  VAL+ + EK V++
Sbjct: 548 PWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALENVDEKQVKE 607

Query: 597 DD 598
           D+
Sbjct: 608 DE 609

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/599 (47%), Positives = 389/599 (64%), Gaps = 11/599 (1%)

Query: 13  NLSTQAHTQDDSIKKETV-----SATINSVSSLSEES-----VKDAGVNNIEIYAEQYQN 62
           +  +   T+++++ KET      +A  N  S  + E      V DAGV NIEIYAE Y +
Sbjct: 3   DFQSSITTKEEAVAKETTVVSHDAAAKNDFSIETREDGDDAIVYDAGVRNIEIYAEYYTS 62

Query: 63  PFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWF 122
            F R M FF LFLVAYAYGLD  +R TF   ATSSY +H+L+STV CIKT+I+AAGQI F
Sbjct: 63  KFSRFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMSTVTCIKTIISAAGQIGF 122

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
           AR+ DIFGR +I   SII Y +GT++ESQAT ++++  G   Y LG++G +L+ E++  D
Sbjct: 123 ARSCDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYSLGHSGIVLVSEVLIAD 182

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
           FSNLNWR++A   P LP +INTWISG++ A +  +WKWGIG+WA +FP+ CIPL   +LH
Sbjct: 183 FSNLNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWAIVFPVCCIPLLFILLH 242

Query: 243 MRYLA-HKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLA 301
           M+YLA +K+ +  L   +T+PK +++ +Y I+  FWR+D++GL+L+   FG +LIPFTLA
Sbjct: 243 MKYLAQYKDKRPELKRIWTLPKGMTKVQYLIETLFWRVDVVGLILLAATFGLILIPFTLA 302

Query: 302 GGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLI 361
                QW+ A  IVPEV+GW V+LPLY +WE  F+R PLTP   +KDRG+Y AL+++  I
Sbjct: 303 EKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLATVKDRGIYGALLVSLFI 362

Query: 362 NFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILF 421
           +F +YMQ  Y+YTVL VA + +  AATRI +LYSFV VIT   LG  +V+L++ K FILF
Sbjct: 363 DFVYYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFLGFVVVRLKKVKKFILF 422

Query: 422 GICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVI 481
           GI  W I++GL I YR    ++ G I ++C+LGF  GF              SH KMAVI
Sbjct: 423 GIAVWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPARASIQASVGSHQKMAVI 482

Query: 482 TALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETA 541
           T+L+LA  +I            W N +   I + +SN T AA AY SP  F+  Y W TA
Sbjct: 483 TSLFLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALAYDSPTKFVKKYKWGTA 542

Query: 542 ERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPI 600
            R  VV AYRE   IL ++G+  CVPLL+ + +LRD KLE+V++ D M       D+ I
Sbjct: 543 TRMEVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVISYDMMGSNSESKDEII 601

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/618 (44%), Positives = 386/618 (62%), Gaps = 26/618 (4%)

Query: 11  IHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNI-----EIYAEQYQNPFL 65
           +  +ST     D+ + ++T            E+     GV NI     EI AE Y   + 
Sbjct: 43  VDQISTAQSEMDEKMAEQT------------EQQRTMTGVKNIIIRKTEIMAEVYDKWYY 90

Query: 66  RAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARA 125
            A+L F+ F+  Y YGLDGN RY +   ATSSY++HSLLST+N I  VI+AA QI +AR 
Sbjct: 91  HAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARL 150

Query: 126 SDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSN 185
           SD++GR  +  VSI+ Y +GT+I+SQA +V R+ AG  FY  GY G +L++ +I +DFS+
Sbjct: 151 SDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSS 210

Query: 186 LNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHM 243
           L WRL+  F+P  PFIINTWISG+VT+  N   NW W IGMWAFIFPL+C+PL C M+HM
Sbjct: 211 LRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPLLCVMIHM 270

Query: 244 RYLAHKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAG 302
            +LA K  +   L    T  +    K+  +++ FW++D +G+ ++    GC+L+P TLAG
Sbjct: 271 WWLARKTEEWQELSKEKTFYQKHGLKDTIVEL-FWKIDAMGVFIMTISLGCILVPLTLAG 329

Query: 303 GMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLIN 362
           G K +W  +H+I P V+G+ V +P+ +LWE KF+R P+ P++L+KDRGV+++  I+FLI+
Sbjct: 330 GTKSKWNNSHVIGPFVLGF-VLIPILVLWEYKFARDPIIPYKLVKDRGVWASFAISFLID 388

Query: 363 FCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFG 422
           F +YM  DY+YTVLIV V+ESVK+ATRI+SL +FVS +   I  L + +  R KPFI+ G
Sbjct: 389 FIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTVGSPIFSLLITRFSRLKPFIICG 448

Query: 423 ICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVIT 482
              W ++ GLL HYRG + +H+GIIG+LC+ G     F             SH  MA +T
Sbjct: 449 CGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVSVQAAT-SHEHMATVT 507

Query: 483 ALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAE 542
           AL    Y I            WT  L  ++ + + +  LA EAY SP+ FI+TYTW+T E
Sbjct: 508 ALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAALATEAYASPYKFIVTYTWDTPE 567

Query: 543 RQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VEDDDP 599
           RQAVV+AYR  Q++  I+ LVFC PLL+ +L LRD +L D VA D ++E      +DDDP
Sbjct: 568 RQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARLTDKVAHDNIAEGEYVDAKDDDP 627

Query: 600 IFAFLKKCIPFYNKKNGE 617
           I+ + K     + +K+ E
Sbjct: 628 IYEWFKGATTRFRRKSKE 645

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 263/601 (43%), Positives = 381/601 (63%), Gaps = 11/601 (1%)

Query: 5   STTDQDIHNLSTQA--HTQDDSIKKETVSATINSV-----SSLSEESVKDAGVNNIEIYA 57
           + TD  + ++S+ +  H   D  K +  +   +S+     S   EE  K  GV  +EI  
Sbjct: 6   NETDSPLESVSSNSNSHIGTDVEKYQYSNTHGDSIPDNYDSHFEEEEEKSYGVQKVEILN 65

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
           +QY + + ++ +FFSLFL+ + + LD  +R +  A AT+SY +HSLLSTVN +++V AA 
Sbjct: 66  KQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAAC 125

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
           G   ++R SD+FGR+ ++ VS++ Y+ GT+I +QA +V R+ AG   YQ G  G  ++ +
Sbjct: 126 GLPLYSRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFK 185

Query: 178 IIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKW-GIGMWAFIFPLACIPL 236
           +IA DFSNLNWR+    I A PFIINTW+SGD+  A+  NW W GIG+WA   P+A IPL
Sbjct: 186 VIAADFSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPL 245

Query: 237 ACCMLHMRYLAHKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVL 295
             C +HM+YLA K+   ++L    T  K +  K++ ++VFFW+LD+ G+L ++   G +L
Sbjct: 246 VLCFIHMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLIL 305

Query: 296 IPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSAL 355
            P TLAGG   +WRTA +IVP ++G+C  +P++  WE + + HP+ P ++ +DRGVY AL
Sbjct: 306 TPLTLAGGETAEWRTAKVIVPLILGFC-WIPVFAFWENRIATHPIAPTDMFRDRGVYCAL 364

Query: 356 IIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
            I  LI+FCWYMQGDY+YT+L+VA+HESVK+ATRI SLYSF ++ITG  +GL + K+R+ 
Sbjct: 365 GIGILIDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVGLAISKVRKM 424

Query: 416 KPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSH 475
           K FI+FG+C W ++FG++I YRG S +H G+I S  LLGF   FF             +H
Sbjct: 425 KCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYV-NH 483

Query: 476 AKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIIT 535
            +MA IT LY   Y I            WT VLP+ I +  +N+TLA  AY +P +FI  
Sbjct: 484 ERMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAYSAPLSFIKK 543

Query: 536 YTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE 595
           YTW T  R  +V+AYR  QK+L I+G+ FCVP+L  AL LRD  L     +    +K V+
Sbjct: 544 YTWGTPLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLRDPVLISAQNIVDAEDKEVK 603

Query: 596 D 596
           +
Sbjct: 604 E 604

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  523 bits (1347), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 253/579 (43%), Positives = 374/579 (64%), Gaps = 9/579 (1%)

Query: 21  QDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAY 80
           +++ + + + S   + V    E+   + GV NIEIY+E Y  P  R +LF S+FLV Y+Y
Sbjct: 13  EENKVNETSYSLEAHDVP---EDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSY 69

Query: 81  GLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSII 140
            LD  +R TF+  AT+S+SEHSL+S VNC   +++A G+++FAR++DIFGR +I  + ++
Sbjct: 70  SLDSTLRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLV 129

Query: 141 FYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPF 200
           FY++GT+I + +  +++F AG C Y  G +G  ++++++ +DFS+LNWRL+A  IP LP 
Sbjct: 130 FYVVGTIIVATSKGISQFAAGYCIYSFGESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPN 189

Query: 201 IINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFT 260
           +IN W SG + +  + NW+WGIGM+A I P+ACIPLA C+ HMRY+A KN K+ L   + 
Sbjct: 190 VINAWASGTIVSDFSDNWQWGIGMFAIIVPVACIPLAVCLFHMRYMAKKNKKNELKRPWH 249

Query: 261 IPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIG 320
              ++S  ++  +  FWRLD++GL+ +    GC+L+PFTL     ++W  A  IVPEVIG
Sbjct: 250 SNNELSWAQFIRETLFWRLDLVGLITLGASLGCILVPFTLTKKAGKKWAKASTIVPEVIG 309

Query: 321 WCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAV 380
           W V LPLYI+WE  ++++PLTP  L++DRGVY+AL+  FL  F + M+ +YM TVL VA 
Sbjct: 310 WAVGLPLYIVWEKFYAKYPLTPLRLIRDRGVYAALVAVFLYEFIYVMEANYMVTVLQVAF 369

Query: 381 HESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           + +  AATRI + Y FVSV+T  ILG F+V +R+TK  ILFG   +F+S+GL I YRG  
Sbjct: 370 NNTSAAATRINNSYEFVSVLTAFILGFFVVFIRKTKRLILFGGTLFFVSYGLFIRYRGGH 429

Query: 441 GAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXX 500
           G +AG I +LC+ GF  GF              SH +MA+ITAL+ A  ++         
Sbjct: 430 GCYAGSIAALCVFGFANGFIKYPTRTSLQASAGSHKRMAMITALFTAIGSVGKAMAAAIA 489

Query: 501 XXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCII 560
              W+ ++P  +S  ISN  +AA+AY SP T I TY W +  R  +++AYR   K+L I+
Sbjct: 490 GAIWSGLMPGALSSRISNSKVAAKAYSSPLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIV 549

Query: 561 GLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDP 599
            +  CVPLL+A+ +LRD +LE+ VA D       + DDP
Sbjct: 550 AICLCVPLLIASFLLRDRRLENKVAYDS------DSDDP 582

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  523 bits (1348), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 274/624 (43%), Positives = 385/624 (61%), Gaps = 31/624 (4%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINSVSSLSEE-----SVKDAGVNNIEIYAEQYQNPFLR 66
           H L +  H    S   ++ S   +S+  LS +       K   +   EI  E Y+  + +
Sbjct: 23  HELKSDGHVNTTS---DSDSHAFDSIPQLSGKYDALRQNKSLVIKQTEIIGEAYKKWYFQ 79

Query: 67  AMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARAS 126
           A+L  S F+  Y YGLDGNIRY +   ATSSYSEHSLLST+N I  V++AA QI +AR S
Sbjct: 80  AILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLS 139

Query: 127 DIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNL 186
           D+FGRL +   ++I Y++GT+I+SQA +V R+ AG  FY  GY G +LI+ II +DFS+L
Sbjct: 140 DVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVILILLIILSDFSSL 199

Query: 187 NWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMR 244
            WRLL  F P  PFIINTWI+G++T+  N   NW W IGMWAFIFPL+CIP+  CMLHM+
Sbjct: 200 KWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIFPLSCIPIVLCMLHMQ 259

Query: 245 YLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRLDMIGLLLIVCFFGCVLI 296
           ++A K       P +   KD   K Y+        ++  FW+LD+IG+LL+ C  GC+L+
Sbjct: 260 WIARKT------PEWHALKD--EKSYYQEHGFVKVLEQLFWKLDVIGVLLMGCSLGCILV 311

Query: 297 PFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALI 356
           P TLAGG+K  W  + +I P V+G+ V +P+  +WE + +R P+ P++L+KDRGV+S++ 
Sbjct: 312 PLTLAGGVKTTWNDSRLIGPFVLGF-VLIPILWVWEYRVARDPIIPYKLVKDRGVWSSMG 370

Query: 357 IAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTK 416
           I+FLI+F +YM  DY+YTV++VAV+ES+K+ATRI++L SFVSV+     GL + +  R K
Sbjct: 371 ISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASPFFGLIMTRCTRLK 430

Query: 417 PFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHA 476
           PFI+FG C W ++ GLL  YRG   +H+GIIG+LC+ G     F             SH 
Sbjct: 431 PFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQSAV-SHE 489

Query: 477 KMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITY 536
            +A +TAL    Y I            WT  L  +I + + + TLA  AY SP+TFI TY
Sbjct: 490 NLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLATAAYTSPYTFIETY 549

Query: 537 TWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV--- 593
           TW T +R A+V AY+  Q++  I+ LVFC PL+  +L LRD KL D VA++ + E     
Sbjct: 550 TWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDTVAVENIEEGEYVD 609

Query: 594 VEDDDPIFAFLKKCIPFYNKKNGE 617
            +D+DPI  + KK    ++    E
Sbjct: 610 TKDNDPILDWFKKFTSKFSSSKKE 633

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  522 bits (1344), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 271/611 (44%), Positives = 386/611 (63%), Gaps = 11/611 (1%)

Query: 12  HNLSTQAHTQDDS-IKKETVSATINSVSSLSEESVKDA-GVNNIEIYAEQYQNPFLRAML 69
           +N +T+     +S + KE   A  +S +   E   K    +   E+ ++ Y   +L+A+L
Sbjct: 23  NNSATETSDGTNSFVNKEQYEAHQDSTTDEHETGKKKTLTIRKTELLSKSYDKWYLQAIL 82

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
            FS F+  Y YGLDGNIRY +   ATSSYSEHSLLST+N I  V++AA QI +AR SDI+
Sbjct: 83  LFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIVYARLSDIY 142

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GR+++L V+I+ Y +GT+I+ QA +V R+ AG  FY  GY G +LI+ +I +DFS+L WR
Sbjct: 143 GRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVILILLLILSDFSSLRWR 202

Query: 190 LLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLA 247
           L   F+P  PFIINTWISG++T   N   +W W IGMWAFIFPL+C+P+ CCM+HM +  
Sbjct: 203 LFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPLSCVPILCCMIHMHWRV 262

Query: 248 HKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQ 307
             + + + +        +   +  +   FW+LD++G+LL+V   GC+L+P TLAGG+  +
Sbjct: 263 RNDPEWKELQGEKTYFQIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSK 322

Query: 308 WRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYM 367
           W  ++II P V+G+ V +P++  WE +++ +PL P++L+KDRGV++AL I+FLI+F +YM
Sbjct: 323 WNHSNIIGPFVLGF-VLIPIFSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYM 381

Query: 368 QGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWF 427
             DY+YTVLIVAVHESVK+ATRI+SL SFVS +   I+ L L ++ R KP I+ G   W 
Sbjct: 382 AVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPIVALALTRVTRMKPVIIVGCSLWL 441

Query: 428 ISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLA 487
           ++ GLL H+RG   +H+GIIG+LC+ G     F             +H  MA +TAL   
Sbjct: 442 LAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQAAT-NHDNMATVTALNYT 500

Query: 488 CYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVV 547
            Y I            WT  L  ++ + I N  LA +AY SP+TFI TYTW T ER+A+V
Sbjct: 501 LYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSELATKAYASPYTFITTYTWGTPEREAMV 560

Query: 548 KAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSE-KVVE--DDDPIFAFL 604
           +AYR  Q++  I+ +VFC PL+M +L LRD KL D VA + +SE + +E    DPI  F 
Sbjct: 561 QAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKLTDEVAHEDISEGEYIEKASGDPIGEFF 620

Query: 605 KKCIPFYNKKN 615
            K   F   KN
Sbjct: 621 AKL--FKKTKN 629

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  515 bits (1327), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 269/598 (44%), Positives = 368/598 (61%), Gaps = 13/598 (2%)

Query: 26  KKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGN 85
           +K   S  I+ + S  E++     +   EI    Y   +   +L FS F+  Y YGLDGN
Sbjct: 72  EKYLASENIDEIPSDGEKTSTSRIIRETEIMKSVYDKWYYHVILLFSAFVCGYGYGLDGN 131

Query: 86  IRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIG 145
           IRY +   ATSSY+EHSLLST+N I  V +AA QI +ARASD+FGRL++  VS++FY +G
Sbjct: 132 IRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVYARASDVFGRLSLFIVSVVFYAVG 191

Query: 146 TVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTW 205
           T+I+ QA +V R+ AG  FY +GY G +L++ +I +DFS+L WRL   F P  P+IINTW
Sbjct: 192 TIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSDFSSLKWRLFYQFAPTWPYIINTW 251

Query: 206 ISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPK 263
           ISG++T+A N   +W W IGMWAFIFPL+ IP+  C++HMR++A K  + +L+      K
Sbjct: 252 ISGNITSAANPLKHWSWDIGMWAFIFPLSSIPIILCLIHMRWMASKTKEWKLLKQ---EK 308

Query: 264 DVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIG 320
              ++  F+      FWRLD+IG+LL+    GC+L+P TLAGG   +W   +II P  +G
Sbjct: 309 SYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTLAGGTSSKWNHGNIIAPFALG 368

Query: 321 WCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAV 380
           + V +P++  WE KFS+ PL P +L+KDR V+S++ I+FLI+F +YM  DY+YTVLIV V
Sbjct: 369 F-VLIPIFTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFLIDFIFYMAVDYLYTVLIVGV 427

Query: 381 HESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           +ESVK+ATRI+SL SFVS +   I  L + +  R KPFI+ G   W +S GLL HYRG +
Sbjct: 428 NESVKSATRISSLSSFVSTVGSPIFALLITRFTRLKPFIVAGCALWMLSMGLLYHYRGGA 487

Query: 441 GAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXX 500
            +H GII SLC+ G     F             SHA MA +TAL    Y I         
Sbjct: 488 SSHNGIIASLCVWGVGTTLFTYPINVSVQAAV-SHADMATVTALNYTMYRIGSAVGAAVS 546

Query: 501 XXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCII 560
              WT  L  ++ + + + TLA  AY SP++FI+ YTW T  R  +V+AYR  Q++  I+
Sbjct: 547 GAIWTQTLYKQLHKRMGDATLATAAYSSPYSFIVNYTWGTTVRDQMVEAYRYVQRLETIV 606

Query: 561 GLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VEDDDPIFAFLKKCIPFYNKKN 615
            LVF VPLL+ +L LRD +L D VA D + E       D DPI  FL K      KKN
Sbjct: 607 ALVFTVPLLLFSLTLRDARLTDNVASDDIEEGQHINKTDSDPIADFLSKPFKGLFKKN 664

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  512 bits (1319), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 270/642 (42%), Positives = 388/642 (60%), Gaps = 42/642 (6%)

Query: 18  AHTQDDSIKKETVSATINSVSSLSEESVK----DAGVNNI------------EIYAEQYQ 61
           + +  + I ++  +A ++S  S  EE +     D  + N+            EI +  Y 
Sbjct: 3   SRSSSEIIVEKNTAAIVSSKKSSDEEPMDYNEVDEELQNVLQTNKSIVIKKAEIISASYA 62

Query: 62  NPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIW 121
             + + +  F  FL  Y YGLD NIRY +   ATSSYSEHSLLSTV  I  V++AA QI 
Sbjct: 63  KWYEKLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIV 122

Query: 122 FARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIAT 181
           +AR SD FGR  +  V+I+ Y +GT+I+ QA +V R+ AG  FY  GY G +L++ +I +
Sbjct: 123 YARLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILS 182

Query: 182 DFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACC 239
           D S L WRL   F+P  P+IINTWISG++T+A N   NW W +GMWAFIFPL+C+P+  C
Sbjct: 183 DMSTLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPILAC 242

Query: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRLDMIGLLLIVCFF 291
           M+HM++ A K  + + +         ++K Y+        +   FW++D+IG+LL+    
Sbjct: 243 MIHMQWRARKTQEWKDLK--------TQKTYYQQHGLMKSLVSLFWKIDIIGVLLMAASL 294

Query: 292 GCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGV 351
           GC+L+P TLAGG   +WR + II   V+G+ V +P++ +WE KF+  P+ P++L+KDRGV
Sbjct: 295 GCILVPLTLAGGTSSKWRDSRIIGVFVLGF-VLIPIFFIWEKKFATDPIVPYKLVKDRGV 353

Query: 352 YSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVK 411
           +++L I+FLI+F +YM  DY+YTVLIVAV+ESV AATRI+SLYSFVS +    + L L +
Sbjct: 354 WASLGISFLIDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTR 413

Query: 412 LRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXX 471
             R KPFI+FG C WF++ GLL H+RG + +H+GIIG LC+ G  + FF           
Sbjct: 414 FTRLKPFIIFGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQAA 473

Query: 472 XRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFT 531
             SH +MA ++AL    Y I            WT  L  ++   + + TLA  AYGSP+T
Sbjct: 474 V-SHEQMATVSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYGSPYT 532

Query: 532 FIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSE 591
           FI+TYTW T ER+A+V+AYR  Q++  ++ LVFCVPL+  +L LRD +L D VA D MS 
Sbjct: 533 FIVTYTWGTPEREAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAHDDMSS 592

Query: 592 KVVED---DDPIFAFLKKCIPFYNKKNGETSTVTTSTDGNDV 630
               D   DDP+  F    +  + +  G+    T S + + V
Sbjct: 593 GEFIDTKSDDPLAEFF---VGLWRRVTGKKENKTQSDEKSSV 631

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  509 bits (1312), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/605 (43%), Positives = 375/605 (61%), Gaps = 20/605 (3%)

Query: 12  HNLSTQAH--TQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAML 69
           H L+ + H  +  DS     +S   N++        +   +   EI    Y   +L+A+L
Sbjct: 23  HELNPETHNDSNSDSYGLPQLSEKYNAL-----RQNRSLIIQQTEIIGSAYNKWYLQAIL 77

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
             S F+  Y YGLDGNIRY +   ATSSYSEHSLLST+N I  V++AA QI +AR SD+F
Sbjct: 78  LLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVF 137

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GRL +   ++I Y++GT+I+SQA +V R+ AG  FY  GY G +LI+ II +DFS+L WR
Sbjct: 138 GRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWR 197

Query: 190 LLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHMRYLA 247
           LL  F+P  PFIINTWI+G++T+  N   NW W +GMWAFIFPL+C+P+  CMLHM++ A
Sbjct: 198 LLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCVPIVLCMLHMQWRA 257

Query: 248 HKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPFTLAGGM 304
            K  +   +      K   ++  FI +    FW LD++G+LL+ C  GC+L+P TLAGG+
Sbjct: 258 RKTPEWHALKG---QKSYYQEHGFIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGV 314

Query: 305 KEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFC 364
           K  W  + +I P V+G+ V +P+  +WE +F+R P+ P+ L+KDR V+S++ I+FLI+F 
Sbjct: 315 KTTWNDSRLIGPFVLGF-VLIPILWIWEYRFARDPILPYRLVKDRAVWSSMGISFLIDFI 373

Query: 365 WYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGIC 424
           +YM  DY+YTV+IVAV+ESVK+ATRI +L SFVS +      L + +  R KPFI+FG  
Sbjct: 374 YYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASPFFALLVTRCTRLKPFIMFGCA 433

Query: 425 GWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITAL 484
            W ++ GLL H+RG S +H+GIIG+LC+ G     F             SH  MA +TAL
Sbjct: 434 LWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYPVTVSVQSAV-SHENMATVTAL 492

Query: 485 YLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQ 544
               Y I            WT  L  +I + + +  LA  AY SP+TFI TYTW T +R 
Sbjct: 493 NYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALATTAYESPYTFIETYTWGTPQRN 552

Query: 545 AVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VEDDDPIF 601
           A++ AY+  Q++  I+ LVFCVPL+  +L LRD KL D VA++ + +      +D+DPI 
Sbjct: 553 ALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPKLTDTVAVEYIEDGEYVDTKDNDPIL 612

Query: 602 AFLKK 606
            + +K
Sbjct: 613 DWFEK 617

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  506 bits (1303), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 269/619 (43%), Positives = 382/619 (61%), Gaps = 29/619 (4%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINSVSSLSEE-----SVKDAGVNNIEIYAEQYQNPFLR 66
           H L+ + HT  +SI           +  LSE+       +   +   EI+   Y   +L+
Sbjct: 23  HELNAETHTGSNSIS--------FGLPQLSEKYDALRQNRSLIIQQTEIFGAAYNKWYLQ 74

Query: 67  AMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARAS 126
             L  S F+  Y YGLDGNIRY +   ATSSYSEHSLLST+N I  V++AA QI +AR S
Sbjct: 75  VFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLS 134

Query: 127 DIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNL 186
           D+FGRL +   ++I Y++GT+I+SQA +V R+ AG  FY  GY G +LI+ II +DFS+L
Sbjct: 135 DVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSL 194

Query: 187 NWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHMR 244
            WRLL  F P  PFIINTWI+G++T+  N   NW W +GMWAFIFPL+CIP+  CMLHM+
Sbjct: 195 KWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQ 254

Query: 245 YLAHKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPFTLA 301
           + A K  +   +      K   ++  FI +    FW LD+IG+LL+ C  GC+L+P TLA
Sbjct: 255 WRAKKTPEWHTLKG---QKSYYQEHGFIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLA 311

Query: 302 GGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLI 361
           GG+K  W  + +I P V+G+ V +P+  +WE +F+R P+ P++L+KDR V+S++ I+FLI
Sbjct: 312 GGVKTTWNDSRLIGPFVLGF-VLIPVLWIWEYRFARDPILPYKLVKDRAVWSSMGISFLI 370

Query: 362 NFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILF 421
           +F +YM  DY+YTV+IVAV+ESVK+ATRI++L SFVS +      L + +  R KPFI+F
Sbjct: 371 DFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASPFFALLVTRCTRLKPFIMF 430

Query: 422 GICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVI 481
           G   W ++ GLL H+RG S +H+GIIG+L + G     F             SH  MA +
Sbjct: 431 GCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYPVTVSVQSAV-SHENMATV 489

Query: 482 TALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETA 541
           TAL    Y I            WT  L  +I + + +  LA  AY SP+TFI TYTW T 
Sbjct: 490 TALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALATAAYDSPYTFIETYTWGTP 549

Query: 542 ERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VEDDD 598
           +R A++ AY+  Q++  I+ LVFCVPL+  +L LRD KL + VA++ + +      +D+D
Sbjct: 550 QRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNAVAVEYIEDGEYVDTKDND 609

Query: 599 PIFAFLKKCIP--FYNKKN 615
           PI  + +K IP  F +K++
Sbjct: 610 PILEWFEK-IPSKFTSKRD 627

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  506 bits (1302), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 263/620 (42%), Positives = 381/620 (61%), Gaps = 28/620 (4%)

Query: 12  HNLSTQAHTQDDS---IKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAM 68
             L+ +AHT   S    + +T+        +L +   +   +   EI    Y   +L+A+
Sbjct: 23  QELNPEAHTDSHSSSYARDDTLPQMSGKYDALRQN--RSLIIKQTEIIGTAYNKWYLQAI 80

Query: 69  LFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDI 128
           L FS F+  Y YGLDGNIRY +   ATSSYS+HSLLST+N I  V++AA QI +AR SD+
Sbjct: 81  LLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSDV 140

Query: 129 FGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNW 188
           FGRL +   ++I Y++GT+I+SQA +V R+ AG  FY  GY G +LI+ II +DFS+L W
Sbjct: 141 FGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKW 200

Query: 189 RLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHMRYL 246
           RLL  F P  PFIINTWI+G++T+  N   NW W +GMWAFIFPL+CIP+  CMLHM++ 
Sbjct: 201 RLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQWR 260

Query: 247 AHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRLDMIGLLLIVCFFGCVLIPF 298
           A K  + + +          +K Y+        ++  FW+LD+IG+LL+ C  GC+L+P 
Sbjct: 261 AGKTPEWQELK--------GQKSYYQEHGLMKILEQLFWKLDVIGVLLMGCSLGCILVPL 312

Query: 299 TLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIA 358
           TLAGG+K  W  + +I P V+G+ V +P+  +WE  ++R P+ P++L+KDRGV+S++ I+
Sbjct: 313 TLAGGVKTTWNDSRLIGPFVLGF-VLIPILWVWEYSYARDPILPYKLVKDRGVWSSMGIS 371

Query: 359 FLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPF 418
           FLI+F +YM  DY+YTV+IVAV+ES+K+ATRI++L SFVSV+     GL + +  R KPF
Sbjct: 372 FLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVVASPFFGLLMTRCTRLKPF 431

Query: 419 ILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKM 478
           I+ G   W ++ GLL  +RG S +H+GIIG+LC+ G     F             SH  +
Sbjct: 432 IMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTLFTYPVTVSVQSAV-SHENL 490

Query: 479 AVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTW 538
           A +TAL    Y I            WT  L  +I + + +  LAA AY SP+ FI TYTW
Sbjct: 491 ATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAASAYDSPYVFIETYTW 550

Query: 539 ETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VE 595
            T +R A++ AY+  Q++  I+ LVFCVPL+  +L LRD +L D VA++ + +      +
Sbjct: 551 GTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPRLTDTVAVENIKDGEYVDTK 610

Query: 596 DDDPIFAFLKKCIPFYNKKN 615
           D DPI  + +K    +  K 
Sbjct: 611 DSDPILEWFEKIPSKFTSKQ 630

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  503 bits (1294), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 276/634 (43%), Positives = 378/634 (59%), Gaps = 21/634 (3%)

Query: 1   MSSVSTTDQDIHNLST-----QAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEI 55
           MSS+S+ DQ +  LS        H      K    + T + ++  S    K   +   E+
Sbjct: 1   MSSISSGDQAMR-LSKIGPIENVHVVSSKEKDIETNETDDDITIRSPPPKKSLVIKQTEV 59

Query: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIA 115
            A  Y   +   +L  S F+  Y YGLDGNIRY +   ATSSY+EHSLLSTV  I  V++
Sbjct: 60  MASVYDKWYYHVVLLVSAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVS 119

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175
           AA QI ++R SD FGR  +  ++I+ Y++GT+I+SQA +V R+ AG  FY  GY G +LI
Sbjct: 120 AASQIVYSRLSDFFGRFILFVIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLI 179

Query: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLAC 233
           + +I +DFS+L WRL   F P  PFIINTWISG++T A N   +W W +GMWAFIFPL+C
Sbjct: 180 LLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITLAANPLVHWSWDVGMWAFIFPLSC 239

Query: 234 IPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGC 293
           IP+  CM+HM++ A K  + + +       +       +   FWRLD+IG+LL+V + GC
Sbjct: 240 IPMLLCMIHMQWKASKTEEWKELKKEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGC 299

Query: 294 VLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYS 353
           +L+P TLAGG+K +W    II P V+G+ V +P++  WE  F+R PL P+ L+KDRGV++
Sbjct: 300 ILVPLTLAGGVKSKWNDGRIIGPFVLGF-VLVPIFAAWEYFFARDPLIPYALIKDRGVWA 358

Query: 354 ALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLR 413
           ++ I+FLI+F +YM  DY+YTVLIVAVHESVK+ATRI+SL SFVS +      L L +  
Sbjct: 359 SMGISFLIDFIFYMASDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPFFALLLTRCS 418

Query: 414 RTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXR 473
           R KPFI+ G   W +S GLL H+RG   +H+GIIG+LC+ G     F             
Sbjct: 419 RLKPFIMVGCSLWMLSMGLLYHFRGGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQSAT- 477

Query: 474 SHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVL-PDRISR------GISNQTLAAEAY 526
           SH  MA +TA+   CY +            WT  L PD + R           T+A EAY
Sbjct: 478 SHENMATVTAINYTCYRLGSAIGAAVSGAIWTQKLYPDILKRVTEVVGATEAVTIATEAY 537

Query: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586
            SP+TFI  YTW T  R AVV++YR  Q++  I+ LVFCVPL++ +L LRD KL D +A 
Sbjct: 538 SSPYTFITKYTWGTPVRDAVVESYRYIQRLETIVALVFCVPLIIFSLCLRDAKLTDEIAH 597

Query: 587 DQMSEKVV---EDDDPIFAFLKKCIPFYNKKNGE 617
           + + E      ED D  F +LKK     +KK+ E
Sbjct: 598 ENIKEGEYVSKEDSDVFFDWLKKVFG-RSKKSDE 630

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  478 bits (1230), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 256/590 (43%), Positives = 365/590 (61%), Gaps = 14/590 (2%)

Query: 19  HTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAY 78
           HT  D+ +K+T +           +S K   +   EI A QY   F R++L FS FL  Y
Sbjct: 16  HTPSDN-EKQTYNELNEYGIPDKLKSTKSLVIRKTEILAAQYDTWFYRSILLFSAFLCGY 74

Query: 79  AYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVS 138
            YGLDG++RY +   AT+SY+EHSLLST+  I  VI+AA QI +AR +D+FGRL +   +
Sbjct: 75  GYGLDGSVRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYARLADVFGRLYLFITA 134

Query: 139 IIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPAL 198
           +IFY++GT+I+SQA +V R+ AG  FY  GY G +L++ +I +DFS+L WRL   F+P  
Sbjct: 135 VIFYVVGTIIQSQAYDVQRYAAGAVFYNTGYVGVVLVLLLILSDFSSLKWRLFYQFVPTW 194

Query: 199 PFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLM 256
           PFIINTWI+GD+T+  N   NW W I MWAFIFPL+ +P+ CCMLHMR  A K  + +++
Sbjct: 195 PFIINTWIAGDITSRANPQENWSWDISMWAFIFPLSALPIICCMLHMRIKARKTPEWQVL 254

Query: 257 PSFTIPKDVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHI 313
                 K   +   FI      FW+LD+IG+L++    GC+L+P TLAGG   +W+ + I
Sbjct: 255 SE---EKSFYQTHGFIQTLVQLFWKLDVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQI 311

Query: 314 IVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMY 373
           I P V+G+ V +P+YI WE K+++ P+ P++LLKDRGV++AL I+FLI+F +YM  DY+Y
Sbjct: 312 IGPIVLGF-VLIPMYIYWESKWAKEPMAPFKLLKDRGVWAALGISFLIDFIFYMAADYLY 370

Query: 374 TVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLL 433
            VL++ V++SVK+A+RI+SL SFVS +      L + +  R KP+I+ G   W ++ GLL
Sbjct: 371 AVLLIGVNQSVKSASRISSLSSFVSTVASPFFALIITRSTRLKPYIITGCSLWMLAMGLL 430

Query: 434 IHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXX 493
            H+RG S +++GI+G+LC+ G     F             SH  MA +TAL    Y I  
Sbjct: 431 YHFRGGSESYSGIVGALCVWGIGTTMFTYPVNVSVQSVT-SHENMATVTALNYTLYRIGA 489

Query: 494 XXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRET 553
                     WT  L   +   + +  LA  AY  P++FIIT+TW T ER A+V++YR  
Sbjct: 490 AVGAAVSGAIWTQTLYKDLLNRLDDAALAMSAYSEPYSFIITHTWNTPERDAMVQSYRYV 549

Query: 554 QKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKV---VEDDDPI 600
           Q++  I+ LVF VPLL+ +  LRD  L D VA D + E     V  +DPI
Sbjct: 550 QRLETIVALVFTVPLLVFSFFLRDPPLTDKVAQDNIEEGEYINVNHNDPI 599

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  476 bits (1225), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 242/564 (42%), Positives = 341/564 (60%), Gaps = 8/564 (1%)

Query: 43  ESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHS 102
           +S K   +   EI AEQY +   R +L FS FL  Y YGLDGN+R  +   AT+SYS HS
Sbjct: 57  KSSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHS 116

Query: 103 LLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGG 162
           LLST+  +  V+ AA QI +AR SD++GR T+   +I+FY++GT+IESQA +V R+ AG 
Sbjct: 117 LLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGA 176

Query: 163 CFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDV--TAAVNGNWKW 220
            FY +GY G +LI+ +I +DFS+L WRL   F+P  PFIINTWISG++   A    NW W
Sbjct: 177 VFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSW 236

Query: 221 GIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLD 280
            I MWAFIFPL+C+PL  CMLHM++ A +    + + S             +   FW+LD
Sbjct: 237 DIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLFWKLD 296

Query: 281 MIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPL 340
           +IG+  ++   GC+L+P TLAGG+  +W   HII P ++G+ V +P +I WE K++R P+
Sbjct: 297 VIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFILGF-VLIPFFIAWESKWAREPI 355

Query: 341 TPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVI 400
            P++LL+DRG+++AL IAFLINF + M   Y+YT+L+VAV+ESV +ATRI+S+ +F S +
Sbjct: 356 APFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTV 415

Query: 401 TGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFF 460
                 LF+ +  R KPFI+ G   W ++ G+L H+R    +  GIIG+L + G     F
Sbjct: 416 FSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGLGTTMF 475

Query: 461 XXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGIS-NQ 519
                        SH  MA +TAL    Y I            WT +L  ++ + +  + 
Sbjct: 476 TYPVTVSLQSVT-SHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQHLDGDA 534

Query: 520 TLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHK 579
           TLAA  YGSP T+I  Y W T  R  VV+AYR  QK   ++ LVF  PL + +L LRD  
Sbjct: 535 TLAASFYGSPLTYIAQYPWGTPVRDGVVQAYRYVQKYEVLVALVFTAPLFVFSLCLRDPP 594

Query: 580 LEDVVALDQMSEKV---VEDDDPI 600
           L + VA + + +     VEDDDP+
Sbjct: 595 LTNEVAHENIKQGEYVDVEDDDPV 618

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  476 bits (1224), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 244/564 (43%), Positives = 349/564 (61%), Gaps = 14/564 (2%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   EI A+QY   + +A+L FS+FL +Y YGLDG++R  +   AT+SYS HSLLST++ 
Sbjct: 51  LRKTEILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISI 110

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I  VI A+ Q++FAR SD+FGRLT+L V+ +FY +GT+I+SQA +V R+ AG  FY +G 
Sbjct: 111 INLVIGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGL 170

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAF 227
            G +L + +I +DFS+L WRL   F+P+ PFIIN W+SG+V  A N   NW W IGMWAF
Sbjct: 171 VGVVLQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAF 230

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGL 284
           IFPL C+PL CC+LHMRY A K    R      + K   +    +      FW+LD++G+
Sbjct: 231 IFPLTCLPLVCCILHMRYRASKTEAWR---HLQLEKTYYQSHGLLQTLIQLFWKLDVVGV 287

Query: 285 LLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWE 344
           LL+    GC+L+P TLAGG+ ++W   H+I P V+G+ V LP++++WE K++  P+ P+E
Sbjct: 288 LLLTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGF-VLLPIFVVWESKWALDPIAPFE 346

Query: 345 LLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTI 404
           LLKDRGV+SAL I FLI F + M   Y+YT+L++AV ES  +ATRITS+YSF + +    
Sbjct: 347 LLKDRGVWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPF 406

Query: 405 LGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXX 464
             L + + +R KP+I+ G   W ++ G+L H+R    +  GIIG L L G  +  F    
Sbjct: 407 FALVVTRSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPV 466

Query: 465 XXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGIS-NQTLAA 523
                    SH  MA +TAL    Y I            WT +L  ++ + ++ + TLA 
Sbjct: 467 TVSLQSIT-SHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLAT 525

Query: 524 EAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDV 583
            AYGSPF FI+ Y W T  R A+V++YR  QK   ++ L+F VP+ + ++ LRD  L D 
Sbjct: 526 AAYGSPFDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDD 585

Query: 584 VALDQMSEKV---VEDDDPIFAFL 604
            A + + E      E DDPI A++
Sbjct: 586 QAQENLKEGEYINTEHDDPILAWM 609

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  474 bits (1220), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 258/618 (41%), Positives = 359/618 (58%), Gaps = 22/618 (3%)

Query: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAG-----VNNIEIY 56
           S   + +++I    T +  +  +I+ +       S   + E  V         +   EI 
Sbjct: 11  SEKHSVNENIAEFQTDSDGEKKNIQNQ-------SFQDIDENDVPKTAKRAMVIRKTEIM 63

Query: 57  AEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAA 116
           A QY   +    L F+ F+  Y YGLDGNIRY +   ATSSY+EHSLLSTV  I  V++A
Sbjct: 64  AAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSA 123

Query: 117 AGQIWFARASDIFGRLTILG-VSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175
             QI+      +FGRL I+  V+I+ Y +GT+I+SQA +V R+ AG  FY  GY+G + I
Sbjct: 124 VSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAGYSGVLFI 183

Query: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLAC 233
           + II +DFS+L WRL   F P  PFIINTWISG++T+A N   NW W IGM AFI PL+C
Sbjct: 184 LLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRAFIIPLSC 243

Query: 234 IPLACCMLHMRYLAHKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFG 292
           +P   CM+HM + A K  +   L+   T  ++ +     +   FWRLD+ GL+L+    G
Sbjct: 244 LPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGLWGTLVELFWRLDVAGLILMGSSLG 303

Query: 293 CVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVY 352
           C+L+P TLAGG   +W   ++I P ++G+ V +P + LWE  F+R PL P +L+KDRGV+
Sbjct: 304 CILVPLTLAGGTSSKWNHGNVIGPFILGF-VLIPFFALWEKFFARDPLLPAKLVKDRGVW 362

Query: 353 SALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKL 412
           SA+ I+FLI+F +YM  DY+YTVLIVAV ESVK+ATRI+SL SFVS +      L+L + 
Sbjct: 363 SAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFALYLTRC 422

Query: 413 RRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXX 472
            R KP+I+ G   W ++ GLL ++RG   +H+GIIG+LC+ G     F            
Sbjct: 423 SRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPVTVSVQAAV 482

Query: 473 RSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTF 532
            SH  MA +TA     Y I            WT  L  ++ + + +  LA  AY SP+TF
Sbjct: 483 -SHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALATAAYSSPYTF 541

Query: 533 IITYTWET-AERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSE 591
              Y W T  ER+AVV+AYR  Q++  ++ LVFCVPL+  +L LRD +L D VA   ++E
Sbjct: 542 TTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLTDEVAHGNIAE 601

Query: 592 K---VVEDDDPIFAFLKK 606
               V  D DPI  F  K
Sbjct: 602 GEIIVKSDSDPISEFFVK 619

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 253/564 (44%), Positives = 355/564 (62%), Gaps = 23/564 (4%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   EI A QY + + R +L F+ F+  Y YGLDGNIRY +   AT++YSEHSLLST+  
Sbjct: 46  IKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGV 105

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           +  VI AA Q+ +AR +D FGRL++   +I+FY +GT+I+SQA +V R+ AG  FY +GY
Sbjct: 106 VNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGY 165

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAF 227
            G +L++ ++ +DFS+L WRLL   +P  PFIINTWISG++T+A     NW W IGMWAF
Sbjct: 166 VGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAF 225

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRL 279
           IFPL+C+PL  CM+HMR       K R  P +   K    K YF        +   FW+L
Sbjct: 226 IFPLSCVPLIACMIHMR------IKARKTPEWIALKQ--EKSYFQTNGLWDTLVELFWKL 277

Query: 280 DMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHP 339
           D++G+LL++   GC+L+P TLAGG   +W   HII P V+G+ V +P+ + WE++++R P
Sbjct: 278 DVVGVLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGF-VLVPILMFWEMRWARDP 336

Query: 340 LTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSV 399
           L P+ L+KDRGV+SAL I+FL  F + +   Y+Y +L+VAV ESVK+ATRI+SL SFVSV
Sbjct: 337 LVPYGLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSV 396

Query: 400 ITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
           +   I  LF+ + ++ KP+I+ G   W +  GLL HYRG S AH+GIIG+LC+ G  +  
Sbjct: 397 VWSPIFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTM 456

Query: 460 FXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQ 519
           +             SH  +A +TAL    Y I            WT  L  ++ + + + 
Sbjct: 457 WTYPVNISVQSAT-SHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDA 515

Query: 520 TLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHK 579
            LAA AY SP+TFI++Y W T +R+AVV AYR  Q+   I+ LVFC PL++ A+ LRD  
Sbjct: 516 DLAAAAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPD 575

Query: 580 LEDVVALD--QMSEKVVEDD-DPI 600
           L D VA    +  E +V+D  DPI
Sbjct: 576 LTDEVAHSGLEKGEYIVKDQTDPI 599

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  471 bits (1211), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 246/566 (43%), Positives = 350/566 (61%), Gaps = 7/566 (1%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   E+ A +Y     R +L F  F+  Y YGLD NIR+ + +  T+S+SEHSLLSTVN 
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I  VI+AA QI +AR +D+FGRLT+   +++FY +GTVI+SQ+ N+  + AG  FY LGY
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAF 227
            G +L++ +I +DFS+L WRL   F P  PFIINTWISG++T+  N   NW W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLI 287
           IFPL+C+PL CCMLHM + A +  + +++              FI   FW+LD IG  ++
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIM 318

Query: 288 VCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLK 347
               GC+L+P TLAGG   +W  + II P V+G  V LP+ I++E+K++R P+ PW+L+K
Sbjct: 319 TVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLIK 377

Query: 348 DRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGL 407
           DR V++++ I+FL +F +YM  DY+YTV+IVAV ESVK+ATRI+SL +FVS +      L
Sbjct: 378 DRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFAL 437

Query: 408 FLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXX 467
           ++ ++ R KP+I+ G   W ++ GLL H+RG   +H+GIIG LC+ G     F       
Sbjct: 438 YITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVS 497

Query: 468 XXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYG 527
                 SH  MA +T+L    Y I            WT  L   I + + +  +A+ AY 
Sbjct: 498 VQSAT-SHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYE 556

Query: 528 SPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALD 587
            P+ FI  YTW T  RQ VV+AY   QK+  ++GLVFC PLL+ +L LRD +L D +A +
Sbjct: 557 QPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAHN 616

Query: 588 QMSEK--VVEDDDPIFAFLK-KCIPF 610
            + E   +  D D IF +++ KC  F
Sbjct: 617 DLGEGEYIARDKDYIFDWIEDKCRKF 642

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  462 bits (1189), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 248/586 (42%), Positives = 357/586 (60%), Gaps = 25/586 (4%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           K   +   EI A QY + + R +L FS F+  + YGLD NIRY +   ATSSY++HSLLS
Sbjct: 43  KSLVIRKTEILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLS 102

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
           TV  I  +++AA QI++AR SD+FGRL++  VS++FY+IGT+I+SQA +V ++ AG  FY
Sbjct: 103 TVAIINNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFY 162

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIG 223
            +GY G  LI+ +I +D S+L WRL   + P  PFII TWISG++ +  N   NW WGIG
Sbjct: 163 NIGYVGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIG 222

Query: 224 MWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV--------- 274
           MWAFIFPL C+P+  CMLHMR+ A K       P +   +D+S ++ F            
Sbjct: 223 MWAFIFPLTCLPILFCMLHMRFKARKT------PEW---QDLSSQKSFFQTHGIVQALVQ 273

Query: 275 FFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIK 334
            FW+LD++G+ ++    GC+L+P TLAGG   +W+ + II P V+G+ V +P++I WE K
Sbjct: 274 LFWKLDVVGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGF-VLVPVFIYWESK 332

Query: 335 FSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLY 394
           +++ PL P+ELLKDRG+++++   FL++F + M   Y+Y VLIVAV ES K+ATRITSL 
Sbjct: 333 WAKDPLAPFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLA 392

Query: 395 SFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLG 454
           SFVS +    +G  + +  R KP+I+ G   WF++ GLL HYR    +H+GIIG L LLG
Sbjct: 393 SFVSTVASPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLG 452

Query: 455 FCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISR 514
                              SH  MA +TAL    Y I            WT  L + + +
Sbjct: 453 LGCT-LSIYPINVSAQSLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLK 511

Query: 515 GISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALM 574
            + + TLA  AY +P++F++TY W+T  RQAVV+AYRE Q++  +I L+F  PLL+++L 
Sbjct: 512 RLGDATLAMSAYSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLF 571

Query: 575 LRDHKLEDVVALDQMSEK---VVEDDDPIFAFLKKCIPFYNKKNGE 617
           LRD  L D V  + + +        +DPI  +L     F  +K  +
Sbjct: 572 LRDPPLTDQVGQENIKDGEYVATGYNDPITDWLTGKFKFLKRKRQD 617

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  449 bits (1156), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 240/604 (39%), Positives = 352/604 (58%), Gaps = 14/604 (2%)

Query: 5   STTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESV-KDAGVNNIEIYAEQYQNP 63
           S +D+  H+ S     +  ++ ++ V+  ++      +  V K   +   E+ A+QY   
Sbjct: 9   SASDKGFHSGSVN-EAKKITVDEKMVAEPLDEYGMPDKLKVTKSLVIRKAELMAKQYDTW 67

Query: 64  FLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFA 123
           FL+++  FS FL ++ YGLDGNIR  +   A +SYS HSL+STV  I  VI+A  Q+ +A
Sbjct: 68  FLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMVISAVAQVIYA 127

Query: 124 RASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDF 183
             SD+FGRL++  VSI+FY++GT+I+SQA +V R+ AG  FY +G  G ML + ++ +D 
Sbjct: 128 GLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLVGVMLQVILVLSDN 187

Query: 184 SNLNWRLLALFIPALPFIINTWISGDV--TAAVNGNWKWGIGMWAFIFPLACIPLACCML 241
           S+L WRL   F+PA P II TW+SG+V  TA    NW W I MWAFIFPL+CIPL  CML
Sbjct: 188 SSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAFIFPLSCIPLIACML 247

Query: 242 HMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPF 298
           HMR+      + + + +    K   +    I      FW+LD++G++L+    GC+L+P 
Sbjct: 248 HMRWKVRNEPEWKELQT---EKTYYQSHGLIQTVVQLFWKLDVVGIILLTVGTGCILVPL 304

Query: 299 TLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIA 358
           TLAGG+  QW++A +I P V+G+ V + ++I WE K +  P+ P+++LKDRG+++ L I 
Sbjct: 305 TLAGGVSTQWQSAKLIAPFVLGF-VLIAIFIYWESKLALAPIAPFKMLKDRGIWAPLWIM 363

Query: 359 FLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPF 418
           FLI F + M   Y+YT+L+VAV E+  +ATRITSLYSFVS I   +LG  + +  R KP+
Sbjct: 364 FLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPVLGFIVARSSRLKPY 423

Query: 419 ILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKM 478
           ++ G   +F++ GL   YR    AH G+IG++ + G C+  F             SH  M
Sbjct: 424 MVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFDYPVTVSIQSVT-SHENM 482

Query: 479 AVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTW 538
           A +TAL    ++I            WT +L  ++   I +  LA  AY SP TF + Y W
Sbjct: 483 ATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADLAEAAYSSPLTFYLDYPW 542

Query: 539 ETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE--D 596
            T  R A+V+AY+  QK   +I LVF  P+ +    LRD  L D VA      + VE   
Sbjct: 543 GTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLTDDVAQKLNDGEYVETSH 602

Query: 597 DDPI 600
           DDPI
Sbjct: 603 DDPI 606

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  444 bits (1142), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 238/570 (41%), Positives = 341/570 (59%), Gaps = 13/570 (2%)

Query: 43  ESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHS 102
           ++ K   +   EI A QY   +  A++ FS F+  Y YGLDG++RY + + A SSYS+H 
Sbjct: 31  KTTKSLVIRKTEIMAAQYDRWYHHAIILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHP 90

Query: 103 LLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGG 162
           L+ST+  +  +I+AA QI FAR SD+FGRL++   +++FY +GT+I+SQAT+V ++ AG 
Sbjct: 91  LISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGA 150

Query: 163 CFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKW 220
            F+  GY G +LI+ +I +DFS+L WRL+  F P+ P+IINTW +G VTA  N   +W W
Sbjct: 151 IFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYIINTWFAGTVTARANPQEHWSW 210

Query: 221 GIGMWAFIFPLACIPLACCMLHMRYLAHKN---AKDRLMPSFTIPKDVSRKEYFIDVFFW 277
            I MWAFI PL+ +P+  CMLHMR+ A K    A  +   SF     + R    +   FW
Sbjct: 211 DIAMWAFIVPLSALPMIFCMLHMRFKARKTEQWAAIKDEKSFFQSHGLIRT---LVELFW 267

Query: 278 RLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR 337
           +LD++G+LL+    GC+L P TLAGG+K +W   H+I P V+G+ V LPL+++WE K ++
Sbjct: 268 KLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPHLIGPLVLGF-VLLPLFMIWESKAAK 326

Query: 338 HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFV 397
           +P+ P+ L+KDR V+ AL   FLI F +     Y+YT+LIVAV+ESVK+AT I+SL SFV
Sbjct: 327 YPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGYIYTILIVAVNESVKSATVISSLSSFV 386

Query: 398 SVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCA 457
           S +  T   L++ +  + K +I+ G   W ++ GL  HYRG   AH+GI+G++ + G   
Sbjct: 387 STVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFYHYRGGEFAHSGIVGAMVIWGL-G 445

Query: 458 GFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGIS 517
                           SH  MA +TAL    Y I            W+  L   +   + 
Sbjct: 446 DTLLIYPTTISVQSATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLYKALLSRLQ 505

Query: 518 NQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRD 577
           +   A+ AY +PF FI+TYTW T ER A+V AYR  Q+   I+ LVF VPLL   L LRD
Sbjct: 506 SVEQASAAYSTPFEFILTYTWGTPERNAMVDAYRHVQRYESIVALVFTVPLLFFGLCLRD 565

Query: 578 HKLEDVVALDQMSEKVVED---DDPIFAFL 604
             L D VA + + +    D   DDPI  +L
Sbjct: 566 PPLTDKVAQEDIDDGEFLDKNHDDPIAEWL 595

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  443 bits (1140), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 236/617 (38%), Positives = 350/617 (56%), Gaps = 27/617 (4%)

Query: 15  STQAHTQDDSIKKETVSATINSVSSLSE-----ESVKDAGVNNIEIYAEQYQNPFLRAML 69
           ST + T   ++  ET         S  +     +  K   +   E+ A QY N FL+++ 
Sbjct: 15  STSSETNGKTVIVETEKQFTKEAESEHKLADKLQITKRIVIRKSELMANQYDNWFLKSLF 74

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
            FS F+ A++YGLD  IR  +   A + Y  HSLLSTV+ I   I+A  QI+FA  SD+F
Sbjct: 75  LFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSVISLTISAVAQIFFAGLSDVF 134

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GRL+I  V+I FY++GT+I+SQA +V R+ AG  FY +G  GAM  + ++ +D S+L WR
Sbjct: 135 GRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQVTLMLSDSSSLKWR 194

Query: 190 LLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLA 247
           L   F+PA P ++  WISG+V    N   NW WGI MWAFIFP AC+P+  C+LHMR+  
Sbjct: 195 LFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAFIFPAACLPIIGCLLHMRW-- 252

Query: 248 HKNAKDRLMPSFTIPKDVS-RKEYF--------IDVFFWRLDMIGLLLIVCFFGCVLIPF 298
               K R  P +   KD+   K YF        +   FW+LD++G+LL     GC+LIP 
Sbjct: 253 ----KLRNDPEW---KDLQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVSTGCILIPL 305

Query: 299 TLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIA 358
           T+AGG    WR+A +I P V+G  V +P +I WE K +  PL P+++LKDRG+++ L+I 
Sbjct: 306 TVAGGASTHWRSAKVIAPIVLG-SVLVPAFIYWESKLALVPLAPFKMLKDRGIWAPLLIT 364

Query: 359 FLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPF 418
           FLI F + M   Y+YT+L+VA +ES  +ATRITSLYSFV+ +   ++G+F+ +  R KPF
Sbjct: 365 FLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVARFSRLKPF 424

Query: 419 ILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKM 478
            +FG   +F++  L  H+RG      G+IG++ + G  + FF             SH  M
Sbjct: 425 AVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPINISMQTVT-SHENM 483

Query: 479 AVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTW 538
           A +TAL L  + I            WT  L  R+ + + + T+A EAY  P +F++ + W
Sbjct: 484 ATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEAYNMPLSFMLKHEW 543

Query: 539 ETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDD 598
            TA R A+V +YR  Q+   ++GL+F  P+ +   +LRD  L +         + V+ DD
Sbjct: 544 GTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPLTEDYGQRLEDNEYVKHDD 603

Query: 599 PIFAFLKKCIPFYNKKN 615
           PI  ++ +    + K +
Sbjct: 604 PITDWIAERFSRFKKHD 620

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  443 bits (1139), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 224/583 (38%), Positives = 344/583 (59%), Gaps = 20/583 (3%)

Query: 43  ESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHS 102
           +  K   +   E+ A QY N FL+++  FS F+ A++YGLD  IR  +   A +SYS HS
Sbjct: 46  QMTKRIVIRKTELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHS 105

Query: 103 LLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGG 162
           LLSTV+ I   I+A  QI+FA  SD+FGRL++  V+I+FY++GT+I+SQA +V R+ AG 
Sbjct: 106 LLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGS 165

Query: 163 CFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKW 220
            FY +G  G+M  I +I +D S+L WRL   F+PA P ++  WISG+V +  N   NW W
Sbjct: 166 IFYYIGLVGSMFEITLILSDCSSLKWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSW 225

Query: 221 GIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------I 272
           GI MWAFIFP +C+P+  C+LHMR+    N      P +   ++   K YF        +
Sbjct: 226 GIAMWAFIFPASCLPIIGCLLHMRWKLRNN------PEWIELQE--EKTYFQTHGLVQTL 277

Query: 273 DVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWE 332
              FW+LD++G+LL     GC+L+P TLAGG   QWR+A +I P V+G+ + +P++I WE
Sbjct: 278 KQLFWKLDVVGVLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLL-VPVFIYWE 336

Query: 333 IKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITS 392
            K +  PL P+++LKDRG+++ L+I FLI + + M   Y+YT+L+VA +ES  +ATRITS
Sbjct: 337 SKLALVPLAPFKMLKDRGIWAPLVITFLICYIYMMAAGYLYTILVVAGNESPLSATRITS 396

Query: 393 LYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCL 452
           LYSFV+ +   ++G+F+ +  R KPF +FG   +F++  L  H+RG +    G+IG++ +
Sbjct: 397 LYSFVAAVFSPVVGIFVARFTRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVI 456

Query: 453 LGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRI 512
            G  + FF             SH  MA +TA  L  + I            WT  L  R+
Sbjct: 457 WGITSCFFNYPINISMQTVT-SHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRL 515

Query: 513 SRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAA 572
            + + +  +A EAY  P +F++ + W T+ R+ +V+AYR  Q+   ++GL+F  P+ +  
Sbjct: 516 LKTLGDPNMAIEAYSMPLSFVLKHEWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLT 575

Query: 573 LMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKKCIPFYNKKN 615
             LRD  L +         + ++ DDPI  +L +    + K +
Sbjct: 576 FFLRDPPLTEDYGQKLDDNEYLKQDDPITDWLAERFSRFKKHD 618

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  442 bits (1136), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 226/591 (38%), Positives = 350/591 (59%), Gaps = 11/591 (1%)

Query: 31  SATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTF 90
           +A +   S  + E  +   +   E+ A+QY + FL+++  F++F+ ++AYGLD  IR  +
Sbjct: 34  NADMEQESPDTFEVTESIVIRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIY 93

Query: 91  QALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIES 150
              A ++Y  HSLLSTVN I  VI+A GQI+FAR SD+FGRL++  VSI+ Y++GTVI+S
Sbjct: 94  MTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQS 153

Query: 151 QATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDV 210
           QA +V R+ AG  FY +G  GAM  + +I +D S L WRL   F+PA P II  WISG+V
Sbjct: 154 QAYDVQRYAAGSVFYNVGLVGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNV 213

Query: 211 TAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRK 268
               N   NW WGI MWAFIFP++CIP   C+LHMR+    + + R +      K   + 
Sbjct: 214 VHVANPLENWSWGIAMWAFIFPVSCIPFIACILHMRWKVRNSHEWRELQE---EKSFYQT 270

Query: 269 EYFIDVF---FWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVAL 325
              +  F   FWRLD++G++L+  F GC+ +P T+AGG+  +WR+  +I P V+G+ + +
Sbjct: 271 HGLVQTFVQLFWRLDVVGVILLSVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSL-I 329

Query: 326 PLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVK 385
           P ++ WE + +R PL P+ +LKDRG+++ L I FLI F + M  +Y+YT+L+VA +ES  
Sbjct: 330 PAFVYWESRLARFPLAPFLMLKDRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDL 389

Query: 386 AATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAG 445
           +A RITSLYSFV+ I   I+GL + +  R KP+ + G   +F++ GL  HYRG + A  G
Sbjct: 390 SAIRITSLYSFVAAIFSPIVGLLVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKG 449

Query: 446 IIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWT 505
           +IG++ + G  +  +             SH  +A ++AL    + I            WT
Sbjct: 450 VIGAMVVWGITSCLYDYPISVSIQTVT-SHENLANVSALSSTIFRIGGAVGAAVSGAIWT 508

Query: 506 NVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFC 565
             L  ++ + + +  +A  A+ SP  FI  Y W T  R+A V+A++  QK   ++GL+F 
Sbjct: 509 QTLYPKLLKALGDAGMAEAAFNSPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFV 568

Query: 566 VPLLMAALMLRDHKLEDVVALDQMSEKVV-EDDDPIFAFLKKCIPFYNKKN 615
           VP+ +    LRD  L +    +   E+ V E+DDPI  ++ + +  + K++
Sbjct: 569 VPMFVMTFFLRDPPLNEEFGQNLNGEEYVKENDDPINDWIAERLSRFKKQD 619

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  441 bits (1134), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 233/570 (40%), Positives = 337/570 (59%), Gaps = 18/570 (3%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   E+ A+QY + F +++   + F+ ++AYGLD  IR  +   A   Y+EHSLLSTVN 
Sbjct: 53  IRKSELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNV 112

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           +  +I+A GQI+FA  SD+FGRL++  V+IIFY++GT+I+SQA +V R+ AG  FY +G 
Sbjct: 113 VSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGL 172

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAF 227
            GA+  + II +D S+L WRL   F+PA P  +  WISG+V    N   NW WGIGMW F
Sbjct: 173 VGAIFQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGF 232

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGL 284
           IFP +C+PL  CMLHMR+   K   DR        K   +    +      FW+LD+ G+
Sbjct: 233 IFPASCLPLIACMLHMRW---KVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGV 289

Query: 285 LLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWE 344
           LL+    GC+L+P T+AGG+  QWR+A +I P V+G+ + +P+++ WE + +  PL P++
Sbjct: 290 LLLTACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFAL-VPVFLYWESRIALVPLAPFK 348

Query: 345 LLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTI 404
           +LKDRG+++ L I FLI F + M   Y+YTVL+VA +ES  +ATRITSLYSFV+ I   I
Sbjct: 349 MLKDRGIWAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPI 408

Query: 405 LGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXX 464
           LG+ + +  R KP+ L G   +F++ GL  HYRG   A  GIIG++ + G  +  +    
Sbjct: 409 LGVLVARSTRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPI 468

Query: 465 XXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAE 524
                    SH  MA +TAL L  + I            WT  L  ++ + + +  +AA+
Sbjct: 469 SISMQTVT-SHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAK 527

Query: 525 AYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVV 584
           AY  P TFI  Y W T+ R A V+AYR  QK   ++GL+F  P+ +    LRD  L +  
Sbjct: 528 AYDEPLTFIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTEEY 587

Query: 585 ALD-QMSEKVVEDDDPI-------FAFLKK 606
             + +  E V E+DDPI       F+ LKK
Sbjct: 588 GQNLEDDEYVKENDDPINDWIMERFSRLKK 617

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  439 bits (1130), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 233/612 (38%), Positives = 352/612 (57%), Gaps = 25/612 (4%)

Query: 11  IHN---LSTQAHTQDDSI--KKETVSATINSVSSLSEESVKDAGV------------NNI 53
           +HN   L  +    +D +  +KE  +  IN +   S++ V+ +GV               
Sbjct: 1   MHNNPVLKMENDQIEDGVGHRKEGAAEKINEMDEDSKKGVQFSGVCDGMKQTKSLVIRKT 60

Query: 54  EIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTV 113
           EI A QY   + + +     FL AY Y LD +IRY +   AT+SY+ HSLLST++ I  +
Sbjct: 61  EIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISIINMM 120

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAM 173
           I+A  Q++FA  SD+FGRL ++ V+I+FY++GTVI+SQA ++ R+ AG  FY +G  G M
Sbjct: 121 ISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGVVGVM 180

Query: 174 LIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPL 231
           L + +   D S+L WRLL  F+PA P IIN W+SG++  A N   NW W I MWAFI PL
Sbjct: 181 LQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAFILPL 240

Query: 232 ACIPLACCMLHMRYLAHKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCF 290
           +C+PL CC++HMR+ A K  +   L    T  +        ++V FW++D++GLLL+   
Sbjct: 241 SCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHGFVHTIVEV-FWKVDIVGLLLLTAS 299

Query: 291 FGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRG 350
            GC+L+P T+AGG+ EQW    II P V+G    +PL I WE  +++ P  P+ LLKDRG
Sbjct: 300 MGCILVPLTIAGGISEQWNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLLKDRG 358

Query: 351 VYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLV 410
           +++ + I FL+ F + M   Y+YT+L+V+++++  +ATRI +LYSFV+ I   I G  + 
Sbjct: 359 IWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFGFVVA 418

Query: 411 KLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXX 470
           +  R K F+L G C +F+  GL   YRG  GA +GIIG++ + G  +  +          
Sbjct: 419 RTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTTSAQS 478

Query: 471 XXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPF 530
              SH  MA +TA+ L  + I            WTN+L  ++ + + +  LA+ AY +P 
Sbjct: 479 VT-SHENMATVTAMLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAYTAPL 537

Query: 531 TFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMS 590
           TFI+++ W T  R A++ AYR  QK   ++GL+F  P+L+    LRD +L D        
Sbjct: 538 TFIVSHPWNTEVRTAMIDAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTDDYGQKLAE 597

Query: 591 EKVV--EDDDPI 600
            + V  E +DPI
Sbjct: 598 GQCVQTEGEDPI 609

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  439 bits (1128), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 221/561 (39%), Positives = 329/561 (58%), Gaps = 20/561 (3%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   E+ A QY    L++M  FS F+ A++YGLD  IR  +   A + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I   I+A  QI+FA  SD+FGRL++  V+I+FY++GTVI+SQA +V R+ AG  FY +G 
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAF 227
            G+M  + ++ +D S+L WRLL  F+PA P ++  WISG+V    N   NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRL 279
           IFP  C+P+  C+LHMR+    N++ + +           K YF        +   FW+L
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQ--------EEKTYFQTHGLVQTLKQLFWKL 286

Query: 280 DMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHP 339
           D++G+LL     GC+LIP T+AGG    WR+A +I P V+G  + +P +I WE K +  P
Sbjct: 287 DVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVP 345

Query: 340 LTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSV 399
           L P+++LKDRG+++ L+I FLI F + M   Y+YT+L+VA +ES  +ATRITSLYSFV+ 
Sbjct: 346 LAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAA 405

Query: 400 ITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
           +   ++G+F+ +  R KPF +FG   +F++  L  H+RG +    G+IG++ + G  + F
Sbjct: 406 VFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCF 465

Query: 460 FXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQ 519
           F             SH  MA +TA  L  + I            WT  L  R+ + + + 
Sbjct: 466 FNYPINISMQTVT-SHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDP 524

Query: 520 TLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHK 579
           TLA EAY  P +F++ + W T  R A+++AYR  QK   ++GL+F  P+ +    LRD  
Sbjct: 525 TLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPP 584

Query: 580 LEDVVALDQMSEKVVEDDDPI 600
           L +        ++ V+ DDPI
Sbjct: 585 LTEDYGQKLEDDEYVKHDDPI 605

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  439 bits (1128), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 221/561 (39%), Positives = 329/561 (58%), Gaps = 20/561 (3%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +   E+ A QY    L++M  FS F+ A++YGLD  IR  +   A + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I   I+A  QI+FA  SD+FGRL++  V+I+FY++GTVI+SQA +V R+ AG  FY +G 
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAF 227
            G+M  + ++ +D S+L WRLL  F+PA P ++  WISG+V    N   NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRL 279
           IFP  C+P+  C+LHMR+    N++ + +           K YF        +   FW+L
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQ--------EEKTYFQTHGLVQTLKQLFWKL 286

Query: 280 DMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHP 339
           D++G+LL     GC+LIP T+AGG    WR+A +I P V+G  + +P +I WE K +  P
Sbjct: 287 DVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVP 345

Query: 340 LTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSV 399
           L P+++LKDRG+++ L+I FLI F + M   Y+YT+L+VA +ES  +ATRITSLYSFV+ 
Sbjct: 346 LAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAA 405

Query: 400 ITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
           +   ++G+F+ +  R KPF +FG   +F++  L  H+RG +    G+IG++ + G  + F
Sbjct: 406 VFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCF 465

Query: 460 FXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQ 519
           F             SH  MA +TA  L  + I            WT  L  R+ + + + 
Sbjct: 466 FNYPINISMQTVT-SHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDP 524

Query: 520 TLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHK 579
           TLA EAY  P +F++ + W T  R A+++AYR  QK   ++GL+F  P+ +    LRD  
Sbjct: 525 TLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPP 584

Query: 580 LEDVVALDQMSEKVVEDDDPI 600
           L +        ++ V+ DDPI
Sbjct: 585 LTEDYGQKLEDDEYVKHDDPI 605

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  438 bits (1126), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 240/603 (39%), Positives = 350/603 (58%), Gaps = 25/603 (4%)

Query: 8   DQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRA 67
           D++ +NL    H  +D IKK               +S K   +   E+ A  Y   +   
Sbjct: 15  DEEKNNLGVSQH--NDPIKKL--------------QSTKSLNIRKTELMASCYDRWYHHV 58

Query: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASD 127
            L F+ FL  Y YGLDGNIR  + + A +SY+ H L+ST++ +  V++AA QI+FAR SD
Sbjct: 59  FLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSD 118

Query: 128 IFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLN 187
           +FGRL++   +I FY++GT+I+SQA ++ R+  G  F+ +GY G +L++ +I +DFS+L 
Sbjct: 119 VFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLR 178

Query: 188 WRLLALFIPALPFIINTWISGDVTAAVNGN--WKWGIGMWAFIFPLACIPLACCMLHMRY 245
           WRLL  F P+ P IINTWI+G +TA  N    W W IGMWAFI PL C+P+  CMLHMR+
Sbjct: 179 WRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAFIIPLTCLPMILCMLHMRF 238

Query: 246 LAHKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGM 304
            A +  +   L    +  +     +  I++ FW++D++G+LL+    GCVL P TLAGG 
Sbjct: 239 KARRTEQWAELRNERSYYQTHGLIKTLIEL-FWKVDVVGILLMTASIGCVLAPLTLAGGT 297

Query: 305 KEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFC 364
             +W+   +I P V+G+ V LP++++WE K++R P+ P++L+KDR V+++L   FLI F 
Sbjct: 298 GSKWQNPRVISPFVLGF-VLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFI 356

Query: 365 WYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGIC 424
           + M   Y+Y +LIV V+ES+K+AT IT L SFV+        L++ +  R K +I+ G  
Sbjct: 357 YMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIVAGCG 416

Query: 425 GWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITAL 484
            W ++ GL  HYRG   AH GI+ ++ + G                   SH  MA++TAL
Sbjct: 417 LWMLAMGLFYHYRGGEFAHGGIVAAMVVWGL-GDVLLIYPITVSVQSATSHDNMAMVTAL 475

Query: 485 YLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQ 544
               Y I            WT  L   + + + + TLA  AY  PF FI TYTW T ER+
Sbjct: 476 NYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGTPERE 535

Query: 545 AVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMS--EKVVED-DDPIF 601
           AVV+AYR  Q+   I+ LVF VPLL+  L LRD  L D VA   +   E V +D +DPIF
Sbjct: 536 AVVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVAHGSIKDGEYVAKDHEDPIF 595

Query: 602 AFL 604
           ++ 
Sbjct: 596 SWF 598

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  436 bits (1121), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/634 (38%), Positives = 359/634 (56%), Gaps = 18/634 (2%)

Query: 10  DIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAML 69
           +I+++  + + + ++I+  +   T     +  EE      +  IEI    Y   +  A+L
Sbjct: 57  EINHIEQKNNEKFNTIEHTSTEGTNPKYDTTYEEFDSKRIIKEIEIMKSVYDTWYFHALL 116

Query: 70  FFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIF 129
            F  F+ +Y Y LD  +R  ++  A SSY +HSL+ST+N I +V +A  Q+ ++RASDIF
Sbjct: 117 LFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIF 176

Query: 130 GRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           GRL++L V+II Y++GT+I+SQA ++ R+ AG  FY LGY G  L++ +I +D+S+L WR
Sbjct: 177 GRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWR 236

Query: 190 LLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLA 247
                I A P IIN WISG +    N   +W W IGMWAFIFPL+CIP+ CC++HM++LA
Sbjct: 237 FFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSCIPILCCLIHMQWLA 296

Query: 248 HKNAK-DRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKE 306
            +  +  +L    +  K    K+  ID+ FWR D++G++L+  F G +LIP TLAGG K 
Sbjct: 297 SQTDEWKQLKKGKSYFKYYGYKDSLIDM-FWRFDVVGVILLAAFIGLILIPLTLAGGTKS 355

Query: 307 QWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWY 366
           +W    +I P VIG CV +P + +WE  F++HP+ PW L+KDR +++AL ++ +  F + 
Sbjct: 356 RWSEGKLIAPFVIG-CVMVPCFAIWEKWFAKHPIMPWRLIKDRSIWAALTLSLVYKFVFA 414

Query: 367 MQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGW 426
           +  DYMY++L+VAV ES+K+AT I  ++SFVS +           + R KPFI  G   +
Sbjct: 415 VAQDYMYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFSYGTTFVGRLKPFIFLGTLLY 474

Query: 427 FISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYL 486
            +S GLL +YRG   AH+GIIG+LC++G     F             S A MA +TAL L
Sbjct: 475 MLSLGLLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLTVITQASVSSADMANVTALIL 534

Query: 487 ACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAV 546
              NI            WT  L   + + + N+TLA +AY SP +FI  Y+W T  R  +
Sbjct: 535 TFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTLAKKAYSSPLSFIANYSWGTPVRNIM 594

Query: 547 VKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE--DDDPIFAFL 604
           V++YR  Q+   I+ + FC PL++    LRD  L      D    K V+  D DPIF F 
Sbjct: 595 VESYRSVQRYEIIVAISFCAPLVLLTFALRDINLNRSTDADLEDGKHVKMTDSDPIFDFF 654

Query: 605 KKCIPFYNK--------KNGETSTVTTSTDGNDV 630
                 +NK        K  + S     +  ND+
Sbjct: 655 AN---IFNKIFHSSPRGKKSDNSDQDNYSSNNDI 685

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  432 bits (1111), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 233/622 (37%), Positives = 350/622 (56%), Gaps = 27/622 (4%)

Query: 1   MSSVSTTDQDIHNLSTQAHTQDDS---IKKETVSATINSVSSLSEE--SVKDAGVNNIEI 55
           M      D  ++  ST + T   +     +E  S   ++   L+++    K   +   E+
Sbjct: 1   MPEYQEEDPSLNLGSTSSETNGKTNVVETEEQFSKEADNEHELADKFHVTKRIVIRKSEL 60

Query: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIA 115
            A QY N  L+++  FS F+ +++YGLD  IR  +   A ++Y  HSLLSTVN I   I+
Sbjct: 61  MANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMTIS 120

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175
           A  QI+FA  SD+FGRL+I  V+I+FY++GT+I+SQA +V R+ AG  FY +G  GAM  
Sbjct: 121 AVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQ 180

Query: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLAC 233
           + ++ +D S+L WRL   F+PA P ++  WISGDV    N   NW WGI MWAFIFP  C
Sbjct: 181 VTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAFIFPATC 240

Query: 234 IPLACCMLHMRYLAHKNAKDRLMPSFTIPKDV-SRKEYF--------IDVFFWRLDMIGL 284
           +P+  C+LHMR+    +      P +   KD+  +K YF        +   FW+LD +G+
Sbjct: 241 LPIIGCLLHMRWKLKND------PEW---KDLQEKKTYFQTHGLVQTLKQLFWKLDAVGV 291

Query: 285 LLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWE 344
           LL     GC+L+P T+AGG+  QWR+A II P V+G  + L ++I WE K +  PL P++
Sbjct: 292 LLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLAPFK 350

Query: 345 LLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTI 404
           +LKDRG+++ L++ FL+ F + M  DY+YT+L+VA +ES  +ATRITSLYSFV+ +    
Sbjct: 351 MLKDRGIWAPLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAA 410

Query: 405 LGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXX 464
            G+ + +  R KPF  FG   +F++  L   +RG      G+IG++ + G  + FF    
Sbjct: 411 AGILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFDYPI 470

Query: 465 XXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAE 524
                    SH  MA +TAL LA + I            WT  L  R+ + + +  +A E
Sbjct: 471 NISMQTVT-SHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDMAIE 529

Query: 525 AYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVV 584
           AY  P +F++ + W T  R+A+V +YR  QK   ++GLVF  P+ +    LRD  L +  
Sbjct: 530 AYDMPLSFMLEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLTEDY 589

Query: 585 ALDQMSEKVVEDDDPIFAFLKK 606
                  + V+ DDPI  ++ K
Sbjct: 590 GQRLEDNEYVKHDDPITDWIAK 611

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  428 bits (1101), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 234/605 (38%), Positives = 335/605 (55%), Gaps = 14/605 (2%)

Query: 6   TTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFL 65
            T+++ + L       DDS  ++ +   +    SL         +   E+ A++Y    L
Sbjct: 17  NTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLI--------IRKSELMAKKYDTWQL 68

Query: 66  RAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARA 125
           +A+  FS F+  +AYGLD +IR T+   A +SYS HSL+STV+ I  +I+A  Q+ F   
Sbjct: 69  KAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGL 128

Query: 126 SDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSN 185
           SDIFGRLT+  VSI+ YI+GT+I+SQA +V R+ AG  FY +G  G ML + ++ +D S+
Sbjct: 129 SDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLMLSDNSS 188

Query: 186 LNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCMLHM 243
           L WRL    IP+ P II TW+SG V  A N   NW W I MWAFIFPL CIPL  CMLHM
Sbjct: 189 LKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIFPLCCIPLILCMLHM 248

Query: 244 RYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGG 303
           R+    + + + +               +   FW+LD++G+LL     GC+L+P TLAGG
Sbjct: 249 RWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKLDVVGVLLFTAGVGCILVPLTLAGG 308

Query: 304 MKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINF 363
           +   WR + II P V+G+ V +P +I WE + +  P  P++LLKDRGV++ L I F I F
Sbjct: 309 VSTNWRNSKIIGPFVLGF-VLVPGFIYWESRLALVPFAPFKLLKDRGVWAPLGIMFFICF 367

Query: 364 CWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGI 423
            + M   Y+YT+L+VAV ES  +ATRI +LYSFV+ +    LGL + +  R K +I+FG 
Sbjct: 368 VYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLGLIVTRSSRLKSYIIFGG 427

Query: 424 CGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITA 483
             +FI+ GL   YR    A  GII  + + G  +  F             SH  MA +TA
Sbjct: 428 SLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVSIQSVT-SHENMATVTA 486

Query: 484 LYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAER 543
           L    + I            WT  L  ++   + +  LA  AYGSP TFI++  W T  R
Sbjct: 487 LNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAYGSPLTFILSNPWGTPVR 546

Query: 544 QAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE--DDDPIF 601
            A+V+AYR  QK   I+ LVF  P+ +    +RD +L +  A      + V+  +DDPI 
Sbjct: 547 SAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFAQKLPDREYVQTKEDDPIN 606

Query: 602 AFLKK 606
            ++ K
Sbjct: 607 DWIAK 611

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  411 bits (1056), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 300/454 (66%), Gaps = 10/454 (2%)

Query: 5   STTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGV-NNIEIYAEQYQNP 63
           S +  ++H  +  +   +D   KE  S   ++ SS+ + +VK + V    EI +  Y   
Sbjct: 3   SQSSPEVHEKNHLSSKGNDIFTKEIESQNDDTQSSVPDFAVKRSLVIKKTEIMSAVYDKW 62

Query: 64  FLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFA 123
           +   +L FS F+  YAYGL+ NIRY +   ATSSY+EHSLLSTVN I  V++AA QI ++
Sbjct: 63  YHHVILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYS 122

Query: 124 RASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDF 183
           R SD FGRLT+  ++I+ Y++GT+I+SQA +V R+ AG  FY  GY G +LI+ +I +DF
Sbjct: 123 RLSDFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDF 182

Query: 184 SNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCML 241
           S+L WRL   F P  PFIINTWISG+VT++ N   +W W +GMWAFIFPLACIP+  CM+
Sbjct: 183 SSLKWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAFIFPLACIPMIGCMI 242

Query: 242 HMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV---FFWRLDMIGLLLIVCFFGCVLIPF 298
           HM++ A K  +   + S    K   +   F       FW+LD+IG LL     GC+L+P 
Sbjct: 243 HMQWKASKTPEWHALRS---EKSFYQANGFYKTMTELFWKLDIIGTLLFTACLGCILVPL 299

Query: 299 TLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIA 358
           TLAGG   +W  + +I P V+G+ V +P+  +WE K++R PL P++L++DRGV++AL I+
Sbjct: 300 TLAGGTNSKWNNSRVIGPFVLGF-VLIPILGVWEYKWARDPLIPYKLVRDRGVWAALGIS 358

Query: 359 FLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPF 418
           FLI+F +YM  DY+YTV++VAVHESVK+ATRI++L SFVS +      L + +  R KPF
Sbjct: 359 FLIDFIFYMAADYLYTVMVVAVHESVKSATRISTLSSFVSTVASPFFALLMTRCTRLKPF 418

Query: 419 ILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCL 452
           I+FG   W +S GLL ++RG   +H+GIIG+LC+
Sbjct: 419 IIFGCSLWMLSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  409 bits (1051), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 213/604 (35%), Positives = 340/604 (56%), Gaps = 28/604 (4%)

Query: 3   SVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQN 62
           SVS +++ + N S+++   +D+                +  +V+ + +   EI A Q+  
Sbjct: 7   SVSNSEKCVTNESSRSFEDEDA----------------NPANVEFSKLGESEIIAVQFDT 50

Query: 63  PFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWF 122
           P  RA++  + FL  + Y LD  +R T+   AT+SY+EHSLLST+  I  V++   Q+ F
Sbjct: 51  PKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVF 110

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
           +R SD FGR+ +   + I Y+IGT+++SQA +V+ + AG  FY  G  G  L++ +I +D
Sbjct: 111 SRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSD 170

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCM 240
           FS+L WR+L  ++P  PFII  WISG++  A N   +W W I MWAFIFPL+ +P+ C +
Sbjct: 171 FSSLKWRILYQYVPYWPFIIIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLL 230

Query: 241 LHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFID---VFFWRLDMIGLLLIVCFFGCVLIP 297
           ++M Y + K  + + +   T    + + + F+      FW LD IG++LI    GCVL+P
Sbjct: 231 VYMMYKSSKTPEWKALKERT---HIKKNQGFLKNTVFLFWELDSIGIILITVSLGCVLVP 287

Query: 298 FTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALII 357
            TLA G+ ++W ++ II   V G  V   +++ WE  ++++PL P++LL DRG+++ L +
Sbjct: 288 LTLANGVSQKWHSSKIIGTLVFG-GVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGV 346

Query: 358 AFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKP 417
           AF   F +++  D++Y VL+V+++ES   ATRI +L  FV        G+ + K RR K 
Sbjct: 347 AFFNYFTFFIACDFLYPVLLVSMNESSTTATRILNLPDFVGATLSPFYGILVAKARRLKF 406

Query: 418 FILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAK 477
            ++ G   W IS GL   YRG S +H G I +  ++G  +G               +H +
Sbjct: 407 SVVGGCAAWMISMGLFYQYRGGSESHGGAIAASVIMGM-SGLLCSNSVIVSLQAMTTHGR 465

Query: 478 MAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYT 537
           MAVIT++Y     +            WT ++P+++ +  SN TLA  AY SP+TFI  Y 
Sbjct: 466 MAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQLRKAFSNDTLADAAYESPYTFIYEYP 525

Query: 538 WETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEK--VVE 595
           W + ER AVV+AYR  Q+I+  IGLV  +P     L +RD +L D    ++ +E    + 
Sbjct: 526 WGSPERIAVVEAYRYVQRIMMTIGLVCTIPFFAFTLFMRDPELIDKSTHEEFTEDGLALS 585

Query: 596 DDDP 599
            D+P
Sbjct: 586 KDEP 589

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  389 bits (1000), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 210/610 (34%), Positives = 335/610 (54%), Gaps = 19/610 (3%)

Query: 8   DQDIHNLSTQAHTQDDSI---KKETVS-ATINSVSSLSEE--------SVKDAGVNNIEI 55
           D+ I + S+     +DS     KE ++ A  N    L +E        + +   +  +EI
Sbjct: 11  DRKIQSRSSSFDNNEDSFPNANKENLTFAEENHKQELLDEYGVPDKLRANRSLVIRKMEI 70

Query: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIA 115
             +QY + F   +  F+ FL      L+  +R  +   AT+SY  HSLLST+  + ++I+
Sbjct: 71  MRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGVVSSIIS 130

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175
           A     +AR SD+FGR+ +   +++F+++GT+I+SQA NV ++ AG  FY LG  G  ++
Sbjct: 131 AGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGTAGIQVM 190

Query: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLAC 233
           + II +DFS+L WRL   F P  P +   WI+G +   ++    W WGIGMWAFI+PL+ 
Sbjct: 191 MFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAFIYPLSS 250

Query: 234 IPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGC 293
           +P    +L +RY A K  + +++ S     +       +   FW++D++GLLL V F GC
Sbjct: 251 VPFVAYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLFVAFLGC 310

Query: 294 VLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYS 353
           +L+P TLAGG+  QW    I+ P ++G+C+ +P +ILWE K++R P+ P+++LKDRG++S
Sbjct: 311 ILVPLTLAGGVSSQWSNGKILGPFILGFCL-VPAFILWETKYARLPIAPFKMLKDRGIWS 369

Query: 354 ALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLR 413
           ALII+ L    +Y+   Y+ T+L+VAV++S   A  I +++S V          F+V++R
Sbjct: 370 ALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSYFVVRVR 429

Query: 414 RTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXR 473
           R KPFI+ G   W +S GLL +YR    +  GIIG++ L G  +                
Sbjct: 430 RLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVISSQSIT- 488

Query: 474 SHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFI 533
           +H  MA ITA+ LA   I            WT  L  ++   I +  +A + Y SP + I
Sbjct: 489 AHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQSPLSAI 548

Query: 534 ITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEK- 592
             Y W T  R A+V+AYR  Q+   ++ ++  +PL +A+L LRD +L D VA   + +  
Sbjct: 549 RVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVAHTDIKDGE 608

Query: 593 --VVEDDDPI 600
              V+ +D I
Sbjct: 609 FIAVDGNDAI 618

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  388 bits (997), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/575 (35%), Positives = 326/575 (56%), Gaps = 20/575 (3%)

Query: 54  EIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTV 113
           EI + Q+ +   + +L  + F+  +   LD  +R T+   AT+SYSEHSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAM 173
           ++   Q+ ++R SD FGRL +  V+ IFYI+GT+I+SQAT +  + AG  FY  GY G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 174 LIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPL 231
           L++ +I +DFS+L WR+   +    P+II  WISG++  A N   NW W I MWAFI+PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 232 ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVF------FWRLDMIGLL 285
           + +P+   +L+M+Y + K A+ R +      K+ +RKE    +F      FW+LD++G+L
Sbjct: 227 SALPIIFLILYMKYKSSKTAEWRSL------KEQARKERTGGLFENLVFLFWKLDIVGIL 280

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           LI    GC+L+P TLA    ++W  + II   V G C+   +++ WE KF++ PL P++L
Sbjct: 281 LITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKL 339

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           L DRG+++ L + F   F +++  DY+Y VL+V++ ES  +A RI +L  FV+       
Sbjct: 340 LSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFY 399

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
            L + K R+ K  ++ G   W +  GL   YRG SG+H G+I +  ++G  +G       
Sbjct: 400 SLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSV 458

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                   +H++MAVIT +      +            WT  +P+++ + + N TLA  A
Sbjct: 459 IVILQAMTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIA 518

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           Y SP+TFI  Y W + ER AVV++YR  Q+I+  +GL   VP     + +RD +L D   
Sbjct: 519 YASPYTFISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRDPELIDKAT 578

Query: 586 LDQMSEK---VVEDDDPIFAFLKKCIPFYNKKNGE 617
            ++ +E    V+ D++ IF+ +K     +N+ N +
Sbjct: 579 HEEFTEDGLVVLPDEENIFSQIKALFR-HNRSNKK 612

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  387 bits (995), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 207/576 (35%), Positives = 326/576 (56%), Gaps = 21/576 (3%)

Query: 54  EIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTV 113
           EI + Q+ +   + +L  + F+  +   LD  +R T+   AT+SYSEHSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAM 173
           ++   Q+ ++R SD FGRL +  V+ IFYI+GT+I+SQAT +  + AG  FY  GY G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 174 LIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPL 231
           L++ +I +DFS+L WR+   +    P+II  WISG++  A N   NW W I MWAFI+PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 232 ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVF------FWRLDMIGLL 285
           + +P+   +L+M+Y + K A+ R +      K+ +RKE    +F      FW+LD++G+L
Sbjct: 227 STLPIIFLILYMKYKSSKTAEWRSL------KEQARKERTGGLFENLVFLFWKLDIVGIL 280

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           LI    GC+L+P TLA    ++W  + II   V G C+   +++ WE KF++ PL P++L
Sbjct: 281 LITVSLGCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKL 339

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           L DRG+++ L + F   F +++  DY+Y VL+V++ ES  +A RI +L  FV+       
Sbjct: 340 LSDRGIWAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFY 399

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
            L + K R+ K  ++ G   W +  GL   YRG SG+H G+I +  ++G  +G       
Sbjct: 400 SLLVAKTRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSV 458

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                   +H++MAVIT +      +            WT  +P+++ + + N TLA  A
Sbjct: 459 IVILQAMTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIA 518

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           Y SP+TFI  Y W + ER AVV++YR  Q+I+  +GL   VP     + +R+ +L D   
Sbjct: 519 YASPYTFISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRNPELIDKAT 578

Query: 586 LDQMSEK---VVEDDDPIFAFLKKCIPF--YNKKNG 616
            ++ +E    V+ D++ IF+ +K        NKK+G
Sbjct: 579 HEEFTEDGLVVLPDEENIFSQIKALFRHNRSNKKSG 614

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/559 (36%), Positives = 309/559 (55%), Gaps = 13/559 (2%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           V  +EI  +       R  L  S FL  +AY LD   R  +   A +SY +HSLLST+  
Sbjct: 47  VKEMEIIKDVCSGNLARVFLLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQV 106

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I +V+    QI FAR SD+FGRL +  V  I Y++GT+I+SQA +V  +  G  FY  G+
Sbjct: 107 INSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGF 166

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAF 227
            G  L++ ++ +D S L WRL   F  + P II +WISGD+  A N   NW W IGMWAF
Sbjct: 167 VGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGDIVEAANPMKNWSWDIGMWAF 226

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDV--FFWRLDMIGLL 285
           IFPL+ +P    + ++ Y  H ++K +         +  ++   + V   F ++D++G +
Sbjct: 227 IFPLSSLPF---ITYLFYATHISSKTKKWKDLRNKVETHKRNIILVVKDIFNQIDIVGTV 283

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           L+    G +L+P TLAGG+ E+W    II   VIG  + L +++ WE KF+++   P+ L
Sbjct: 284 LVTAALGLILVPLTLAGGVSERWHEPGIIATLVIGIALLL-VFLFWEAKFAKNAALPFNL 342

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           LKDRGV+++++ AFL    + M  DY+Y VL+V+V+E+ K+ATRI  L +F++ +     
Sbjct: 343 LKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMACLCSVFF 402

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           GL +V ++R K F + G   W IS GL   +RG   +H+GIIG+  +LGF +  F     
Sbjct: 403 GLLVVSVQRLKVFTICGTFLWIISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSII 462

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEA 525
                   SH  MA IT LY     +            WT  +  ++ + + +  L    
Sbjct: 463 VTLQAMA-SHDNMASITGLYFMFAQVGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAV 521

Query: 526 YGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVA 585
           + SP+ FI +Y W T ER  V++AYR  QK+  ++ L+  VPLL++ L  +D KL D V+
Sbjct: 522 FASPYEFIASYAWGTKERDLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVS 581

Query: 586 LDQMSEKVVEDDDPIFAFL 604
            D       EDDDP++ ++
Sbjct: 582 SDASH----EDDDPMYTWV 596

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  371 bits (952), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/590 (36%), Positives = 324/590 (54%), Gaps = 15/590 (2%)

Query: 25  IKKETVSAT---INSVSSLSEESVKDAG---VNNIEIYAEQYQNPFLRAMLFFSLFLVAY 78
           +K+E    T   I SV+  ++ S   +G   V  +EI +        RA L  S FL  +
Sbjct: 30  LKEEKFDVTEHDIESVADSNKSSKLGSGFLKVKEMEIMSSTCSGKSARAALLASAFLCGF 89

Query: 79  AYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVS 138
            Y LD   R  +   ATSSY+EH+LLST+  I +VI+ A QI FA+ SDIFGRL +  V 
Sbjct: 90  GYYLDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVG 149

Query: 139 IIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPAL 198
            + YI+GT+I+ +A ++  +  G  FY  GY G  +++ I+ +D S   WRLL  F  + 
Sbjct: 150 TVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSW 209

Query: 199 PFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLM 256
           P II  WISGD+  + N   NW++ IGMWAF+FP++ +P    +L+    A K A+ + +
Sbjct: 210 PCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPFIIFLLYFTRQASKTAEWKEI 269

Query: 257 PSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVP 316
                   V R  Y+I   +  +D++G  L+    GC+L+P TLAGG+ + W    II  
Sbjct: 270 QGDNKEPSV-RIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIAT 328

Query: 317 EVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL 376
            V+G+ V+   ++ W+IKF+++ + P++LLKDRGV+++L  A L    +    DY+Y VL
Sbjct: 329 IVVGF-VSFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVL 387

Query: 377 IVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHY 436
           +V+V+ES K+ATRI  L +FV+       GL +V+ +R K + + G+C W +S GL  HY
Sbjct: 388 LVSVNESSKSATRILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHY 447

Query: 437 RGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXX 496
           RG + +H+GIIG+  +LG  +  F             SH  MA IT LY     I     
Sbjct: 448 RGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMT-SHKNMASITGLYFMFAQIGSASG 506

Query: 497 XXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKI 556
                  WT  +  ++ + + + +LAA A+ SP+ FI  Y W T ER  ++ AYRE QK 
Sbjct: 507 ASISGAIWTQTMYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIYAYREVQKK 566

Query: 557 LCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVEDDDPIFAFLKK 606
             ++ LV   PL +  L  +D KL D V     +E    D+DP+  ++ K
Sbjct: 567 TMLVSLVLTGPLFLLILFTKDRKLGDNVT----AETTQSDEDPMLTWILK 612

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  361 bits (926), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/576 (36%), Positives = 319/576 (55%), Gaps = 16/576 (2%)

Query: 50  VNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNC 109
           +  +EI +   +    +++L  +  +  ++Y LD  +R T+   AT+S+S+HSLL+T+N 
Sbjct: 64  MKELEIVSSFCKEWHFQSILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINV 123

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGY 169
           I +V++ A Q++FAR SD FGRL + G   + YI+GT+++SQ+ NV+ +  G  FY  GY
Sbjct: 124 INSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGY 183

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAF 227
           TG  L++ I+ +DFS L WR   +  P   +II TW+SG++    N   NW W I MWAF
Sbjct: 184 TGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWAF 243

Query: 228 IFPLACIPLACCMLHMRYLAHKNAKDRLMPSFT--IPKDVSRKEYFIDVFFWRLDMIGLL 285
           IFPL  IPL   +++M Y A +  + + + S T  +P  V  KE      FW LD+ G+L
Sbjct: 244 IFPLTTIPLVGFLVYMFYKASRTDEWKELRSVTKKMPTPVYIKE-----VFWNLDIPGVL 298

Query: 286 LIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWEL 345
           LI    GC+LIP T++GG  E+W+ +  I    +G  V  P+++LWE K ++ P+     
Sbjct: 299 LIAISLGCILIPLTVSGGETEEWKDSRNIGVLCLG-SVLFPIFLLWEGKIAKRPVLALTY 357

Query: 346 LKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTIL 405
           LKDRGV++ L  +F ++  + +  DY+Y VL+V  ++S  A+ RIT L SF  V+     
Sbjct: 358 LKDRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFT 417

Query: 406 GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXX 465
           GL + + +  K   + G   ++I+FGL   YRG S   AGII     +GF +G       
Sbjct: 418 GLLITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSG-ISTYPL 476

Query: 466 XXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQ-TLAAE 524
                   SH K+A++TAL+     +            WT V+   IS+ +  +  +A  
Sbjct: 477 MVSLQAVSSHTKIAIVTALFYTFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALA 536

Query: 525 AYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDV- 583
           AY SP+TF+  Y WET++R AVV AY   QKIL ++ L+   PL + A+M+RD +L    
Sbjct: 537 AYASPYTFVTKYGWETSQRMAVVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSD 596

Query: 584 VALDQMSEKVV---EDDDPIFAFLKKCIPFYNKKNG 616
           VAL    +  V   + +D I+    K   F  KK G
Sbjct: 597 VALSSSDDSHVIISKHEDKIYEAFCKFFSFSTKKEG 632

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  305 bits (781), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 160/438 (36%), Positives = 250/438 (57%), Gaps = 9/438 (2%)

Query: 149 ESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISG 208
            S   +V+ + AG  FY  GY G  LI+ +I +DFS L WR+   +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 209 DVTAAVN--GNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVS 266
           ++  A     NW W I MWAFIFPL+ +PL C ++   YL  K+ K     +        
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPLYCLII---YLKMKSVKTPEWKALKERAHSV 124

Query: 267 RKEYFIDV--FFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVA 324
           ++ +F ++   FW LD+IG++LI    GC+L+P TLA G  E+WR++ II   V G  + 
Sbjct: 125 KRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLF 184

Query: 325 LPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESV 384
           L +++ WE  ++ +PL P++LLKDRG+++ L +AF   F +Y+  D++Y VL+V+++ES 
Sbjct: 185 L-IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMNESS 243

Query: 385 KAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHA 444
            +A RI +L  FV+        L + K +R K  ++ G   W +S GL   +RG  G+H 
Sbjct: 244 TSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYGSHG 303

Query: 445 GIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXW 504
           G+I +  ++GF +G               +H++MAV+T ++     I            W
Sbjct: 304 GVISASVIMGF-SGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGASVSGGVW 362

Query: 505 TNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVF 564
           T  +P R+ + + N TLAAEAY SP++FI +Y W T ER AVV+AY+  Q+I+ I+GL+ 
Sbjct: 363 TQTMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVGLIC 422

Query: 565 CVPLLMAALMLRDHKLED 582
            +PL   +L +RD +L D
Sbjct: 423 TIPLFAFSLFMRDPELID 440

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  300 bits (768), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 162/441 (36%), Positives = 242/441 (54%), Gaps = 9/441 (2%)

Query: 119 QIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEI 178
           Q+  AR SD FGRL I   S + YI  +++ES A N++ + AG   Y +G+    +++ +
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 179 IATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN--GNWKWGIGMWAFIFPLACIPL 236
           + +DFS+L WR+L  F P    ++  WISGDV  ++    +W WGIG WAF FPLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 237 ACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVF--FWRLDMIGLLLIVCFFGCV 294
            CCM++M Y   K+ + +L   F   K ++  +    V   F ++D IG L+     GCV
Sbjct: 122 ICCMVYMIYTTRKSDQWKL---FNQEKPLNEAKLLTRVMRIFHQVDFIGTLIFSVALGCV 178

Query: 295 LIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSA 354
           L+P TLAGG   +W  +  IVP V+G  V    YI+WE   + +P  P++LLKDRG++  
Sbjct: 179 LVPLTLAGGYSSKWSHSDSIVPLVVG-SVLFVFYIVWESFMASYPALPFKLLKDRGIWIP 237

Query: 355 LIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRR 414
           ++  FL++  +Y   DYMY VL+VA++ES K+AT I SL  FV+ +      + L    R
Sbjct: 238 ILAGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGR 297

Query: 415 TKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRS 474
            K + + G   W +S GL   YR   G+H G++ ++ LLG     F              
Sbjct: 298 LKWYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGL-GRTFTQFPLLTTMQARAP 356

Query: 475 HAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFII 534
           H KMA +T L+    ++            WT  +P ++ + + +  LA  AY SP+TFII
Sbjct: 357 HTKMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFII 416

Query: 535 TYTWETAERQAVVKAYRETQK 555
           +Y W T+ER AVV AY+  QK
Sbjct: 417 SYPWGTSERLAVVLAYKNVQK 437

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  251 bits (641), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 155/541 (28%), Positives = 274/541 (50%), Gaps = 22/541 (4%)

Query: 65  LRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFAR 124
           L+  L  +LFL  Y  GL G I  + Q  A +S+ +HS + ++N +K+++A+   + +AR
Sbjct: 62  LKTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYAR 121

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFS 184
            SD FGR+     +++ Y IG +I +     +   AG    Q GY+G  L+   +  D S
Sbjct: 122 ISDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLS 181

Query: 185 NLNWRLLALFIPALPFIINTWISGDVTAAVNGN-----WKWGIGMWAFIFPLACIPLACC 239
            L  R  A+ I  +P IINTW+SG++ ++V GN     W+WG G++  I P++ + L   
Sbjct: 182 GLRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLP 241

Query: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWR----LDMIGLLLIVCFFGCVL 295
            ++ +Y++ ++ K   +P    P  +  K   +    W+    +++IG++L   F   VL
Sbjct: 242 YVYAQYISWRSGK---LP----PLKLKEKGQTLRQTLWKFADDINLIGVILFTAFLVLVL 294

Query: 296 IPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSAL 355
           +P T+AGG   +WR  HII   V+G C+   ++++WE+KF+++P  P   L D  +Y AL
Sbjct: 295 LPLTIAGGATSKWREGHIIAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVAL 353

Query: 356 IIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
           ++ F+      ++ +Y+ TVL+VA  ES  +A RI  LY+F+   T  ++G+ L      
Sbjct: 354 LMEFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHP 413

Query: 416 KPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSH 475
           K F++ G     I  GLL  YR      +G+IG+  ++G   G               +H
Sbjct: 414 KVFVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-TH 472

Query: 476 AKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIIT 535
            +MA +T L ++ Y I            WT  L   + + + + +L    Y SP  ++  
Sbjct: 473 NEMATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKK 531

Query: 536 YTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRD---HKLEDVVALDQMSEK 592
           Y   +  R  ++++Y + Q++L I+ + F     +    LR    +K + + A ++  EK
Sbjct: 532 YPIGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLCFFLRGFTVNKKQSLSAEEREKEK 591

Query: 593 V 593
           +
Sbjct: 592 L 592

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 146/510 (28%), Positives = 256/510 (50%), Gaps = 19/510 (3%)

Query: 65  LRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFAR 124
           L+  L  +LFL  Y  GL G I  + Q  A +S+ +HS + ++N +K+++A+   + +AR
Sbjct: 61  LKITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYAR 120

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFS 184
            SD FGR+     +++ Y +G +I +     A   AG    Q GY+G  L+   +  D S
Sbjct: 121 MSDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLS 180

Query: 185 NLNWRLLALFIPALPFIINTWISGDVTAAVNG-----NWKWGIGMWAFIFPLACIPLACC 239
            L  R  A+ I  +P IINTW+SG++ ++V G     NW+WG G++  I P + + L   
Sbjct: 181 GLRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLP 240

Query: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWR----LDMIGLLLIVCFFGCVL 295
             + +Y+  +N     +P    P  +  K   +    W+    +++IG++L   F   +L
Sbjct: 241 YAYAQYIGWRNGT---LP----PYKLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLL 293

Query: 296 IPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSAL 355
           +P T+AGG   +WR  +II   V+G C+   ++++WE++F+++P  P   L D  +Y AL
Sbjct: 294 LPLTIAGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVAL 352

Query: 356 IIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
           ++ F+      ++ +Y+ TVL+VA  ES  +A RI  LY+F+   T  ++G+ L      
Sbjct: 353 LMEFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHP 412

Query: 416 KPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSH 475
           K F++ G     +  GLL  YR      +G+IG+  ++G   G               +H
Sbjct: 413 KLFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-TH 471

Query: 476 AKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIIT 535
            +MA +T L ++ Y I            WT  L   + + + +  L    Y SP  ++  
Sbjct: 472 NEMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGSN-LGMSIYKSPLNYLKK 530

Query: 536 YTWETAERQAVVKAYRETQKILCIIGLVFC 565
           Y   +  R  +V++Y + Q++L I+ + F 
Sbjct: 531 YPIGSEVRDQMVESYSKIQRLLIIVSISFA 560

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  216 bits (550), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 144/534 (26%), Positives = 261/534 (48%), Gaps = 20/534 (3%)

Query: 8   DQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRA 67
           D+     S +A T+DD    ++  + I  + +++   + D G  +   +   +    L+ 
Sbjct: 9   DKSTAGYSEKAETEDD----KSTGSGIRRIDAVNR-VLSDYG--SFTAFGVTFST--LKT 59

Query: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASD 127
           +L  +LFL  Y  GL G I  + Q  A + + +HS + ++N +K+++++   + +AR SD
Sbjct: 60  VLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARMSD 119

Query: 128 IFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLN 187
            FGR+     +++ Y +G +I +   N     AG    Q GY+G  L+   +  D S L 
Sbjct: 120 RFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSGLR 179

Query: 188 WRLLALFIPALPFIINTWISGDVTAAVNGN-----WKWGIGMWAFIFPLACIPLACCMLH 242
            R  A+ I  +P IINTW+SG++ +++ G+     W+WG G++  I P + + L     +
Sbjct: 180 DRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPYAY 239

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAG 302
            +Y++ +N     +P F + +        I  F   +++IG++L   F   VL+P T+AG
Sbjct: 240 AQYISWRNGT---LPPFKLKEKGQNLRQTIWKFAEDINLIGIILFTAFLVLVLLPLTIAG 296

Query: 303 GMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLIN 362
           G   +WR  +II   V+G  +   ++++WE++F+++P  P   L D  +Y AL++ F+  
Sbjct: 297 GATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFVWR 355

Query: 363 FCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFG 422
               ++ +Y+ TVL+VA  ES  +A RI  LY+F+   T  ++G+ L      K F++ G
Sbjct: 356 LGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKVFVVAG 415

Query: 423 ICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVIT 482
                +  GLL  YR      +G+IG+  ++G   G               +H +MA +T
Sbjct: 416 SLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKEMATVT 474

Query: 483 ALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITY 536
            L ++ Y I            WT  L   + + +    L    Y SP  ++  Y
Sbjct: 475 GLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGYD-LGMSIYKSPLNYLKKY 527

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  216 bits (551), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 159/563 (28%), Positives = 271/563 (48%), Gaps = 18/563 (3%)

Query: 13  NLSTQAHTQDDSIKKETVSAT-----INSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRA 67
            L  + H ++D  K  ++S T      N V  +   +   +   +   +  ++Q   L+ 
Sbjct: 5   ELLKKDHVEEDDDKSSSLSQTNEPPLSNGVRRMDAVNATLSRAGSFTAFGVRFQT--LKI 62

Query: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASD 127
            L  +LFL  Y  GL G I  + Q  A +++ +   + ++N +K+V+AAA  + +AR SD
Sbjct: 63  ALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARLSD 122

Query: 128 IFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLN 187
            FGR+     +++ Y +G +I +         AG    Q GY+G  L+   +  D S L 
Sbjct: 123 RFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISGLR 182

Query: 188 WRLLALFIPALPFIINTWISGDVTAAVNG-----NWKWGIGMWAFIFPLACIPLACCMLH 242
            R  A+ I  +P IINTW+SG++  ++ G      W+WG G++  I P + + L     +
Sbjct: 183 DRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPYAY 242

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAG 302
            +YLA +  +   +P F   K     +  +      +++IG++L   F   VL+P TLAG
Sbjct: 243 AQYLAWREGR---LPQFEFRKQGQSWKQALWKLTEDVNLIGIVLFTAFLVLVLLPLTLAG 299

Query: 303 GMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLIN 362
           G   +W+  HII   V+G C  + L+ +WE+  ++ P  P   L D  +Y AL++ F   
Sbjct: 300 GASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYVALLMEFAWR 358

Query: 363 FCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFG 422
               ++ +Y+ TVL+VA  ES  +A RI  LY+F+   T  ++G+ L      KPFI+ G
Sbjct: 359 LALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPHPKPFIVAG 418

Query: 423 ICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVIT 482
                +  GLL  YR      +G+IG+  ++G  AG               SH +MAV T
Sbjct: 419 SLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGI-AGSMVRFPMWTLVHASTSHEEMAVAT 477

Query: 483 ALYLACYNIXXXXXXXXXXXXWTNVLPDRISRGISNQTLAAEAYGSPFTFIITYTWETAE 542
            L ++ Y I            WT  L   + + + ++   A  Y SP +++  Y   +  
Sbjct: 478 GLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYLTKYPLGSEV 536

Query: 543 RQAVVKAYRETQKILCIIGLVFC 565
           R  ++++Y E Q++L I+ + F 
Sbjct: 537 RNEILESYSEIQRLLIIVSISFA 559

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  192 bits (487), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 161/609 (26%), Positives = 270/609 (44%), Gaps = 40/609 (6%)

Query: 4   VSTTDQDIHNLSTQA----HTQDDSIKKETVS--ATINSVSSLS-----EESVKDAGVNN 52
           VS TD     L+ Q       + D+ +K  VS   ++  ++S +     E+ +K  GV  
Sbjct: 5   VSITDSISGKLNVQEKYHEEAKSDAAEKNLVSIDGSLKQITSATSCYDGEKIIKTRGVTR 64

Query: 53  IEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKT 112
           IE+  E+     +R +L  S+FL +    LD    Y +Q  ATSS++ HS+LST+    +
Sbjct: 65  IEVVREKMSTR-VRWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANS 123

Query: 113 VIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGA 172
           VI A  + + A+ SD+  R     V ++ Y+IG VI + +  +A +  G  F  +G +G 
Sbjct: 124 VIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGI 183

Query: 173 MLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA-VNGNWKWGIGMWAFIFPL 231
            L+  +I  D + L WR     + ++P+++ TWISG +    +N NW+WG GM+A I P+
Sbjct: 184 SLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPV 243

Query: 232 ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSR-----------KEY--FIDVFFWR 278
           A  P    +L M YL H+  K   +P  + P    R           +EY   + V    
Sbjct: 244 ALTP---AILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIE 300

Query: 279 LDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRH 338
           +D  GL+L+   F  +L+P +L    +  W    +I  EV+G  + L  Y+++E+ F+  
Sbjct: 301 IDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG-GIFLISYVVFEVFFAPF 359

Query: 339 PLTPWELLKDRGVYSALIIAFLINFCWYMQ----GDYMYTVLIVAVHESVKAATRITSLY 394
           PL P  +L +R     +II F+     Y        Y + VL ++    V  +   T   
Sbjct: 360 PLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGL 419

Query: 395 SFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHA-GIIGSLCLL 453
            F  V+ G +   F     R K F + GI    I  GL +      G+   G++ +  ++
Sbjct: 420 CFFGVVWGALFRGF----HRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVV 475

Query: 454 GFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDRIS 513
                                H  MA   ++     +I            WT+ LP  +S
Sbjct: 476 TNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALS 535

Query: 514 RGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAAL 573
           + + ++  AA A+    T +    W +A R+  + AY+E    L  +GL     + + AL
Sbjct: 536 KYVPDREKAA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVAL 594

Query: 574 MLRDHKLED 582
              ++ L D
Sbjct: 595 FQTNYYLGD 603

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  186 bits (473), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 163/611 (26%), Positives = 267/611 (43%), Gaps = 44/611 (7%)

Query: 4   VSTTDQDIHNLSTQAHTQDDSIKK-------------ETVSATINSVSSLSEESVKDAGV 50
           VS TD     L+ Q    D++ K              + VS++I S +   E+ VK  GV
Sbjct: 5   VSMTDSTSGQLNFQEKLHDEARKDAAEKDLISVNGCLQQVSSSITSCNG--EKIVKTRGV 62

Query: 51  NNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCI 110
             IE+  E+     +  +L  S+FL ++   LD    Y +Q  ATSS++ HS+LST+   
Sbjct: 63  TRIEVVREKMSTKVIW-ILGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIA 121

Query: 111 KTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYT 170
            +VI A  + + A+ SD+  R     V ++ Y+IG VI + + N++ +  G  F  +G +
Sbjct: 122 NSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQS 181

Query: 171 GAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA-VNGNWKWGIGMWAFIF 229
           G  L+  +I  D + L WR     + ++P+++ TWISG +    +N NW+WG GM+A I 
Sbjct: 182 GISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIIT 241

Query: 230 PLACIPLACCMLHMRYLAHKNAKDRLMPSFTIP---KDVSRKEYFIDVF--FWRL----- 279
           P+A  P    +L M YL H   K   +P    P   K V   E  I  F  +W L     
Sbjct: 242 PVALTP---AILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSL 298

Query: 280 ---DMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFS 336
              D  GL+L+   F  +L+P +L    +  W    +I  EV+G  + L  Y+++E+ F+
Sbjct: 299 IEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG-GILLISYVVFEVFFA 357

Query: 337 RHPLTPWELLKDRGVYSALIIAFLINFCWYMQ----GDYMYTVLIVAVHESVKAATRITS 392
             PL P  +L +R     +II F+     Y        Y + VL ++  + V  +   T 
Sbjct: 358 PFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTM 417

Query: 393 LYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIH-YRGDSGAHAGIIGSLC 451
              F  V+ G +   F     R K F + GI    I  GL +   + D     G++ +  
Sbjct: 418 GLCFFGVVWGALFRGF----HRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAAL 473

Query: 452 LLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLPDR 511
           ++                     H  MA   ++     +I            WT+ LP  
Sbjct: 474 VVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGA 533

Query: 512 ISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMA 571
           + + + ++  A  A+    T I    W +  R+  + AY+E    L  +GL     + + 
Sbjct: 534 LFKYVPDKEKAV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSSIMFVV 592

Query: 572 ALMLRDHKLED 582
           AL   ++ L D
Sbjct: 593 ALFQTNYYLGD 603

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  179 bits (453), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 146/553 (26%), Positives = 247/553 (44%), Gaps = 21/553 (3%)

Query: 45  VKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLL 104
           +K  GV  IE+  E+     +  +L  S+ L A+   LD    Y +Q  ATSS++ HS+L
Sbjct: 58  IKTRGVTRIEVVKEKMSTK-VTWILAASILLTAWIAALDATTTYNYQPYATSSFNRHSML 116

Query: 105 STVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCF 164
           ST+    +VI A  + + A+ SD+  R     V +I Y+IG +I + +  +A +  G  F
Sbjct: 117 STLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVF 176

Query: 165 YQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGD-VTAAVNGNWKWGIG 223
             +G +G  L+  +I  D ++L WR     + ++P+++ TWISG  V   ++ NW+WG G
Sbjct: 177 IAVGQSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYG 236

Query: 224 MWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIP---KDVSRKEYFIDVF--FWR 278
           M+A I P+A  P    +L M YL H+  K   +P  + P   K    +E  I  F  +W+
Sbjct: 237 MFAIITPVALTP---AILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQ 293

Query: 279 L--------DMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYIL 330
           L        D  GL+L+   F  +L+P +L    +  W+   +I  EVIG  + L  Y++
Sbjct: 294 LLKTSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIG-GIFLISYVI 352

Query: 331 WEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRI 390
           +E+ F+  PL P  +L +R     ++I F+     Y    +  +   V ++ S K    +
Sbjct: 353 FEVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYL 412

Query: 391 TSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIH-YRGDSGAHAGIIGS 449
           ++  +      G + G+      R K F + GI    I  GL +   + D     G+I +
Sbjct: 413 SNTTTMGLCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVA 472

Query: 450 LCLLGFCAGFFXXXXXXXXXXXXRSHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVLP 509
             ++                     H  MA   ++     +I            WTN LP
Sbjct: 473 ALIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELP 532

Query: 510 DRISRGISNQTLAAEAYGSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLL 569
             + + + ++  A   + S  T I    W +  R+  + AY+E    L  +GL     + 
Sbjct: 533 GALLKYVPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMF 591

Query: 570 MAALMLRDHKLED 582
           + AL   +  L D
Sbjct: 592 IVALFQTNFYLGD 604

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  133 bits (335), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 141/589 (23%), Positives = 243/589 (41%), Gaps = 50/589 (8%)

Query: 27  KETVSATINSVSSLSEESVKDAGVNNI------EIYAEQYQNPFLRAMLFFSL------- 73
           K  V    +  + +SE++V     +N+      E+  E+ Q    +A     L       
Sbjct: 6   KSVVGVKSSKPAQVSEKTVSSEAEDNVLPSSDDEVINEELQKGVQKAQAMTQLWKKRDLI 65

Query: 74  ----------FLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFA 123
                     F++A++ G+ G    T     TSS+ +HSL +   C       + QI   
Sbjct: 66  AIFIIIWVIQFVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALC 121

Query: 124 RASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDF 183
           ++ DI+GR       ++   IGT++ +   NV  + A   FY +GY G    I I   D 
Sbjct: 122 QSIDIWGRAQGFAFMVLSITIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADT 181

Query: 184 SNLNWRLLALFIPALPFIINTWISGDVTAAVNG--NWKWGIGMWAFIFPLACIPLACCML 241
           + L  R   L   +  +I   W  G    ++     ++WG G+WA I P+ C PL     
Sbjct: 182 TKLKNRAFILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPL---FG 238

Query: 242 HMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFW--RLDMIGLLLIVCFFGCVLIPFT 299
            + Y   K  K  L+P     ++ S + ++  V F+    D+IG+ ++       L+ F 
Sbjct: 239 LLYYYQQKAVKVGLIPK----REKSGRTFWQSVVFYGKEFDVIGIFILALGLALFLLGFN 294

Query: 300 LAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAF 359
           L    K +WR+  II   +IG  + +   I WE  F+     PWELL +R V     +A 
Sbjct: 295 LYSYQKNEWRSPLIICFLIIGGLLIISFGI-WEY-FAPVSFIPWELLTNRTVIFTYSMAA 352

Query: 360 LINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFI 419
            +   +Y+   Y +       + S   AT IT++YS  S     ++G+ +    R K   
Sbjct: 353 AMYCSFYIWDSYFFRHH-CRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIA 411

Query: 420 LF-GICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFXXXXXXXXXXXXRSHAKM 478
           LF G+    +  GL+I YR        I+     + F  G                    
Sbjct: 412 LFWGVPITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVSAQQHIP 471

Query: 479 AVITALYLACYNIXXXXXXXXXXXXWTNVLPDRISR----GISNQTLAAEAYGSPFTFII 534
           AV+ A+      I            WT + P +++      + +Q L+   YGS  T  I
Sbjct: 472 AVL-AMEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLS--IYGS-LTVQI 527

Query: 535 TYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDV 583
           +Y   TA R+A+ ++Y +TQ+++CI         + + L+ ++  ++++
Sbjct: 528 SYPRGTAAREAIDRSYGDTQRLMCIAATCIYATCIFSTLLWKEVNVKEI 576

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  115 bits (289), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 82/146 (56%), Gaps = 4/146 (2%)

Query: 474 SHAKMAVITALYLACYNIXXXXXXXXXXXXWTNVL-PDRISRGISNQTLAAEAYGSPFTF 532
           SH  MA +TAL    Y I            WT  L P+ + R   N ++A  AY SP+TF
Sbjct: 15  SHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGNVSMATAAYASPYTF 74

Query: 533 IITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALD---QM 589
           I TYTW T+ER+AVV+AY+  QK+  ++ LVFC PLLM +L LRD KL D VA D     
Sbjct: 75  ITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDAKLTDKVAHDGEIPE 134

Query: 590 SEKVVEDDDPIFAFLKKCIPFYNKKN 615
            E   +D+DPI  + K C+  + K  
Sbjct: 135 GEYTTKDEDPIADWFKACVGKFKKSK 160

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score =  105 bits (261), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (62%)

Query: 54  EIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTV 113
           E+ + Q+ +   R ++  + FL  + + LD  +R T+   AT+SY+EHSLLST+  I  V
Sbjct: 45  ELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAV 104

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAM 173
           ++   Q+ F+R SD FGRL +  V+ I YIIGT+++SQA +V+ + AG  FY  GY G  
Sbjct: 105 VSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGYVGVS 164

Query: 174 L 174
           L
Sbjct: 165 L 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 143/324 (44%), Gaps = 25/324 (7%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R ++I G    L +S++ + IG++I + +  +     G      G +G   +  ++ T 
Sbjct: 64  GRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTS 123

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGN--WKW------GIGMWAFIFPLACI 234
               N+R + +   A+ ++I   +   +  A N +  W+W       IG +AFI    C 
Sbjct: 124 IVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFISLAFCC 183

Query: 235 PLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCV 294
                 L  ++L  K         + I K    K+ F  +  ++LDMIG++L    F  +
Sbjct: 184 ASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKKVF-QILVFKLDMIGIILSSAGFTLL 242

Query: 295 LIPFTLAGGMKEQWRTAHIIVPEVIG------WCV----ALPLY-ILWEIKFSRHPLTPW 343
           ++  +  GG    W ++ II    +G      +C      LPL  + ++ K++R PL  W
Sbjct: 243 MLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYAR-PLLTW 300

Query: 344 ELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL-IVAVHESVKAATRITSLYSFVSVITG 402
           ++  + G++++ I  F   F + +Q  Y+  +  +V    S+ A+  +  L S  ++IT 
Sbjct: 301 KIASNAGIFTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWEL-SIPAMITT 359

Query: 403 TILGLFLVKLRRTKPFILFGI-CG 425
                   K    KP I+FG+ CG
Sbjct: 360 MATAYLNAKYGIIKPAIVFGVLCG 383

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/354 (23%), Positives = 153/354 (43%), Gaps = 39/354 (11%)

Query: 120 IWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEII 179
           +W   A    G  T +  +I+ + IG++I + A ++     G     +G +G   +  +I
Sbjct: 112 LWGRIAFSFLGFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVI 171

Query: 180 ATDFSNLNWR-LLALFIPA---LPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIP 235
            +   +   R  +  F+ A   +  +I  +I G  T+ V   W + I +     P+  + 
Sbjct: 172 GSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHVTWRWCFWINL-----PVGAVA 226

Query: 236 LACCMLHMRYLAHKNAKDRLMPSFTIPKDVS---RKEYFIDVF---FWRLDMIGLLLIVC 289
           L        ++ +   K +++ +    K++S   +K  F D+     ++LD+I  +LI  
Sbjct: 227 LVI----FTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLFKLDIIEFMLISA 282

Query: 290 FFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVAL-----------PLYILWEIKFSRH 338
              C+L+ FT  GG + +W +  II+  VIG C+ +            L I+        
Sbjct: 283 GIVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQ 341

Query: 339 PLTPWELLKDRGVYSALIIAFLINFC-WYMQGDYMYTVLIVAVHESV--KAATRITSLYS 395
           PL  W+ L+ RG+++A +  F   FC  YM     Y      ++ S   KA+  + ++  
Sbjct: 342 PLISWKNLRIRGIFTASMTTFF--FCIGYMSQTVYYVQFFQLIYNSSPWKASIHLIAVM- 398

Query: 396 FVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGL--LIHYRGDSGAHAGII 447
             +V+T  + G    K    KP  + G+C   I  GL  L+    +S  H G++
Sbjct: 399 IPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQHIGLL 452

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/339 (21%), Positives = 132/339 (38%), Gaps = 17/339 (5%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R ++I G    L +S+I + +G++I + + ++    +G      G +G   +  ++ T 
Sbjct: 64  GRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTS 123

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGN--WKWGIGMWAFIFPLACIPLACCM 240
               N R   +   A  ++I   +   +  A N +  W+W   +   I   A I LA C 
Sbjct: 124 IVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFALIILAFCN 183

Query: 241 LHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF----IDVFFWRLDMIGLLLIVCFFGCVLI 296
                L   +   ++    +   D   K  F      VF ++LDMIG+ L    F  +++
Sbjct: 184 TSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAGFTLLML 243

Query: 297 PFTLAGGMKEQWRTAHIIVPEVIG------WCVA----LPLYILWEIKFSRHPLTPWELL 346
             +  GG    W ++ II    +G      +C      LPL  L        PL  W + 
Sbjct: 244 GLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRTKPLLTWSIA 302

Query: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406
            + G++++ +  F   F + +Q  Y+  +  + +      A+      S  ++I    + 
Sbjct: 303 SNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAIIATMAIA 362

Query: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAG 445
               K    KP I+FG+    +  GL     G S    G
Sbjct: 363 YLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKSSQSIG 401

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 86/368 (23%), Positives = 156/368 (42%), Gaps = 52/368 (14%)

Query: 120 IWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEII 179
           IW   A+ I  + T+L  +I+ + IG++I + A+++     G     +G  G   +  +I
Sbjct: 115 IWGRIATPIGFKATML-FAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVI 173

Query: 180 ATDFSNLNWRLLALFIPALPF----IINTWISGDVTAAVNGNWKW---------GIGMWA 226
            +     + R + + I +  F    ++  ++ G  T++V   W+W         G+  + 
Sbjct: 174 GSTLVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSVT--WRWCFYINLPIGGLAFFL 231

Query: 227 FIF-----------PLACIPLACCMLH--MRYLAHKNAKDRLMPSFTIPKDVSRKEYFID 273
           F+             +  IP         +R +AH + K +        K  S K+ FI+
Sbjct: 232 FVLFYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVK-----NFNKSNSWKKLFIE 286

Query: 274 VFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAH----------IIVPEVIGWCV 323
           + F   D+I L+L    F  +L+ FT  GG +  W +            +++  +I    
Sbjct: 287 LVFM-YDVIELVLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFF 344

Query: 324 ALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHES 383
             P + L +   S  PL  W  +K  GV++  I  FL+   +  Q  Y+     +  ++S
Sbjct: 345 VFPKFNLVKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDS 404

Query: 384 V-KAATR-ITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGL--LIHYRGD 439
             KAA   IT + S  +VIT  + G+   K R+ KP I+       +  GL  L++    
Sbjct: 405 AWKAAVHLITCVIS--TVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNAS 462

Query: 440 SGAHAGII 447
           S AH G++
Sbjct: 463 SSAHIGLL 470

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/339 (20%), Positives = 135/339 (39%), Gaps = 29/339 (8%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R ++I G    L +S+I + IG++I + + ++A   +G      G +G   +  ++ T 
Sbjct: 64  GRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTS 123

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
               N R + +   A+ ++I   +   +  A N +  W    W F   L     A  +L 
Sbjct: 124 IVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSW---RWCFYINLPIGAFAFIILA 180

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEY--FIDVFFW---------RLDMIGLLLIVCFF 291
               + +  +   +PS    K +   +Y   +   FW         +LDM+G++L    F
Sbjct: 181 FCNTSGEPHQKMWLPSKI--KKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSSAGF 238

Query: 292 GCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR-----------HPL 340
             +++  +  GG    W +  II    +G  + L L+  ++  F              PL
Sbjct: 239 TLLMLGLSF-GGNNFPWNSGIIICFFTVG-PILLLLFCAYDFHFLSLSGLHYDNKRIKPL 296

Query: 341 TPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVI 400
             W +  + G++++ I  FL  F + +Q  Y+  +  +   +    A+      S  ++I
Sbjct: 297 LTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMI 356

Query: 401 TGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGD 439
               +     K    KP I+FG+    +  GL     G+
Sbjct: 357 ATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGE 395

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/341 (21%), Positives = 128/341 (37%), Gaps = 31/341 (9%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + + G    L  SI+ +  G+++   A ++            G +G   ++  + T 
Sbjct: 63  GRIASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTS 122

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
                 R   + +  + +++       V   +  +  W    W F   L    +A   L 
Sbjct: 123 IVEEKHRARVITVLGIAYMLAEGAGPFVGGGLAEHVSW---RWCFYVNLPIGGVALAALG 179

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWR---------LDMIGLLLIVCFFGC 293
             Y     A  R +  F +          +   FWR         LD+ GL L    F  
Sbjct: 180 WGYNPAGRAPGRALARFWVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSGGFAL 239

Query: 294 VLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEI-----------KFSRHPLTP 342
           V++  T  GG +  WR+A I+   V G  + L L++L++             +   PL P
Sbjct: 240 VMLALTF-GGNQYAWRSATIVCMFVFGAAL-LALFMLYDFVVLPRVGARIAGYEPLPLVP 297

Query: 343 WELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATR---ITSLYSFVSV 399
           W L  +  V ++ +  F   F + +Q  Y+     + V++    A+      SL + VSV
Sbjct: 298 WRLAANVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSV 357

Query: 400 ITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           I   ++     +    KP +L G+   F+  GLL   R D+
Sbjct: 358 IASAVVN---ERFGVVKPLVLAGVVMGFVGSGLLTLVRSDT 395

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 92/399 (23%), Positives = 166/399 (41%), Gaps = 51/399 (12%)

Query: 97  SYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVA 156
           SYSE   L T   +   + A   IW   A+ I  + T+L  +I+ + +G++I + A ++ 
Sbjct: 109 SYSEIGWLFTGYSLPNALLAL--IWGRIATPIGFKRTML-FAIVIFEVGSLISALANSMN 165

Query: 157 RFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPF----IINTWISGDVTA 212
               G     +G  G   +  +I ++    + R + + I +  F    ++  ++ G  T+
Sbjct: 166 VLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAIASVVGPFLGGVFTS 225

Query: 213 AVNGNWKWGI-------GMWAFIFPLACIP---------------LACCMLHMRYLAHKN 250
            V   W+W         G+  F+F + C P                +  +  +R + H  
Sbjct: 226 RVT--WRWCFYINLPIGGLTFFLFLMFCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHL 283

Query: 251 AKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRT 310
           +K +      + K  S K    ++ F   D+I  +L    F  +L+ FT  GG +  W +
Sbjct: 284 SKVK-----ELGKRTSWKILLTELVFM-YDIIEFVLCTAGFTSILLAFTF-GGNRYAWDS 336

Query: 311 AHIIVPEVIGWCVAL----------PLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFL 360
           A IIV  VIG  + +          P + + +      PL  W  +K  G+++  I  FL
Sbjct: 337 AEIIVLFVIGVILVILAAVYDFFVFPKFDVVKTAPRYQPLMSWRNIKRPGIFTVNIALFL 396

Query: 361 INFCWYMQGDYMYTVLIVAVHESV-KAATRITSLYSFVSVITGTILGLFLVKLRRTKPFI 419
           +   +  Q  Y+     +  ++S  KAA  + +     +VIT  + G+   K R+ KP I
Sbjct: 397 LCTGYISQFTYIVQYFQLIYNDSAWKAAVHLVACI-IPTVITSVVCGVITDKTRQIKPII 455

Query: 420 LFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAG 458
           +       +  GLL     +S +++  IG L L G   G
Sbjct: 456 VISSILGVVGAGLLTLLN-NSASNSAHIGLLILPGIAFG 493

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/350 (22%), Positives = 143/350 (40%), Gaps = 37/350 (10%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + + G    L  SI+ +  G+++ + AT++     G      G +G   ++  + T 
Sbjct: 63  GRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTR 122

Query: 183 FSNLNWRLLALFIPALPFII----NTWISGDVTAAVNGNWKWGIGMWAFI-FPLACIPLA 237
             +   R   + I  + +++      +I G     V+  W+W      FI  P+  + LA
Sbjct: 123 MVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVS--WRWCF----FINIPIGGVALA 176

Query: 238 --CCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--------IDVFFWRLDMIGLLLI 287
             C   +       NA +    S+   +  S K+ F        + +F ++LD++GLLL 
Sbjct: 177 ILCWGYNPAGRTPINALNHYWKSY---RKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLLS 233

Query: 288 VCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEI-----------KFS 336
              F  +++  T  GG K  W +A II    IG  + L +++L++               
Sbjct: 234 SGGFALIMLALTF-GGNKFAWNSASIICMFTIGIAL-LGIFMLYDFVVLPYIGRRLENGE 291

Query: 337 RHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSF 396
             PL PW L  +  + ++ +  F  +F + +Q  Y+     +  +E    A+      S 
Sbjct: 292 AMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMSV 351

Query: 397 VSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGI 446
            ++IT  +      K    KP I+ G+   FI  GLL  +  ++   A I
Sbjct: 352 PALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLFGSNTSTGASI 401

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 80/347 (23%), Positives = 142/347 (40%), Gaps = 27/347 (7%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + IFG    L +SI+ +  G++I + + ++     G     +G +G   +  +IA+ 
Sbjct: 97  GRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIAST 156

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
            +    R +A+ + +  + +    S  + +A   +  W    W F   L    LA  +L 
Sbjct: 157 LTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFAVLV 213

Query: 243 MRYLAHKNAKDRLMPS-------FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVL 295
           + Y  H+    R + S       F   +  S+  Y             +  I C  G +L
Sbjct: 214 LTYKPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFNELVFGFDFIGFIFCSVGFIL 273

Query: 296 IPFTLA-GGMKEQWRTAHIIVPEVIGWCVALPLYILWEI----KFSR-------HPLTPW 343
               L  GG K  W +  IIV  V+G  +++  ++L++     KF R        PL PW
Sbjct: 274 FRLGLTFGGDKYTWSSGAIIVYFVVGVTISVA-FLLYDFMVFPKFGRVRKNASFRPLVPW 332

Query: 344 ELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL-IVAVHESVKAATRITSLYSFVSVITG 402
            ++   G+ +A+   FL+   +  Q  Y+     +V   ++ +A+  + +L     +IT 
Sbjct: 333 SVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIPDIITV 391

Query: 403 TILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGA--HAGII 447
            I G         KP I  GI    +  GLL     DSG+  H G++
Sbjct: 392 AISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIGLL 438

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 145/347 (41%), Gaps = 27/347 (7%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + IFG    L +SI+ +  G++I + + ++     G     +G +G   +  +IA+ 
Sbjct: 97  GRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIAST 156

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
            +    R +A+ + +  + +       +  A   +  W    W F   L    LA  +L 
Sbjct: 157 LTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFAVLV 213

Query: 243 MRYLAHKNAKDRLMPSF--TIPKDVSRKEYFIDVFFWRLDMI-----GLLLIVCFFGCVL 295
           + Y  H+    R + S   +  +  + + +  D++    D +      +  I C  G +L
Sbjct: 214 LTYKPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCSVGFIL 273

Query: 296 IPFTLA-GGMKEQWRTAHIIVPEVIGWCVALPLYILWEI----KFSR-------HPLTPW 343
               L  GG K  W +  IIV  ++G  +++  ++L++     KF R        PL PW
Sbjct: 274 FLLGLTFGGDKYAWSSGAIIVYFIVGVTISVA-FLLYDFMIFPKFGRVRKNASFRPLVPW 332

Query: 344 ELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL-IVAVHESVKAATRITSLYSFVSVITG 402
            ++   G+ +A+   FL+   +  Q  Y+     +V   ++ +A+  + +L     +IT 
Sbjct: 333 SVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIPDIITV 391

Query: 403 TILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGA--HAGII 447
            I G         KP I  GI    +  GLL     DSG+  H G++
Sbjct: 392 AISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGSSKHIGLL 438

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 120/296 (40%), Gaps = 34/296 (11%)

Query: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASD 127
           ++  S++L  +   LD  I  T  A   S ++E   +S V     + +A  Q  + + SD
Sbjct: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181

Query: 128 IFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLN 187
           IFGR  +L    I + +G++I   + +     AG     +G  G   +  I  +D   L 
Sbjct: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLR 241

Query: 188 WRLLALFIPALPFIINTWISGDVTAAVNGNW--KWGIGMWAFIF----PLACIPLACCML 241
            R L   I    F + T + G     V G W     +G W   F    P+A       +L
Sbjct: 242 NRALYQGICNFYFGLGTALGG-----VVGGWFSDRSVG-WRMSFLIQLPIAFFSTILIIL 295

Query: 242 HMRYLAHKNAKDRLMPSFTIPKDVSRKEYF--IDVFFWRLDMIGLLLIVCFFGCVLIPFT 299
            +R    K +K R +             YF  I V    +D IG   +V F    +I  +
Sbjct: 296 FLRL--PKESKGRGLQ--------VDGNYFSTIKVRLSAVDWIGATTLVLFLFSFMITAS 345

Query: 300 LAGGMKEQWRTAHIIVPEVIGWCVALPLYIL----WEIKFSRHPLTPWELLKDRGV 351
           L G  KE   T+H    + IG CV   +  L     E+K ++ P+ P   LKDR V
Sbjct: 346 LGG--KEIPYTSH----KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSV 395

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 79/361 (21%), Positives = 145/361 (40%), Gaps = 35/361 (9%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + + G  T L +S++ + IG++I + + ++    AG      G +G   ++ I+ T 
Sbjct: 99  GRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIVGTS 158

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
             +   R + + +    F+ +      +  A+N +  W    W F   L   P+      
Sbjct: 159 LVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASW---RWCFFINL---PIGGAAAF 212

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRK------------EYFIDVFFWRLDMIGLLLIVCF 290
           M +L +  +   L+ + T   + +R              + +D+  +R D+IG  L    
Sbjct: 213 MLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDIIGFALSSAG 272

Query: 291 FGCVLIPFTLAGGMKEQWRTAHIIVPEVIG------WCV----ALPLYILWEIKFSRH-- 338
           F  +L+     GG K  W +   I    +G      +C+     LP+ +   + +S    
Sbjct: 273 FVLLLL-GLTFGGRKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPV-LARSLAYSSEVT 330

Query: 339 PLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVS 398
           PL PW ++   GV++    +F   F + MQ  Y+     V  +ES   A+      S  +
Sbjct: 331 PLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHMWALSIPA 390

Query: 399 VITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAG 458
           ++   +LG    K    KP  + G     I  GLL   +G + +   I    C+L   AG
Sbjct: 391 LVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYCILA-GAG 447

Query: 459 F 459
           F
Sbjct: 448 F 448

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 79/145 (54%), Gaps = 8/145 (5%)

Query: 278 RLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR 337
           ++D +G +L V  FG +++ F         W++A+IIV  V+ +C AL +++++E+K+++
Sbjct: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326

Query: 338 HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFV 397
            PL P  +  +RG+   L+I F +   W   G + +      ++    +     S Y F+
Sbjct: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382

Query: 398 SVITGTILGLFL-VKLRRTKPFILF 421
            VI+G+ + +   + +++ KP +LF
Sbjct: 383 FVISGSTVAIVCGLTIKKIKPSVLF 407

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 145/342 (42%), Gaps = 33/342 (9%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + IFG  T L VSII + IG+++ + + ++     G      G +G   ++  IAT 
Sbjct: 76  GRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAIATS 135

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
             + + R   + + +L + + + +   +  A+     W    W F   L   P+    L 
Sbjct: 136 LVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYVTW---RWCFYINL---PIGGLALG 189

Query: 243 MRYLAHKNAKDRLMPSFT-IPKDVSRKEY--FIDVFFWRLDMIGLLLIVCFFGCVLIP-- 297
           + YL++  A+ +++  F    K V+  E+   + + F+R+ +  L+  + FFG       
Sbjct: 190 VFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQLLSLKFYRMLLKFLVFELDFFGFTFCSVG 249

Query: 298 ------FTLAGGMKEQWRTAHIIVPEVIG--WCVALPLY------ILWEIKFSRH--PLT 341
                     GG    W++  II   V+G  + V   +Y      + W+ + + +  PL 
Sbjct: 250 FVLLLLGLTFGGNLHPWQSGTIIAYLVVGSFFIVIFFVYEFVIFDMFWQSQRNGNARPLI 309

Query: 342 PWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHES-VKAATRITSLY--SFVS 398
            W      G+++A    F     + +Q  ++  +  +   +S  +AA+ + SL   +FVS
Sbjct: 310 SWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLWSLLIPAFVS 369

Query: 399 VITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           +I   I G    +    KP  LF      I  GLL    G+S
Sbjct: 370 II---ISGKITSRYGYVKPITLFAGISGVIGAGLLTLLNGES 408

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 62/106 (58%), Gaps = 12/106 (11%)

Query: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318
           ++IP ++       +++   +D IG +L +  FG +++ F         W++A+IIV  V
Sbjct: 280 YSIPNNIPT-----NIYNLSMDWIGAILGI--FGLLILNFVFNQAPIVGWQSAYIIVLLV 332

Query: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFC 364
           + +C AL +++++E+K+++ PL P  +  +RG+   L+I F + FC
Sbjct: 333 LSFC-ALVIFVVYEVKYAKTPLIPKAISSNRGM---LMILFAL-FC 373

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 77/163 (47%), Gaps = 10/163 (6%)

Query: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318
           ++IP  V       +V  + +D IG +L V   G +L+ F    G    W+TA+II   V
Sbjct: 250 YSIPNSVPT-----NVHGFAMDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIALLV 302

Query: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIV 378
           +     L L+  +E+K++  PL P E+ K+R +   L   FL    + +   Y ++ L+ 
Sbjct: 303 VS-VFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLN 361

Query: 379 AVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILF 421
             H S   A     +++    +   I+G F+ K+  +  FILF
Sbjct: 362 LRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKI--SAAFILF 402

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 91/425 (21%), Positives = 167/425 (39%), Gaps = 52/425 (12%)

Query: 22  DDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYG 81
           +D+  KE  +   +S S + E++ K        +  +Q    F       SL L  +   
Sbjct: 5   EDNSSKELCTQAESSTSEVVEQNKK-------VVSQDQVVKGFALYACLGSLTLALFLSA 57

Query: 82  LDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIF 141
           LD  I  T     +  ++E+S    +    ++  A   + + RA+ I G  + + +SII 
Sbjct: 58  LDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIII 117

Query: 142 YIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPF- 200
           + +G+++ + A ++     G     +G +G   +  +I +   N   R +A+ + +  F 
Sbjct: 118 FEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAISVLSCSFA 177

Query: 201 ---IINTWISGDVTAAVNGNWKW------GIGMWAF-IFPLACIPLACCMLH-----MRY 245
              I+  ++ G  T  V   W+W       IG  AF +F L+  P     +      +R 
Sbjct: 178 VASIVGPFLGGAFTTHVT--WRWCFYINLPIGGLAFLVFVLSYNPNGGNSIKNFTKAVRS 235

Query: 246 LAHKNAKDRLMPSFTIPKDVSRKEYF--IDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGG 303
           ++H +    L            K Y+   +   ++ D +G  L    F  +L+  T  GG
Sbjct: 236 ISHVDFGGLL----------KAKSYYNTFEKLVFKFDFVGFALCSAGFCLILLGLTF-GG 284

Query: 304 MKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR----------HPLTPWELLKDRGVYS 353
            +  W +  II   VIG  +++  ++     F+R           PL  W ++   GV +
Sbjct: 285 NEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLVSWNVISKPGVIT 344

Query: 354 ALIIAFLINFCWYMQGDYMYTV-LIVAVHESVKAATRITSLYSFV-SVITGTILGLFLVK 411
           A  + F I  C       +Y V     +H S      I  +   V ++IT  I G+   K
Sbjct: 345 ATAVNFTI--CLMYNAQVIYIVQFFQLIHGSTAWKAGIHLIACVVPTIITVNISGIINGK 402

Query: 412 LRRTK 416
               K
Sbjct: 403 TGHVK 407

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/337 (21%), Positives = 121/337 (35%), Gaps = 23/337 (6%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + I G  T L  SI+ + IG++I + + ++     G      G +G   ++ ++ T 
Sbjct: 63  GRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTS 122

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
                 R + + +  L F +   +   +  A   N  W    W F   L    +A  ML 
Sbjct: 123 LVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGGVALTMLT 179

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWR---------LDMIGLLLIVCFFGC 293
             Y   + +    +          R   ++   FWR         LD IG  L    F  
Sbjct: 180 FSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAYNFLMFDLDFIGFALSSTGFVL 239

Query: 294 VLIPFTLAGGMKEQWRTAHIIVPEVIG------WC----VALPLYILWEIKFSRHPLTPW 343
            ++  T  GG    W +  II    +G      W     V L  +  W  K    PL   
Sbjct: 240 FMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKREATPLLRR 298

Query: 344 ELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGT 403
            L    G++++ I      F + MQ  Y+  +  +  +    AA+     +   ++++  
Sbjct: 299 SLCFRPGIFTSSIANLFTCFGFNMQTVYIVQLYQLVFNSGPTAASMHLWAFLIATMVSVI 358

Query: 404 ILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           I+G         KP I+FG     +  GL+   R  S
Sbjct: 359 IIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTS 395

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 77/355 (21%), Positives = 140/355 (39%), Gaps = 29/355 (8%)

Query: 123 ARASDIFG-RLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIAT 181
            R S + G R++++   II +  G++I + A ++    +G     +G +G   +  +I  
Sbjct: 100 GRLSAVLGPRISVISC-IILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGC 158

Query: 182 DFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCML 241
              N   R L L +    F + + +   +  A   +  W    W F   L    LA  + 
Sbjct: 159 QLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGGLAIAIF 215

Query: 242 HMRYLAHKNAKDRLMP-SFTIPKDVSRK------EYFIDVFFWRLDMIGLLLIVCFFGCV 294
              Y  +    D L   S T  K +S +      +  +D   +  D++  +L    +   
Sbjct: 216 IFFY--NPEGADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLF 273

Query: 295 LIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRH--------PLTPWELL 346
           L+  T  GG    W++  I++  +I   + + L ++++ +   H        PL  W L+
Sbjct: 274 LLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLM 331

Query: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVL-IVAVHESVKAATRITSLYSFVSVITGTIL 405
             R + +A    F     + +Q  Y      +V    + KA   +  +   VS +  +I 
Sbjct: 332 SQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVSTVVFSIA 389

Query: 406 -GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
            G+ + K    KP ++FG     +  GL+I     S  H   IG L L G   GF
Sbjct: 390 SGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQ-IGVLILPGVALGF 443

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 98/229 (42%), Gaps = 19/229 (8%)

Query: 35  NSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALA 94
           N   S+++    D         AE+     LR ++  S++L  +   +D  I  T  A  
Sbjct: 80  NGYGSITDPHDGDNKSERPVSTAEEISGARLRVIML-SMYLGIFLAAIDNTIVSTTSAHV 138

Query: 95  TSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN 154
            S +++ S +S +     + +A  Q  + + SDIFGR  +L  + + ++IG ++   + +
Sbjct: 139 ASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKS 198

Query: 155 -----VARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGD 209
                +ARF AG     +G  G   +  I  TD   L  R +   I  + + + T   G 
Sbjct: 199 FWWLVIARFVAG-----VGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGI 253

Query: 210 VTAAVNGNWKWGIGMWAFIF----PLACIPLACCMLHMRYLAHKNAKDR 254
           V    + N     G W   F    PL+ I L   +LH++  + +  +++
Sbjct: 254 VGGWFSDNK----GGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQ 298

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 67/161 (41%), Gaps = 27/161 (16%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQ--ATNVA 156
           S +SLL     + TVI   GQ+ F   +D+ GR  I GV +I  I  TV++    ++   
Sbjct: 97  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSI 153

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWR---LLALFIPA---------LPF 200
            F A   FY+    +G  G   +  II ++FS   WR   + A+F            L  
Sbjct: 154 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLSCGILAL 213

Query: 201 IINTWISGDVTAAVNGN------WKWGIGMWAFIFPLACIP 235
           I+     GD+  A  G+       K    MW  +    C+P
Sbjct: 214 ILVAAYKGDLVGATTGDECGFECQKACDQMWRILVGFGCVP 254

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 121/297 (40%), Gaps = 47/297 (15%)

Query: 68  MLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKT---VIAAAGQIWFAR 124
           ++  S+FL  +   LDG I  T   L T   SE + L  V+ I T   + ++  Q  + +
Sbjct: 83  IIMISMFLGIFLAALDGTIVST---LLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGK 139

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATN-----VARFTAGGCFYQLGYTGAMLIIEII 179
            SD  GR  +L  S + + IG +I   +T+     V RF +G     +G  G   +  ++
Sbjct: 140 LSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSG-----IGGCGLTCLASMV 194

Query: 180 ATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLAC-IPLAC 238
            +D   L  R +   +    F + T   G V AA           W   F + C I LA 
Sbjct: 195 ISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD--------WRMAFTIQCPISLAS 246

Query: 239 CMLHMRYLA----HKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCV 294
           C L + YL     H++ KDR   S    +D              LD  G++ +VCF    
Sbjct: 247 CALIVSYLELPPRHEDDKDRHWTSKL--RD--------------LDWAGVVTLVCFLFLF 290

Query: 295 LIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGV 351
           ++  +L G  KE    + +     +   V   ++   E+  +  P+ P   LK R V
Sbjct: 291 MLVSSLGG--KEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRSV 345

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 120/293 (40%), Gaps = 29/293 (9%)

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           S+ L ++   LD  I  T  +   S ++E S +S +     + +A  Q  + + SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 132 LTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLL 191
             ++ +S +F+I+G +I   + N+    AG     +G  G   +  I A+D   L  R L
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRAL 185

Query: 192 ALFIPALPF--------IINTWISGDVTAAVNGNWKWGIGMWAFI--FPLACIPLACCML 241
              I    F        +I  W S     + NG W+      AF+   PL  I L   ++
Sbjct: 186 YQGIFNFFFGLGIAIGGLIGGWFS----ESKNG-WR-----MAFLVQVPLCAISLVLIII 235

Query: 242 HMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLA 301
            ++          +        D+  K         R+D +G L +V F    ++  +L 
Sbjct: 236 FLKLPPGCKGLGLVSNDKDGKVDIKDK-------LKRIDWLGSLSLVTFLFAFMLASSLG 288

Query: 302 GGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSA 354
           G  KE    ++I    V+   ++   +I  E+  S  P+ P   L +R +  A
Sbjct: 289 G--KEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNRSILGA 339

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 115/288 (39%), Gaps = 30/288 (10%)

Query: 71  FSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFG 130
            S++L  +    DG +  T  A   S ++E   +S +     + +A  Q  + + SDIFG
Sbjct: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142

Query: 131 RLTILGVSIIFYIIGTVIESQATNV-----ARFTAGGCFYQLGYTGAMLIIEIIATDFSN 185
           R  +L ++ I +++G ++     +      ARF +G     +G  G   +  I  +D   
Sbjct: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGGGGVTSMCSITISDIVP 197

Query: 186 LNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLAC--CMLHM 243
           L  R L   +    F + T   G     V G +    G W   F L  +PL+    +L  
Sbjct: 198 LRDRALYQGMCNFFFGLGTACGG----VVGGWFSDHGGGWRMAF-LIQVPLSALSSLLIA 252

Query: 244 RYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGG 303
            ++       R+      P  +  K          +D IG   +V F    L+  +L G 
Sbjct: 253 VFMKLPPRSKRV----NSPASIKNK-------LLSVDWIGASALVVFLSLFLVTASLGG- 300

Query: 304 MKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGV 351
            KE    +   V   IG  +A   +I  E+  ++ P+ P   L++R V
Sbjct: 301 -KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSV 347

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 142/362 (39%), Gaps = 31/362 (8%)

Query: 120 IWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEII 179
           IW  R + I G    L ++I+ +  G++I + A+++     G     +G +G   +  +I
Sbjct: 91  IW-GRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVI 149

Query: 180 ATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACC 239
                    R L + I +  F +   +   +  A   +  W    W F   L    LA  
Sbjct: 150 GCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINLPIGGLAII 206

Query: 240 MLHMRYLAHKNA-----KDRL--MPSFTIPK---DVSRKEYFIDVFFWRLDMIGLLLIVC 289
           M  + Y A         KD +  + SFT  K    V+ K     + F + D  G  L  C
Sbjct: 207 MFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIF-KFDFFGFAL--C 263

Query: 290 FFGCVLIPFTLA-GGMKEQWRTAHIIVPEVIG---WCVALPLYILWEIKFSRHP--LTPW 343
             G VL    L  GG K  W +  +I   V+G   +  +L        KF+  P  ++  
Sbjct: 264 SAGLVLFLLGLTFGGNKYSWNSGQVITYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYR 323

Query: 344 ELLKDRGVYS-ALIIAFLINF--CWYMQGDYMYTVL---IVAVHESVKAATRITSLYSFV 397
            LL  R V   A+II  ++ F  C    G  +Y+V    ++    + KA   +  +    
Sbjct: 324 PLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-IT 382

Query: 398 SVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCA 457
           +VI     G+   KL   KP ++FG     I  GL+      S   +  IG L L GF  
Sbjct: 383 NVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTS-TKSTQIGVLLLPGFSL 441

Query: 458 GF 459
           GF
Sbjct: 442 GF 443

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 63/147 (42%), Gaps = 30/147 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE--SQATNVA 156
           S ++LL     + TVI   GQI F   +DI GR  I G+ +I  I+ T+++  + ++   
Sbjct: 113 STNTLLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSI 169

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++FS   WR                  G +  
Sbjct: 170 NFVAILTFYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 211

Query: 213 AVNGNWKWGI---GMWAFIFPLACIPL 236
           AV  N  WG    G+ A I   A  P+
Sbjct: 212 AVFANQAWGQILGGIVALILVAAYKPM 238

>ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON}
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123C PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
           regulated by Pho4p and Spt7p mutation confers resistance
           to arsenate exit from the ER during maturation requires
           Pho86p
          Length = 604

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 88/222 (39%), Gaps = 38/222 (17%)

Query: 75  LVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTI 134
           ++ Y Y  DGNI            S  +LL     + TVI   GQ  F   +D+ GR  I
Sbjct: 84  MMTYVYWKDGNI----------PSSSETLLKVSTSVGTVI---GQFGFGILADVLGRKKI 130

Query: 135 LGVSIIFYIIGTVIES--QATNVARFTAGGCFYQLGYTGAML----IIEIIATDFSNLNW 188
            GV +I  I   +++    A+    FTA   F+++     +     +  II ++FS   W
Sbjct: 131 YGVELIIMIAACIMQCVIGASPAVNFTAIMTFFRIIMGIGIGGDYPLSSIITSEFSTTKW 190

Query: 189 R---LLALFIPA---------LPFIINTWISGDVTAAVNGN------WKWGIGMWAFIFP 230
           R   + A+F            +  I+      D+ AA +G+       +    MW  +  
Sbjct: 191 RGAIMSAVFANQAFGQVAAGIVALILVEGYKDDLKAAKSGSTCGPSCKRACDQMWRILIG 250

Query: 231 LACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFI 272
           + C+P  C  L+ R    ++ +  L   F   + V+    F+
Sbjct: 251 MGCVP-GCIALYFRLTIPESPRYTLDVEFDAARGVADASKFV 291

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 94/228 (41%), Gaps = 21/228 (9%)

Query: 23  DSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGL 82
           DSIKK TV AT  ++         D   ++IE       +P    ++  S++L  +   L
Sbjct: 95  DSIKKNTV-ATAKTI---------DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASL 144

Query: 83  DGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFY 142
           D  I  T  A   S ++E   +S +     + +A  Q  + + SDIFGR  +L  S + +
Sbjct: 145 DNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMF 204

Query: 143 IIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFII 202
            +G +I   +  +    AG     +G  G   +  I  +D   L  R L   I    F +
Sbjct: 205 ALGCLICGLSPGLWCLVAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGL 264

Query: 203 NTWISGDVTAAVNGNW--KWGIGMWAFIFPLACIPLAC--CMLHMRYL 246
            T   G V     G W  + G G W   F L  IPL    C L + YL
Sbjct: 265 GTACGGLV-----GGWFSEHG-GGWRVAF-LIQIPLCAISCSLIVAYL 305

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 123/297 (41%), Gaps = 37/297 (12%)

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           S++L  +   LD  I  T  A   S ++E   +S +     + +A  Q  + + SDIFGR
Sbjct: 100 SMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGR 159

Query: 132 LTILGVSIIFYIIGTVIESQATN-----VARFTAGGCFYQLGYTGAMLIIEIIATDFSNL 186
             +L    + + IG +I   A +     + RF +G     +G  G   +  I  +D   L
Sbjct: 160 KIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISG-----VGGGGITSMSTITVSDIIPL 214

Query: 187 NWRLLALFIPALPF----------IINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPL 236
             R  AL+     F          II  W +  +     G+W+   G + F  PL+ I  
Sbjct: 215 RNR--ALYQGVCNFYYGLGIALGGIIGGWFTEKL-----GSWR---GAFLFQVPLSVIST 264

Query: 237 ACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRK--EYFIDVFFWRLDMIGLLLIVCFFGCV 294
              M+ ++    K++K   +   T+  + S    E  I      +D  G + +V F    
Sbjct: 265 VTVMVWLQL--PKDSKSYGL-EITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSF 321

Query: 295 LIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGV 351
           +I  + AGG     ++   +   +I    +   +I  E+KF++ P+ P   LKDR V
Sbjct: 322 MI-LSSAGGSDISVKSNTFLYLTLIS-VTSFISFIYIELKFAKDPILPLVFLKDRSV 376

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 64/143 (44%), Gaps = 30/143 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIES---QATNV 155
           S  +LL     + TV+   GQ+ F   +D+ GR  I G  +I  I+ T++++   QA  +
Sbjct: 99  STQTLLKVSTSVGTVV---GQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGL 155

Query: 156 ARFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVT 211
           + FTA   FY+    LG  G   +  II ++F+   WR                  G + 
Sbjct: 156 S-FTAMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR------------------GAIM 196

Query: 212 AAVNGNWKWGIGMWAFIFPLACI 234
            AV  N  WG  +++ I  + CI
Sbjct: 197 GAVFANQAWG-QIFSGIVSIVCI 218

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 91/418 (21%), Positives = 166/418 (39%), Gaps = 49/418 (11%)

Query: 38  SSLSEESVKDAGVNNIEI-----YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQA 92
           SS+   SV      N E      + ++Y+  F+   LF ++FL     GLDG I  +   
Sbjct: 15  SSVDYSSVPPTPRGNFEPNVQKPWIDRYRIVFIETALFANVFL----SGLDGTITASTYQ 70

Query: 93  LATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQA 152
           L  + +    + + +     V   + Q  +   SD  GR   L  +   + +G +    A
Sbjct: 71  LIGNEFDNFEISNWITTAYLVATTSFQPLYGSFSDTLGRRHCLFFANTVFALGCLGCGLA 130

Query: 153 TNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
             +           +G  G + +  I+ +D      R +      +   I   I      
Sbjct: 131 PGILSLIFMRALTGIGGGGLITLSTIVNSDIIPPESRGIYQAFQNVLLGIGAVIGASTGG 190

Query: 213 AVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFI 272
           AV     W    W F   L  +P++     M Y+  +N K  +  S +  + +  +    
Sbjct: 191 AVASYLGW---RWCF---LLQVPVSVGGTIMAYMFLENQKGFVSESESSGQLLKNR---- 240

Query: 273 DVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMK---EQWRTAHIIVPEVIGW----CVAL 325
              F ++D+ G LL++      L+  T+   M     QW +      E IG      ++L
Sbjct: 241 ---FSKIDLKGSLLLIVGLASQLMYLTVNSSMASSGSQWLSK-----ESIGLILLTVLSL 292

Query: 326 PLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLI---VAVHE 382
            ++I  E     +P+ P +LL        L+I+ L+ F  Y    Y++T+ +   + V +
Sbjct: 293 VMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYA---YLFTLPLFFQIVVGD 349

Query: 383 SVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDS 440
           S   A    ++ SF + I G I GL + ++ +T PF+L        SFG+++   G++
Sbjct: 350 SAARAGFRLAIPSFCTPIGGLITGLSM-RIPKTLPFLL--------SFGMVLMMIGNA 398

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 62/145 (42%), Gaps = 34/145 (23%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVI-----ESQAT 153
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I+ +V+     ES+A 
Sbjct: 88  STATLLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAI 144

Query: 154 NVARFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGD 209
           N   F A   FY+    +G  G   +  II ++F+   WR                  G 
Sbjct: 145 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 183

Query: 210 VTAAVNGNWKWGIGMWAFIFPLACI 234
           +  AV  N  WG  + A I  L C+
Sbjct: 184 IMGAVFANQAWG-QIAAGIVALVCV 207

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN--VA 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I+ T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++F+   WR                  G +  
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GAIMG 200

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 201 AVFANQAWG 209

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN--VA 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I+ T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++F+   WR                  G +  
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GAIMG 200

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 201 AVFANQAWG 209

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE--SQATNVA 156
           S  +LL     + TVI   GQ+ F   +D+ GR  I G+ +I  II T+++  + ++   
Sbjct: 136 STATLLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGI 192

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++FS   WR                  G +  
Sbjct: 193 NFVAVLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 234

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 235 AVFANQAWG 243

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 139/368 (37%), Gaps = 55/368 (14%)

Query: 9   QDIHNLSTQAHTQ----DDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPF 64
           +D    +  A T      DS+KK+ +S T + VSS+S         NN +     Y    
Sbjct: 20  EDFQTTTVTAQTSLDVLSDSVKKDQISITDDDVSSIS---------NNSKWQDPTYFKSS 70

Query: 65  LRAMLFFSLFLVAYAYGLDGNIR--YTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWF 122
            +   F    ++A      G  +   T   LA S  S+ +  + +    T+ + +  +  
Sbjct: 71  WQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVS 130

Query: 123 ARASDIFG-RLTILGVSIIFYIIGTV--IESQATNVARFTAGGCFYQLGYT-------GA 172
            R  DI+G + T +G +IIF I   +  +     NV  F     F  LG         G 
Sbjct: 131 GRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGL 190

Query: 173 MLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLA 232
           +  I  + +   N+    +    P        W  G +  +    W W       IF   
Sbjct: 191 VGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMW-GGLIVDSNKDQWPW-------IFFAT 242

Query: 233 CIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFG 292
            I +                + +M  ++IP  V    Y +     ++D IG LL V   G
Sbjct: 243 AIAVFI--------------NLIMGIYSIPNHVPTNIYNL-----KMDWIGSLLGV--IG 281

Query: 293 CVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVY 352
            +L+ F         W  A+IIV  ++     L  + ++E+K +  PL P E+ K+R + 
Sbjct: 282 LILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYELKKAESPLLPPEVTKNRHIV 340

Query: 353 SALIIAFL 360
           + +I  FL
Sbjct: 341 TIIISLFL 348

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 94/437 (21%), Positives = 180/437 (41%), Gaps = 76/437 (17%)

Query: 22  DDSIKKETVSATINSVSSLSEESVK-DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAY 80
           D  +KK+ +  +    S ++EE+++ D    N E  + + +N  LR   +F+     YA+
Sbjct: 2   DTDLKKKNIEVS----SYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAF 57

Query: 81  GLDG------NIRYTFQALATSSYSEHSLLSTVNCIKT-------VIAAAGQIWFARASD 127
                     N+  T Q L+  +     L S+ + +K        +++ +  +   R  D
Sbjct: 58  IFSCMLSQLLNLAGTTQTLSIMNVLTRQLHSS-DSLKVWLVASFPLVSGSFILVSGRLGD 116

Query: 128 IFG--RLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDF-- 183
           I+G  ++ ILG  I+      VI S  T ++ ++  G F+ +      L I ++  +   
Sbjct: 117 IYGLKKMLILGYVIL------VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLG 170

Query: 184 --------SNLNWRLLALFIPALPFI---INTWISGDVTAAVNGNWKWGIGMWAFIFPLA 232
                     L   ++   + A+  I   +    SG V     G+W W      + + LA
Sbjct: 171 LIGMIYKPGTLKKNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAF----YAYTLA 226

Query: 233 CIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFG 292
               A     + Y +  N          IP +V+R           +D IG    V   G
Sbjct: 227 ----AFINTFISYYSIPN---------NIPTNVNRLS---------MDWIGSFTGV--LG 262

Query: 293 CVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVY 352
            +L  F       + W +A++IV  VI   +AL  + ++E++++ +PL P E++++R + 
Sbjct: 263 LILFNFVWNQAPADGWNSAYLIVLLVIS-VIALIAFGIYELRYAENPLLPSEIIRNRQL- 320

Query: 353 SALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGL---FL 409
             ++I   + F W   G + +      ++    +       Y F+ VI+GTI  +   FL
Sbjct: 321 --IMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSY-FIFVISGTITAISCGFL 377

Query: 410 VKLRRTKPFILFGICGW 426
           +K  R    + F + G+
Sbjct: 378 MKKIRPAVLLTFSMVGF 394

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 79/366 (21%), Positives = 146/366 (39%), Gaps = 40/366 (10%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + I G  + +  +II + IG++I   A ++     G     +G +G   +  +I ++
Sbjct: 134 GRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSN 193

Query: 183 FSNLNWRLLALFIPALPF----IINTWISGDVTAAVNGNWKW------GIGMWAF-IFPL 231
             +   R L +   +  F    +I  ++ G  T   +  W+W       +G  AF +F +
Sbjct: 194 LVDERRRGLIIACMSSAFAVASVIGPFLGGAFTT--HATWRWCFYINLPVGGVAFALFVV 251

Query: 232 ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFF---WRLDMIGLLLIV 288
              P    +  +  L+        +   T+ K++     +  + +   +R D+I  +   
Sbjct: 252 FYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEFIFCS 311

Query: 289 CFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWE-IKFSR---------- 337
             F  VL+ FT  GG +  W +A IIV  VIG  + L + +L++ + F R          
Sbjct: 312 AGFVLVLLAFTF-GGNQYNWSSASIIVMFVIG-IILLIVSLLYDFVIFPRFKAVKENSLY 369

Query: 338 HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFV 397
            PL  W +    G+++A    F     +  Q     TV I+   + V+  T   +    +
Sbjct: 370 QPLIKWSIFSHPGIFTANAALFFECTAYICQ-----TVYIIQFFQLVRGNTAWKAAVHLI 424

Query: 398 SVITGTIL-----GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCL 452
           + +  T++     G+   K    K     G+    +  GLL     +S + A  IG L L
Sbjct: 425 ATVVPTVITTFSSGIANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNS-SSAKHIGLLIL 483

Query: 453 LGFCAG 458
            G   G
Sbjct: 484 PGIGFG 489

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 57/132 (43%)

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
             +++P    ++  SL+L      +DG I  T      S + E SL++ V     +   +
Sbjct: 42  RDFRDPKTFPLVLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCS 101

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
            Q  + + SD+ GR   L  + + +IIG V+   A  V           +G +G   +  
Sbjct: 102 VQPLYGKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCN 161

Query: 178 IIATDFSNLNWR 189
           II +D + L+ R
Sbjct: 162 IILSDLAPLSQR 173

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 97/427 (22%), Positives = 168/427 (39%), Gaps = 57/427 (13%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIE-IYAEQYQNPFLRAML- 69
           + +  Q H  D    +   S T +S+SS +E   +DAG   +    + ++  P  R ++ 
Sbjct: 31  NQIEQQDHLLDIEQGRAYGSTTKSSISSENER--EDAGGATVAGCGSAEFYLPSSRILII 88

Query: 70  FFSLFLVAYAYGLDGNIRYT--------FQALATSSYSEHS-LLSTVNCIKTVIAAAGQI 120
            FS+FL  +   LDG I  T        F +L  +S+   S LLS+  C         Q 
Sbjct: 89  MFSMFLGIFLAALDGTIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTC---------QP 139

Query: 121 WFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIA 180
            + + SD  GR  +L  S   + IG +I   + ++    AG     +G  G   +  +I 
Sbjct: 140 LYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAGRFISGIGGCGLTSLATMIM 199

Query: 181 TDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLAC-IPLACC 239
           +D   L  R +   +    F + T  SG +  A   +W+         F L C I +   
Sbjct: 200 SDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWR-------LAFILQCPISVLSG 251

Query: 240 MLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFT 299
           +L + YL         +P    P+  +  +        RLD  G   ++ F    L   T
Sbjct: 252 ILIVVYLE--------LP----PRASASNKDCWSARLRRLDWAGATSLIAFL--FLFMLT 297

Query: 300 LAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAF 359
            + G       + +         V   +++  E++ +  P+ P   L+DR V      + 
Sbjct: 298 SSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTFLRDRSVLG----SS 353

Query: 360 LINFCWYMQGDYMYTVLIVAVHESVKAATRIT-----SLYSFVSVITGTI-LGLFLVKLR 413
           L N  W+     M T   + V+ S     + T     ++ SF SV  G++  GL++ +  
Sbjct: 354 LAN--WFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLGAGLYMKRTG 411

Query: 414 RTKPFIL 420
           +   F+L
Sbjct: 412 KYYYFLL 418

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 52/129 (40%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQ--ATNVA 156
           S  +LL     + TVI   GQI F   +DI GR  I G+ +I  +  TV++     +   
Sbjct: 96  STTTLLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAV 152

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++FS   WR                  G +  
Sbjct: 153 SFVAVLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 194

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 195 AVFANQAWG 203

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 117/302 (38%), Gaps = 42/302 (13%)

Query: 66  RAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARA 125
           R ++  S+ L  +   LDG I  T      S ++E   +S +     + +A  Q  + + 
Sbjct: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198

Query: 126 SDIFGRLTILGVSIIFYIIGTVIESQATN-----VARFTAGGCFYQLGYTGAMLIIEIIA 180
           SDIFGR  +L  S + + +G +I   + N     + RF AG     +G  G   +  I  
Sbjct: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAG-----IGGGGLTSMCSITT 253

Query: 181 TDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIF----PLACIPL 236
           TD   L  R L   I  + F + T   G     V G +      W   F    PL  +  
Sbjct: 254 TDIVPLRSRALYQGICNVFFGLGTACGG----LVGGLFADRAVGWRMAFLVQVPLTLLST 309

Query: 237 ACCMLHMRYL----AHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFG 292
               L +       AHK A  R +P  T  + V              D  G + +V F  
Sbjct: 310 TAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMV--------------DWTGTVTLVVFLF 355

Query: 293 CVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVY 352
           C  +  +L G   E     ++I   ++   ++   +I  E+  +  P+ P   L++R V 
Sbjct: 356 CFTLVCSLYG---EDLPHLYLIFVVIL---LSGSYFIYHELYVATDPILPIRFLENRSVL 409

Query: 353 SA 354
           +A
Sbjct: 410 AA 411

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 53/129 (41%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVA-- 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I  T++++   +    
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAI 158

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II ++F+   WR                  G +  
Sbjct: 159 NFVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GAIMG 200

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 201 AVFANQAWG 209

>Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {ON}
           YML123C (PHO84) - 1:1 [contig 104] FULL
          Length = 569

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 69/163 (42%), Gaps = 32/163 (19%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE---SQATNV 155
           S  +LL     + TVI   GQ+ F   +D+ GR  I G+ +I  I+ TV++    +A  V
Sbjct: 95  STSTLLKVSTSVGTVI---GQVGFGVMADVVGRKKIYGLELIIMIMATVLQCTIGKAPGV 151

Query: 156 ARFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR--------------LLALFIPA 197
           + F A   FY++     +     +  II ++FS   WR               +A  I A
Sbjct: 152 S-FVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWRGAMMGAVFANQAFGQIAAGIVA 210

Query: 198 LPFIINTWISGDVTAAVNGN-----WKWGIGMWAFIFPLACIP 235
           L  ++      D+  A NGN      K    MW  +  L C+P
Sbjct: 211 LVLVVA--YKSDLIDATNGNCGPACAKACDQMWRILVGLGCVP 251

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 54/132 (40%), Gaps = 33/132 (25%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVAR- 157
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I  T+++   T + R 
Sbjct: 103 STQTLLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQ---TTIGRS 156

Query: 158 ----FTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGD 209
               F A   FY+    +G  G   +  II ++F+   WR                  G 
Sbjct: 157 PGINFPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 198

Query: 210 VTAAVNGNWKWG 221
           +  AV  N  WG
Sbjct: 199 IMGAVFANQAWG 210

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 251 AKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRT 310
           A + L+  + IP ++       +V  +++D IG  + V  FG +L  F         W +
Sbjct: 223 ALNGLVALWIIPNNIPT-----NVNEYKMDWIGSAIGV--FGLILFNFVWNQAPIAGWGS 275

Query: 311 AHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDR 349
           A+IIV  ++   VAL  +I +EI+F++ PL P  +L +R
Sbjct: 276 AYIIVLLIVA-VVALIAFITYEIRFAKQPLLPHSVLFNR 313

>TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858
           YML123C
          Length = 581

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNV--A 156
           S ++LL     + TVI   GQ+ F   +DI GR  I GV +I  I  T+++  A +    
Sbjct: 99  SSNTLLKVSTSVGTVI---GQLGFGMMADIIGRKKIYGVELIIMIAATILQCTAGHAPGV 155

Query: 157 RFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR 189
            F A   FY++     +     +  II ++FS   WR
Sbjct: 156 NFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 192

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 98/249 (39%), Gaps = 30/249 (12%)

Query: 1   MSSVSTTDQDIH------NLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIE 54
           MS +   ++ IH      N  T++   +DS +++    TI SV S SE+   D   N IE
Sbjct: 1   MSGIIMVEKPIHDYTGFVNTDTESVHSNDSQREDNQKQTI-SVDSFSED---DISPNVIE 56

Query: 55  IYAEQYQN----PFLRAMLFFSLFLVAYAYGLDGNI----RYTFQALATSSYSEHSLLST 106
           I            F   ++ F  F++ +  G  G       +  +  +T+   EH  LS 
Sbjct: 57  ILKRPLSTYITVCFNCILIGFGGFMMGWDIGTIGGFIAQPDFKRRFGSTTKEGEH-YLSK 115

Query: 107 VN-----CIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------V 155
           V       I  +  A G +   R  DI+GR   L ++   +++G VIE  + +      +
Sbjct: 116 VRTGLLVSIFNIGCAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFI 175

Query: 156 ARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVN 215
            R  AG     +     MLI E+   +          + I    F+ +    G    + +
Sbjct: 176 GRIIAGVGMGVIAILSPMLISEVSPKEVRGGMVSCFQMMITLGIFLGDCTEYGSKEYSNS 235

Query: 216 GNWKWGIGM 224
             W+ G+G+
Sbjct: 236 AQWRVGLGL 244

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 52/127 (40%), Gaps = 27/127 (21%)

Query: 101 HSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN--VARF 158
            +LL     + TVI   GQ  F   +DI GR  I G+ +I  I+ T++++   +     F
Sbjct: 104 QTLLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAINF 160

Query: 159 TAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAV 214
            A   FY+    +G  G   +  II ++F+   WR                  G +  AV
Sbjct: 161 VAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GAIMGAV 202

Query: 215 NGNWKWG 221
             N  WG
Sbjct: 203 FANQAWG 209

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 116/300 (38%), Gaps = 25/300 (8%)

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
           +++     +A +  SL+L ++   +D +I           + E      +     +  AA
Sbjct: 35  QEHNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAA 94

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
            Q  + R SDI GR   L ++  F+++GT++   A NV  F        +G  G   +  
Sbjct: 95  FQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIARAICGMGGGGIGAMSS 154

Query: 178 IIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLA 237
           I  +D      R   ++      I     +G V  A  G        W  IF    + + 
Sbjct: 155 ITVSDICTTKER--GMYQGYANVIFG---AGQVLGAPVGGLIMETFNWRIIFAAQVVAIM 209

Query: 238 CCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIP 297
            CM+    LA++N   +L+      +  +RK         R+D+ G  ++ C     L+ 
Sbjct: 210 ICMI----LAYRNINLKLLHIPPFHQRFTRKN------LSRIDLFGSSMLSCSLVSFLML 259

Query: 298 FTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALII 357
           F+ +G  +  W    +         V+L L+ + E   +   L P  +L+     SAL+I
Sbjct: 260 FS-SGVSRSLWFLLTL---------VSLTLFCINERYIATERLLPNGILRGHFGLSALLI 309

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 251 AKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRT 310
           A + +M  ++IP  V    +   +  W    IG++      G +L  F    G  + W  
Sbjct: 248 AINMVMAIYSIPSTVPTNIHGFGMD-WTGSAIGVV------GMILFNFVWNQGPIDGWNK 300

Query: 311 AHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGD 370
            +II   ++   + +  +I +EIKF++ PL P E++K+R +   L+  F+    + +   
Sbjct: 301 GYIIALLIVSVFLLIAFFI-YEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTF 359

Query: 371 YMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKL--RRTKPFIL 420
           Y Y   +   H S   A        F+ VI GTI   FLV L  +R  P +L
Sbjct: 360 YYYAFQLNLRHYSAVWAGGTF----FMFVIWGTI-AAFLVALTIKRVGPSVL 406

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 58/269 (21%), Positives = 99/269 (36%), Gaps = 23/269 (8%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R   + G  T + +SI+ + +G++I + AT++     G     +G +G   +  +I + 
Sbjct: 131 GRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTMLIGGRVISGIGGSGIQTLCFVITST 190

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
                 R  A+ I +  F + +     +  A   +  W    W F   L    LA     
Sbjct: 191 LVTDRTRGTAISILSCAFAVASVAGPFLGGAFATHVTW---RWCFYINLPIGGLAFFFFL 247

Query: 243 MRYLAH-KNAKDRLMPSFTIPKDVSRKEYFIDVFFWRL--------DMIGLLLIVCFFGC 293
             Y  + +N  +         K +S  +     F+ RL        D     L    F  
Sbjct: 248 FSYNPNGENTFENFKILLGRIKRISYSQLLTVSFYRRLFRTLVFKFDFFEFALSSAGFTL 307

Query: 294 VLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSR----------HPLTPW 343
           VL+  T  GG +  W +  II   V+G  + +  ++   + F R           PL  W
Sbjct: 308 VLLALTF-GGNRYDWNSGTIIAYFVVGILLIIASFVYDFVVFDRVKPQTDRIPYLPLLSW 366

Query: 344 ELLKDRGVYSALIIAFLINFCWYMQGDYM 372
            ++   GV    I  F   FC+ MQ  Y+
Sbjct: 367 NVISKPGVLIPNIANFCTCFCYNMQVVYI 395

>Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON}
           (55476..57182) [1707 nt, 569 aa]
          Length = 568

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 52/129 (40%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE--SQATNVA 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I  T+++  +  +   
Sbjct: 103 STQTLLKVSTSVGTVI---GQVGFGIIADIVGRKKIYGLELIIVITATILQCTTGHSPAV 159

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY+    +G  G   +  II  +F+   WR                  G +  
Sbjct: 160 NFPAILTFYRIVMGIGIGGDYPLSSIITAEFATTKWR------------------GAIMG 201

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 202 AVFANQGWG 210

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 52/129 (40%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-----SQAT 153
           S  +LL     + TV    GQ+ F   +D+ GR  I G+ +I  I+ T+++     S A 
Sbjct: 90  STTTLLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAV 146

Query: 154 N-VARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
           N VA  T       +G  G   +  II ++FS   WR                  G +  
Sbjct: 147 NFVAILTTYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 188

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 189 AVFANQAWG 197

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 80/371 (21%), Positives = 147/371 (39%), Gaps = 56/371 (15%)

Query: 97  SYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVA 156
           SYSE   L T   +   + A   IW   A+ I  + T+L  +I+ + IG++I + A +++
Sbjct: 100 SYSEIGWLFTGYSLPNALLAL--IWGRIATPIGFKETML-FAIVIFEIGSLISALANSMS 156

Query: 157 RFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPF----IINTWISGDVTA 212
               G     +G  G   +  +I +     + R + + + +  F    ++  ++ G  T+
Sbjct: 157 MLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAIASVVGPFLGGVFTS 216

Query: 213 AVNGNWKWGIGMWAFIFPLACIPLACCMLHMRY------LAHKNAKDRLMPS--FTIPKD 264
           +V   W+W      F   L    LA  +    Y              R  PS    I ++
Sbjct: 217 SVT--WRW-----CFYVNLPIGGLAFFLFLFFYNPGLSTFQETMDNIRKFPSQFIEIVRN 269

Query: 265 VS---------------RKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWR 309
           V+               RK +   +F +  D+I  +     F C+L+ FT  GG +  W 
Sbjct: 270 VAYHLLKIKGFSKLNGWRKPFMELIFMY--DIIEFVFCSAGFTCILLAFTF-GGNRYAWN 326

Query: 310 TAH----------IIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAF 359
           +A           ++V   I   +  P + + +      PL  W  +K  G+++  I  F
Sbjct: 327 SASIIILFIIGIVLVVLAGIYDFLVFPKFNIVKATPHYQPLMSWTNIKKPGIFTVNIALF 386

Query: 360 LINFCWYMQGDYMYTVLIVAVHESV-KAATRITSLYSFVSVITGTILGLFLVKLRRTKPF 418
           L    +  Q  Y+     +  ++S  +AA  + +     +V+T  + G    K R+ KP 
Sbjct: 387 LTCAGYISQFTYIVQYFQLIYNDSAWRAAVHLVACI-ISTVVTAILCGAITDKTRQIKPI 445

Query: 419 I----LFGICG 425
           I    +FG+ G
Sbjct: 446 IVISSIFGVVG 456

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 65/167 (38%), Gaps = 10/167 (5%)

Query: 23  DSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGL 82
           D I      +T+ S     EE          E   + +++P     +  SL+L      +
Sbjct: 14  DEIHSSKGESTVPSFPDTGEE----------EDLEKDFRDPNTFPYILLSLWLNTSICAV 63

Query: 83  DGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFY 142
           DG I  T      S + E S ++ V     +   A Q  + + SD+ GR   L  + + +
Sbjct: 64  DGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVF 123

Query: 143 IIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR 189
           I+G V+   A  +           +G +G   +  II +D + L+ R
Sbjct: 124 IVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQR 170

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 111/285 (38%), Gaps = 34/285 (11%)

Query: 197 ALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNA----- 251
           A+  I+   I G  T  V   W+W      F   L    LA  M  + Y A         
Sbjct: 47  AVAAIVGPIIGGAFTTHVT--WRW-----CFYINLPIGGLAIIMFLLTYKAENKGILQQI 99

Query: 252 KDRL--MPSFTIPK---DVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLA-GGMK 305
           KD +  + SFT  K    V+ K     + F + D  G  L  C  G VL    L  GG K
Sbjct: 100 KDAIGTISSFTFSKFRHQVNFKRLMNGIIF-KFDFFGFAL--CSAGLVLFLLGLTFGGNK 156

Query: 306 EQWRTAHIIVPEVIG---WCVALPLYILWEIKFSRHP--LTPWELLKDRGVYS-ALIIAF 359
             W +  +I   V+G   +  +L        KF+  P  ++   LL  R V   A+II  
Sbjct: 157 YSWNSGQVIAYLVLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIIN 216

Query: 360 LINF--CWYMQGDYMYTVL---IVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRR 414
           ++ F  C    G  +Y+V    ++    + KA   +  +    +VI     G+   KL  
Sbjct: 217 MVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-ITNVIAAIASGVITKKLGL 275

Query: 415 TKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
            KP ++FG     I  GL+      S   +  IG L L GF  GF
Sbjct: 276 VKPLLIFGGVLGVIGAGLMTLMTNTS-TKSTQIGVLLLPGFSLGF 319

>AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML123C
           (PHO84)
          Length = 563

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 53/129 (41%), Gaps = 27/129 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQ--ATNVA 156
           S +SLL     + TVI   GQ+ F   +D+ GR  I G+ +I  I+ TV++     +   
Sbjct: 96  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKRIYGLELILMILATVLQCMIGKSPAI 152

Query: 157 RFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            F A   FY++     +     +  II ++FS   WR                  G +  
Sbjct: 153 DFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR------------------GAIMG 194

Query: 213 AVNGNWKWG 221
           AV  N  WG
Sbjct: 195 AVFANQAWG 203

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 121/309 (39%), Gaps = 39/309 (12%)

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           S++L  +   LD  +  T  A   S +++   +  V     + +A  Q  + + SDIFGR
Sbjct: 402 SMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGR 461

Query: 132 LTILGVSIIFYIIGTVI--ESQATNV---ARFTAGGCFYQLGYTGAMLIIEIIATDFSNL 186
             +L  S + +  G +I   S + N+    RF AG     +G  G   +  I  +D   L
Sbjct: 462 KALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAG-----IGGGGITSMTTITVSDIVPL 516

Query: 187 NWRLLALFIPALPFIINTWISGDVTAA-VNGNWKWGIGMWAFIFPLACIPLACCMLHMRY 245
             R +   I    F + T   G +    V+  + W +  W+ +       L  C      
Sbjct: 517 RSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQVPVSGLSTLLIC------ 570

Query: 246 LAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMK 305
                       SF +   +   E  +     R+D +G + ++ +    L+  T+ GG+ 
Sbjct: 571 ------------SFLVVPRIKNYEVSLGRKLMRVDWLGSISMILWLTSFLLITTMMGGIS 618

Query: 306 EQWRTA--HIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAF---- 359
               +   H +   ++   V+  +++L E+  +  P+ P   L +R V  A +  F    
Sbjct: 619 LDIDSDQFHYL---IMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGASLGNFFCVM 675

Query: 360 -LINFCWYM 367
             +  C+Y+
Sbjct: 676 GFMTICFYL 684

>KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.858
           YML123C
          Length = 586

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVA-- 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I  TV++    +    
Sbjct: 96  STATLLKVSTSVGTVI---GQLGFGILADIVGRKKIYGLELIVMIFCTVLQCTLGHSPGI 152

Query: 157 RFTAGGCFYQ----LGYTGAMLIIEIIATDFSNLNWR 189
            F A   FY+    +G  G   +  II ++FS   WR
Sbjct: 153 NFVAVLTFYRVVMGIGIGGDYPLSSIITSEFSTTKWR 189

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 72/157 (45%), Gaps = 8/157 (5%)

Query: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318
           ++IP  +       +V  + +D IG  L V   G +L+ F    G  + W  A+IIV  +
Sbjct: 250 YSIPNHIPT-----NVHGFSMDWIGSGLAVV--GLILLNFVWNQGPIDGWGKAYIIVLLI 302

Query: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIV 378
           +     L L+ ++E+ ++  PL P  + ++R +   L+  FL    + +   Y +  L+ 
Sbjct: 303 VS-VFVLTLFFIYEVHYAASPLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLN 361

Query: 379 AVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
             H S   A     +++   V+   ++GL + K+  +
Sbjct: 362 LRHYSTVWAGGTYFMFAIWGVVASVVVGLSIRKISAS 398

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 78/192 (40%), Gaps = 27/192 (14%)

Query: 17  QAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLV 76
           Q+ T+ D   ++   A I+ V+   E+   D   +N  I  +  + P    + +  ++L+
Sbjct: 2   QSSTESDRDIQDGPDADIH-VAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL 60

Query: 77  AYAYGLDG-----------------NIRYTFQALATSS---YSEHSLLSTVNCIKTVIAA 116
            Y     G                 N +  F +   S+   Y  +  +  +  + ++  A
Sbjct: 61  CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA 120

Query: 117 AGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYTG---- 171
            G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  G    
Sbjct: 121 IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL 180

Query: 172 -AMLIIEIIATD 182
             ML+ EI  TD
Sbjct: 181 CPMLLSEIAPTD 192

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 112/289 (38%), Gaps = 25/289 (8%)

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
            +Y     +  + FSL+L ++   LDG I           +SE S    +     +   A
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTA 86

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
            Q  + + SDI GR + L  +  F+ IG ++   A NV  F+       +G  G   I  
Sbjct: 87  FQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGS 146

Query: 178 IIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLA 237
           I  +D      R +      + F +   +     A + G +   IG W  +F +    + 
Sbjct: 147 IAVSDICTARERGVYQGYANIVFGLGQLLG----APLGGVFIETIG-WRALFGVQVPVIM 201

Query: 238 CCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIP 297
            C +    LA KN   +L   F +P     KE +      R+D+ G L +V     VL  
Sbjct: 202 LCSV----LAIKNINIKL---FHVPP---MKERYTLKNLSRIDIFGSLSLVATISGVL-- 249

Query: 298 FTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346
           F  +  + + + T   I   ++        +IL E  ++   + P ELL
Sbjct: 250 FLCSSHLNKLYLTLFTIGSFIV--------FILVERYYATEKILPLELL 290

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 93/235 (39%), Gaps = 20/235 (8%)

Query: 10  DIHNLS-TQAHTQDDSIKKETVSATINSVSSLSEES----VKDAGVNNIEIYAEQYQNPF 64
           ++  LS   A +Q  +I   +  +T  +V+  S ++    ++ + V    I   Q  +  
Sbjct: 90  EVQELSLGSAGSQSTTILNSSYGSTSTTVTPDSNKNGNVFIRSSSVEVGNIGDSQNISQI 149

Query: 65  LRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFAR 124
             A +  SL +  +   LDG I  T      S +     +S +     + A   Q  + +
Sbjct: 150 RFAAIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGK 209

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATNV-----ARFTAGGCFYQLGYTGAMLIIEII 179
            SDIFGR  IL  S + + +G ++   A  V      RF AG     +G  G   +  II
Sbjct: 210 LSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAG-----IGGGGLTSMPSII 264

Query: 180 ATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACI 234
            +D   L  R     +  + +++   + G +     G W    G W  +F L  +
Sbjct: 265 ISDIVPLRSRASYQDLFNICYVLGITLGGSM-----GGWLAEYGGWRLVFLLQVV 314

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 167/421 (39%), Gaps = 46/421 (10%)

Query: 28  ETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIR 87
           ET S   + V S   +   D  +   E + +    P  +  +  SL+L ++   LDG + 
Sbjct: 6   ETTSLLPDPVESCPNDLPDDTKLEQ-EYHRDNMALP--KGPILLSLWLGSFVSALDGTVV 62

Query: 88  YTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTV 147
                   + ++E      +     +   A Q  + + SDI GR   +  +  F+ +G +
Sbjct: 63  ANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCL 122

Query: 148 IESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWIS 207
           +   A NV +F+       +G  G   +  I  TD  +   R   ++      +  T   
Sbjct: 123 LTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARER--GVYQGYANVVFGT--- 177

Query: 208 GDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSR 267
           G +  A  G +      W  IF +    L  C +    LA KN   +L+    IP    R
Sbjct: 178 GQLLGAPIGGFLLDSIGWRSIFGIQVPMLMLCSV----LALKNVNIKLV---HIPP---R 227

Query: 268 KEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPL 327
            E F      R+D+ G + +V     +L            W  + + +  V+ +     L
Sbjct: 228 NERFTWKNLSRIDIFGSISLVATISGILFL------TSSNWNKSLLGIFTVLSFS----L 277

Query: 328 YILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAA 387
           +I  E+  ++  + P+ELLK  G +    IA +I   + + G+   + + + + ++V  +
Sbjct: 278 FIYIELYVAKERIMPFELLK--GSFGLSSIATVIT-SFIIYGEIFRSPIYLQLIQNV--S 332

Query: 388 TRITSLY--------SFVSVITGTILGLFLVKLRRTKPFILFG-----ICGWFISFGLLI 434
             +T LY        +  S++TG+IL    + L      I+FG     + G  +S+ LL 
Sbjct: 333 VTVTGLYLIFPSVAIALGSIVTGSILRNTKMDLAHCAAAIIFGGMIMQLAGLALSYYLLS 392

Query: 435 H 435
           H
Sbjct: 393 H 393

>Klac_YGOB_Anc_8.858 Chr3 (1471304..1471548,1471550..1473029) [1725
           bp, 574 aa] {ON} ANNOTATED BY YGOB -
          Length = 574

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 70/173 (40%), Gaps = 35/173 (20%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-----SQAT 153
           S  +L+     + TVI   GQ  F   +D+ GR  I G  +I  I   +++     S A 
Sbjct: 95  STSTLIKVSTSVGTVI---GQFGFGIMADVVGRKKIYGTELIIMIAACILQCTLGHSPAV 151

Query: 154 N-VARFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR---LLALFIPA-------- 197
           N VA FT    FY++     +     +  II ++FS   WR   + A+F           
Sbjct: 152 NFVAVFT----FYRIIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAG 207

Query: 198 -LPFIINTWISGDVTAAVNGN-----WKWGIGMWAFIFPLACIPLACCMLHMR 244
            +  ++     GD+  A  GN      K    MW  +  L C+P  C  L+ R
Sbjct: 208 IVALVLVAAYKGDLEDATTGNCGPACQKACDQMWRILIGLGCLP-GCIALYFR 259

>YOL103W Chr15 (124001..125830) [1830 bp, 609 aa] {ON}
           ITR2Myo-inositol transporter with strong similarity to
           the major myo-inositol transporter Itr1p, member of the
           sugar transporter superfamily; expressed constitutively
          Length = 609

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 76/178 (42%), Gaps = 28/178 (15%)

Query: 5   STTDQDIHNLSTQAHTQDDS----IKKETVSATINSVSSLSEES----------VKDAGV 50
           ST  +++H+   + H ++D+     KK  VS +   + S  +E           V D   
Sbjct: 38  STQGEELHH---RKHCEEDNDGQKPKKSPVSTSTMQIKSRQDEDEDDGRIVIKPVNDEDD 94

Query: 51  NNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSL 103
            ++ I   Q  +PF+  + F +  +  + +G D G I     ++         +Y E  L
Sbjct: 95  TSVIITFNQSISPFIITLTFVAS-ISGFMFGYDTGYISSALISINRDLDNKVLTYGEKEL 153

Query: 104 LSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
           ++    +  +I + G      A+D+FGR   L  S + ++IG +++  A    +  AG
Sbjct: 154 ITAATSLGALITSVGA---GTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAG 208

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAGGCFYQLGY 169
           A G +   +  DI+GR   L ++ I ++IG +IE  + +      + R  AG     +  
Sbjct: 127 AVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAV 186

Query: 170 TGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIG---MWA 226
              MLI E+   +          L I    F+ N    G  + + +  W+ G+G   +W+
Sbjct: 187 LSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLWS 246

Query: 227 FIFPLACIPLACCMLHM----RYLAHKNAKDR 254
            I       + C M+ +    RYL  K   ++
Sbjct: 247 II-------MVCAMMFVPESPRYLIQKGKTEQ 271

>Suva_2.674 Chr2 complement(1195582..1197321) [1740 bp, 579 aa] {ON}
           YDR497C (REAL)
          Length = 579

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 112/297 (37%), Gaps = 42/297 (14%)

Query: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEES------VKDAGVNNIEI 55
           S  + +D D   LS +  +   S+K  + +  I       EE       V D    ++ I
Sbjct: 13  SQSNDSDGDSEVLSNEHESPVKSVKVTSEAHEIQRAPGSDEEDRIQIKPVNDEDDTSVMI 72

Query: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVN 108
              Q  +PF+  +L F   +  + +G D G I     ++ T       +Y E  +++   
Sbjct: 73  TFNQSISPFI-IILTFVASISGFLFGYDTGYISSALISIGTDLDNKVLTYGEKEIITAAT 131

Query: 109 CIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLG 168
            +  +I +   I+   A+DI+GR   L  S   ++IG +++  A    +   G      G
Sbjct: 132 SLGALITS---IFAGTAADIYGRKRCLMGSNFMFVIGAILQVSAHTFWQMAVGRLIMGFG 188

Query: 169 YTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA---------VNGNWK 219
                LI  +  ++ +    R        L  I + W++G    A         VN  W+
Sbjct: 189 VGIGSLISPLFISEIAPKMIR------GRLTVINSLWLTGGQLVAYGCGAGLNYVNNGWR 242

Query: 220 WGIGMWAFIFPLACIPLACCMLH--MRYLAH----KNAKDRLMPSFTIPKD--VSRK 268
             +G+   + P A      C L    RY       K A + L  S+T   D  + RK
Sbjct: 243 ILVGLS--LIPTAVQFTCLCFLPDTPRYYVMKGDLKKASEVLRRSYTDTSDEIIDRK 297

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 78/361 (21%), Positives = 138/361 (38%), Gaps = 41/361 (11%)

Query: 123 ARASDIFG-RLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIAT 181
           AR S + G R++++   II +  G++I + A ++    AG     +G +G   +  +I  
Sbjct: 100 ARLSAVLGPRISVVSC-IILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGC 158

Query: 182 DFSNLNWRLLALFIPALPF----IINTWISGDVTAAVNGNWKW---------GIGMWAFI 228
              +   R L L +    F    I+  ++ G  T  V   W+W         G+ +  F+
Sbjct: 159 QLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVT--WRWCFYINLPIGGLAIAIFV 216

Query: 229 FPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIV 288
           F     P    +L       K       P    PK V ++  F        D++  +   
Sbjct: 217 FFYN--PEGVNLLEKFGNTFKKVSS-FHPVKKSPKKVLQQLLF------GFDILSFISFT 267

Query: 289 CFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKF--------SRHPL 340
             +   L+  T  GG    W +  +I   +IG  + + + ++++ K         S  PL
Sbjct: 268 AGWLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPL 325

Query: 341 TPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVL-IVAVHESVKAATRITSLYSFVSV 399
             WE++ +R +  +    F     + +Q  Y      +V    + KA   +  +   VS 
Sbjct: 326 LSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVST 383

Query: 400 ITGTIL-GLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAG 458
           +  +I  G+   K    KP ++FG     +  GL+      S  H   IG L L G   G
Sbjct: 384 VVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLILPGVALG 442

Query: 459 F 459
           F
Sbjct: 443 F 443

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 81/357 (22%), Positives = 140/357 (39%), Gaps = 38/357 (10%)

Query: 120 IWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEII 179
           IW  R + + G  + +  +II + +G+++ + A ++     G     LG +G   +  +I
Sbjct: 109 IW-GRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVI 167

Query: 180 ATDFSNLNWRLLALFIPALPF----IINTWISGDVTAAVNGNWKW------GIGMWAF-I 228
            +     + R L +      F    ++  ++ G  T  V   W+W       IG  AF  
Sbjct: 168 ISTLVEESKRGLLIACMGSAFGIASVVGPFLGGAFTTHVT--WRWCFWINLPIGGLAFAF 225

Query: 229 FPLACIPLACCMLHMRYLAH--KNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286
           F L   P       + Y+    K     L  S  + K +S     +    ++ D+I   L
Sbjct: 226 FILFYNPHGSDQTFVGYVTDFFKQVGGWLKNSGKLLK-LSTWRMIVHELIYKFDIIEFAL 284

Query: 287 IVCFFGCVLIPFTLA-GGMKEQWRTAHIIVPEVIGWCVAL-----PLYILWEIKFSR--- 337
             C  G VLI   L+ GG K  W +   I   VIG  V +        I   +K  R   
Sbjct: 285 --CTTGLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTILALVYDFAIFPRLKVVRENP 342

Query: 338 --HPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESV-KAATRITS-- 392
              PL P  + K   +    I  F +   +  Q +Y+     +  +E+  KA+  + +  
Sbjct: 343 RYQPLIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKASIHVIACV 402

Query: 393 LYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGL--LIHYRGDSGAHAGII 447
           + + ++VIT  IL     K    KP  + GI    +  GL  L+  +  +  H G++
Sbjct: 403 VPTVITVITSGILN---SKFGIVKPINVLGITAAIVGAGLLTLLTNKSTNSEHIGLL 456

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 92/221 (41%), Gaps = 22/221 (9%)

Query: 25  IKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDG 84
           +  ET +  +  +S  +E ++ D G  +   ++E    P    +   +L + ++   LD 
Sbjct: 1   MSDETAALLVPVISPTTETALVDTGEESTTSHSEL--PPTKVRITVLALLMGSFLSALDT 58

Query: 85  NIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYII 144
            I  T      S     S +S +     +  +A Q  + + SDIFGR  +L +S + + +
Sbjct: 59  TIVATLLPTIASDLDASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFAL 118

Query: 145 GTVI-ESQATN------VARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPA 197
           G  I  S  TN        RF AG     +G  G   +  I  +D   L  R +   +  
Sbjct: 119 GCAICGSPWTNNVWVLSTGRFVAG-----IGGGGQATLSTITTSDIIPLRKRGVYQGLVN 173

Query: 198 LPFIINTWISGDVTAAVNGNWKWGIG-MWAFIFPLACIPLA 237
           + F +    SG V  AV    + GIG  WAF   L  +P+A
Sbjct: 174 ICFSLGC-ASGSVLGAV---LQQGIGWRWAF---LVQVPMA 207

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 105/283 (37%), Gaps = 30/283 (10%)

Query: 197 ALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLM 256
           A+  I+   I G  T  V   W+W      F   L    LA  M  + Y A  +   + M
Sbjct: 179 AVAAIVGPIIGGAFTTHVT--WRW-----CFYINLPIGGLAVIMFLLTYDAKNDGIIQQM 231

Query: 257 PS---------FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQ 307
                      F+  K        I+   ++ D  G  L        L+  T  GG K  
Sbjct: 232 KGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTF-GGNKYT 290

Query: 308 WRTAHIIVPEVIG-----WCVALPLYILWEIKFSRHPLTPWELLKDRGVYS-ALIIAFLI 361
           W +  +I   V+G     + +    ++  +    R  ++   L   R V   A+II  ++
Sbjct: 291 WSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAIIIVNMV 350

Query: 362 NF--CWYMQGDYMYTVL---IVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTK 416
            F  C    G  +Y+V    ++    + KA   +  +    +VI     G+   KL   K
Sbjct: 351 TFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-ITNVIAAIASGIITKKLGLVK 409

Query: 417 PFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGF 459
           P ++FG     I  GL+   + +S +    IG L L GF  GF
Sbjct: 410 PLLIFGGFLGVIGAGLMTLMKNNSTSSTQ-IGVLILPGFSLGF 451

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 55/137 (40%)

Query: 46  KDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLS 105
           ++A V  +E    +Y     +  + FSL+L ++   LD  I           +SE S   
Sbjct: 15  EEAEVLPLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQ 74

Query: 106 TVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFY 165
            +     +   A Q  + + SDI GR   L  +  F+ +G ++   A NV  F+      
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVC 134

Query: 166 QLGYTGAMLIIEIIATD 182
            +G  G   I  I  +D
Sbjct: 135 GIGAGGLNAISSIAVSD 151

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 76/168 (45%), Gaps = 15/168 (8%)

Query: 255 LMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHII 314
           LM  ++IP +V       +V    +D  G  L V   G +L  F         W  A+II
Sbjct: 247 LMAWYSIPNNVPT-----NVHGLSMDWTGSTLAV--LGLILFNFVWNQAPIAGWGEAYII 299

Query: 315 VPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYT 374
           V  ++     L  + ++EIK++  PL P  + K+R +   L+  FL    W   G  ++T
Sbjct: 300 VLLILS-VFFLIAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFL---GWGSFG--IWT 353

Query: 375 VLIVAVHESVKAATRI-TSLYSFVSVITGTILGLFLV-KLRRTKPFIL 420
              V+   +++  + + T    FV VI G+I   F+   ++R  P IL
Sbjct: 354 FYYVSFQLNLRHYSPVWTGGTYFVFVIFGSIAAFFVAFSIKRLGPAIL 401

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 12/90 (13%)

Query: 260 TIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVI 319
            IP +V R         + +D IG  L V   G VL+           W  A+IIV  +I
Sbjct: 266 NIPTNVHR---------FSMDWIGSGLGVI--GLVLLNLVWNQAPISGWNQAYIIVLLII 314

Query: 320 GWCVALPLYILWEIKFSRHPLTPWELLKDR 349
              + L L+ ++EI F++ PL P  ++KDR
Sbjct: 315 S-VLFLVLFGVYEIHFAKSPLLPQAVMKDR 343

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 80/422 (18%), Positives = 168/422 (39%), Gaps = 38/422 (9%)

Query: 15  STQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFL---RAMLFF 71
           S+   T  D I +  +S + + V    EE   D   +  +      + P L    A L+ 
Sbjct: 16  SSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLDDETTPLSRIPHLWLIEAALYT 75

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           ++FL     G D  +  +      + ++   L S +     + + + Q  +   SD+ GR
Sbjct: 76  NVFL----SGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYGSFSDVLGR 131

Query: 132 LTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWR-- 189
              L  + + + IG +    + N+   +    F  +G  G + +  I+ +D    + R  
Sbjct: 132 RKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDMIPTSKRGI 191

Query: 190 --LLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLA 247
                  +  L  I      G +T+++   W+     W F+  +  I LA  ++   Y+ 
Sbjct: 192 FQAFQNLLLGLGAICGASFGGVITSSI--GWR-----WCFLLQVP-ISLAGALIGHLYVR 243

Query: 248 HKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQ 307
           +++  +R        K+ S+ +  +      +D  G  LI+      L+  +L     E 
Sbjct: 244 NQDEYERRK-----SKESSQTKEMLK----HIDFSGAFLIIIGLTLQLVYLSLGSAADES 294

Query: 308 WRT--AHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCW 365
             T  +  +   ++   + L L++L E + S   + P +L++    +  L I+ L+ F  
Sbjct: 295 GNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLFSFLVLTISVLVGFAS 354

Query: 366 YMQGDYMYTV----LIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILF 421
           Y    Y++T+     ++    + KA  R+ ++ S  + + G I G+ + K    +  +  
Sbjct: 355 YA---YLFTLPLFFQVILGDSTAKAGLRL-AIPSVFTPVGGLIAGICMSKFNCLQTLLYV 410

Query: 422 GI 423
           GI
Sbjct: 411 GI 412

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 9/100 (9%)

Query: 68  MLFFSLFLVAYAYGLD-GNIRYTFQALATS-----SYSEHSLLSTVNCIKTVIAAAGQIW 121
           ML F   L  + +G D G I    Q++ T      +Y +   +++   +  +IAA G   
Sbjct: 68  MLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGA-- 125

Query: 122 FARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
               +D+FGR   +  S I +++GTV++  A N  +   G
Sbjct: 126 -GICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVG 164

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 105 STVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
           S V+ +  + A AG I     S+ FGR   L +S +FY +G ++ + A+N     AG
Sbjct: 140 SLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIVCAAASNHHEMYAG 196

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 70/360 (19%), Positives = 146/360 (40%), Gaps = 26/360 (7%)

Query: 72  SLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGR 131
           +LF   +  GLD  I  +   L  + + +  + S +     V   + Q  +   SD  GR
Sbjct: 51  ALFTNVFLSGLDSTITASIYQLIGNEFEDVKVSSWITTAYLVTCTSFQPLYGSFSDTLGR 110

Query: 132 LTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLL 191
              L  +   + +G +     + +           +G  G + +  I+ +D      R  
Sbjct: 111 RRCLFFANTIFALGCLGCGLTSTIYSLIIMRAVTGIGGGGLITLSTIVNSDIIPAKKR-- 168

Query: 192 ALFIPALPFIINTWISGDVTAAVNGNWKWGIG-MWAFIFPLACIPLACCMLHMRYLAHKN 250
            ++      ++ T     V A+  G     +G  W F+  +  I +   ++   ++  ++
Sbjct: 169 GMYQSFQNILVGT--GAVVGASCGGEIASSMGWRWCFLLQVP-ISIGGAVMAYLFVQDQD 225

Query: 251 AKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKE---Q 307
             D+   S  +P +VS+ +        ++D +G  L++      LI  T+    +E    
Sbjct: 226 VVDKNPRSGALPSNVSKIK--------KIDFLGAFLLISGLVSQLIFLTINSSAQEGKST 277

Query: 308 WRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYM 367
           W +   +   ++   V+L L+   E   + +P+ P +LL      + LI+  L+ F  Y 
Sbjct: 278 WLSGRSLALGLVT-AVSLILFAYVEKTTTANPIIPHDLLGQWYSTTVLIVGVLVGFVSYA 336

Query: 368 QGDYMYTV----LIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGI 423
              Y++T+     +V    + +A  R+T + SF + I G I+G+ +   +R    ++ GI
Sbjct: 337 ---YIFTLPLYFQVVVGDTAAEAGLRLT-VPSFCTPIGGVIMGISMKDPKRLPGLLIVGI 392

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 76/168 (45%), Gaps = 15/168 (8%)

Query: 255 LMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHII 314
           LM  ++IP +V       +V    +D  G +L V   G +L  F         W  A+II
Sbjct: 246 LMAWYSIPNNVPT-----NVHGLSMDWTGSVLAV--IGLILFNFVWNEAPIAGWDKAYII 298

Query: 315 VPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYT 374
           V  V+     L  + ++EIK++  PL P  + K+R +   L+  F+    W   G  ++T
Sbjct: 299 VLLVVS-VFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFV---GWGSFG--IWT 352

Query: 375 VLIVAVHESVKAATRI-TSLYSFVSVITGTILGLFLV-KLRRTKPFIL 420
              V+   +++  + + T    FV  I GTI   F+   ++R  P +L
Sbjct: 353 FYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALL 400

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 79/353 (22%), Positives = 144/353 (40%), Gaps = 46/353 (13%)

Query: 65  LRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFAR 124
           + A LF ++FL     G DG I  +      + +++ S+ S +     + + + Q  +  
Sbjct: 60  IEATLFSNVFLA----GFDGTITASTYQTIGNEFNQMSISSWITTAYLITSTSFQPLYGS 115

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFS 184
            SD  GR   L  +   + IG +  S +TN+   +       +G  G + +  I+ +D  
Sbjct: 116 FSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFMRALAGIGGGGLITLSTIVNSDVI 175

Query: 185 NLNWR----LLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCM 240
             + R         +     I      G +T+ +   W+     W F+  +    +A  +
Sbjct: 176 PSSKRGIFQAFQNLLLGFGAICGASFGGTITSTI--GWR-----WCFLIQVPISMIASLL 228

Query: 241 LHMRYLAHKNAKDR----LMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLI 296
           ++      K   D+    L+ S  I KD+              D+ G +LI+   G  L 
Sbjct: 229 MNYYVPNQKEYDDQKINILLSSKKILKDI--------------DITGSILIIA--GLTLQ 272

Query: 297 PFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALI 356
              L+ G    W    +++  ++   V + L+IL E K +   + P EL+     +  L 
Sbjct: 273 LLYLSLGASFSWTNPPVLM-LLLASIVIIILFILNERKTTARAIIPMELVNSSFSFVVLS 331

Query: 357 IAFLINFCWYMQGDYMYTV----LIVAVHESVKAATRIT--SLYSFV-SVITG 402
           I+ L+ F  Y    Y++T+     IV    + KA  R+T  SL++ V S+ITG
Sbjct: 332 ISILVGFASYA---YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFTPVGSLITG 381

>TPHA0C04830 Chr3 (1043390..1045186) [1797 bp, 598 aa] {ON}
           Anc_8.858 YML123C
          Length = 598

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 57/142 (40%), Gaps = 28/142 (19%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-----SQAT 153
           S  +LL     + TVI   GQ+ F  A+DI GR  + G  +I  I  T+++     S A 
Sbjct: 103 SSQTLLKVSTSVGTVI---GQVSFGAAADIIGRKKVYGSELIIVICATILQCTSAHSPAI 159

Query: 154 N-VARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
           N VA  T       +G  G   +  II+ +F+   WR                  G +  
Sbjct: 160 NFVAILTTYRIIMGIGIGGDYPLSSIISAEFATTKWR------------------GAIMG 201

Query: 213 AVNGNWKWGIGMWAFIFPLACI 234
           AV  N  WG  +   I  L CI
Sbjct: 202 AVFANQAWG-QIAGGIIALICI 222

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 67/149 (44%), Gaps = 5/149 (3%)

Query: 105 STVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCF 164
           S V+ +  + A AG I     S++ GR T L +S  FY +G +I + A NV    AG  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

Query: 165 YQLGYTGAMLIIEIIATDF--SNLNWRLLAL--FIPALPFIINTWISGDVTAAVNGNWKW 220
             +G       I +   +   S +  RL++L  F  AL  +   +I G +   V+G W++
Sbjct: 194 IGVGVGLEGGGIGVYIAECVPSTVRGRLVSLYQFNIALGELFG-YIVGVIFFEVHGGWRF 252

Query: 221 GIGMWAFIFPLACIPLACCMLHMRYLAHK 249
            +G       L  I L       R+L HK
Sbjct: 253 MVGSSLIFSTLLFIGLLFLPESPRWLMHK 281

>Kpol_309.1 s309 (1360..3120) [1761 bp, 586 aa] {ON} (1360..3120)
           [1761 nt, 587 aa]
          Length = 586

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE--SQATNVA 156
           S  +LL     + TVI   GQ+ F   +DI GR  I G+ +I  I+ T+++  +  +   
Sbjct: 85  STETLLKVSTSVGTVI---GQVGFGTMADIVGRKKIYGLELIIVIVTTILQCTTGHSPAI 141

Query: 157 RFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR 189
            F A   FY++     +     +  II ++F+   WR
Sbjct: 142 EFPAILTFYRIIMGIGIGGDYPLSSIITSEFATTKWR 178

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 42/229 (18%), Positives = 86/229 (37%), Gaps = 15/229 (6%)

Query: 28  ETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIR 87
           ET     N ++S S +       +++E    ++     +  + +SL++ ++   LD  I 
Sbjct: 7   ETTRLLSNRITSSSADE------DDLEEMYHRHNLALPKGPILYSLWMGSFLGSLDSTIV 60

Query: 88  YTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTV 147
                     + E      +     +   A Q  + + SD+ GR T L V+  F+++G +
Sbjct: 61  ANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCL 120

Query: 148 IESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWIS 207
             + + N+  F+       +G  G   +  I  +D      R +      + F   + + 
Sbjct: 121 FTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGSMLG 180

Query: 208 GDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLM 256
           G +     G W      W  IF      +  CM    +L ++N   +L+
Sbjct: 181 GPI-----GGWLMDSFGWKVIFAGQVPLIMTCM----FLGYRNVNIKLL 220

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 51/125 (40%)

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
            +Y     +  + FSL+L ++   LD  I           +SE S    +     +   A
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTA 86

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
            Q  + + SDI GR + L ++  F+ +G ++   A NV  F+       +G  G   I  
Sbjct: 87  FQPLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISS 146

Query: 178 IIATD 182
           I  +D
Sbjct: 147 IAVSD 151

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 15/164 (9%)

Query: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318
           ++IP ++       +V  + +D  G +L V   G +L  F         W TA+II   +
Sbjct: 251 YSIPNNIPT-----NVHGFSMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLI 303

Query: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIV 378
           I     L  + ++E+K+++ PL P  + K+R +   L+  FL    W   G  ++T   +
Sbjct: 304 IS-VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFL---GWGSFG--IWTFYYM 357

Query: 379 AVHESVKAATRI-TSLYSFVSVITGTILGLFL-VKLRRTKPFIL 420
           +   +++  + + T    FV VI GTI    + + ++R  P  L
Sbjct: 358 SFQLNLRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFL 401

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 99/242 (40%), Gaps = 33/242 (13%)

Query: 14  LSTQAHTQDDSIKKETVSATINSVSSLSEESVK-DAGVNN----------IEIYAEQYQN 62
           ++T+  + D +    T + ++ S +   E+ +K D GV+N          IEI  ++ ++
Sbjct: 5   INTEDPSSDHTGVVNTDTESVQSNNFQKEDELKQDYGVDNFSGDENSPHAIEI-PKKPKS 63

Query: 63  PFLRA-----MLFFSLFLVAYAYGLDGNI----RYTFQALATSSYSEHSLLSTVN----- 108
            ++       M+ F  F+  +  G  G       +  +  +T+   EH  LS V      
Sbjct: 64  AYITVCLTCVMVAFGGFINGWDIGTIGGFIAQTDFKRRFGSTNKDGEH-YLSKVRTGLLV 122

Query: 109 CIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAGG 162
            I  V  A G +   R  DI+GR   L ++ + +++G VIE  + +      + R  AG 
Sbjct: 123 SIFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGI 182

Query: 163 CFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGI 222
               +     MLI E+   D          L I    F+ +    G  T + +  W+ G+
Sbjct: 183 GMGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGL 242

Query: 223 GM 224
           G+
Sbjct: 243 GL 244

>SAKL0B00264g Chr2 (22039..23598) [1560 bp, 519 aa] {ON} similar to
           uniprot|Q12300 Saccharomyces cerevisiae YDL138W RGT2
           Plasma membrane glucose receptor, highly similar to
           Snf3p; both Rgt2p and Snf3p serve as transmembrane
           glucose sensors generating an intracellular signal that
           induces expression of glucose transporter (HXT) genes
          Length = 519

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 9/114 (7%)

Query: 54  EIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNI------RYTFQALATSSYSEHSLLSTV 107
           EI   +Y+  F+ A + F   L  Y  G    +      + TF +    S SE SL++++
Sbjct: 13  EIQGSKYRAIFIGAFVAFGGILFGYDTGTISGVMAMDYTKKTFTSEGHFSASETSLITSI 72

Query: 108 NCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
               T     G I    ASD  GR   L V+   +  G ++++ AT  A   AG
Sbjct: 73  LSAGTF---CGAILAPLASDTIGRRLGLLVACAIFSAGAILQTAATTQALLIAG 123

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 73/195 (37%), Gaps = 21/195 (10%)

Query: 97  SYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN-- 154
            Y    LL  +  I  +  A G +  A+ +D FGR T L V++I Y+IG +I  Q  N  
Sbjct: 101 QYFPDLLLGLIISIFNIGCAVGSVTLAKLADWFGRKTGLYVTVIIYVIGLLI--QIINDR 158

Query: 155 ------VARFTAGGCFYQLGYTGAMLIIEIIATDFSN---LNWRLLALFIPALPFIINTW 205
                 + R   G           M + E+          + ++++  F   +  I+N  
Sbjct: 159 TWIQFFIGRIVCGFAIGSSNVVAPMFLAEVAPVRIRGGIIVFYQIMLTFGILMGNIVNYA 218

Query: 206 ISGDVTAA-VNGNWKWGIGMWAFIFPLACIPLA---CCMLHMRYLAHKNAK-DRLMPSFT 260
                     N  WK  +G+    F  ACI +    C      YLA K  + D    SF 
Sbjct: 219 CHQSFPGPNQNEAWKTPLGLG---FAWACIMMGGIWCSPEPAPYLALKKGRIDSAKESFA 275

Query: 261 IPKDVSRKEYFIDVF 275
           +   VS+     D F
Sbjct: 276 MMNGVSKDSKLTDEF 290

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 95/251 (37%), Gaps = 46/251 (18%)

Query: 4   VSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNP 63
           +++ D+    L+ Q+ +++DS K     +     +   EE        ++EI     ++P
Sbjct: 50  LNSLDKQNVQLTVQSSSENDSYKSGREHSGALEGNKEDEE--------DLEI---DLRDP 98

Query: 64  FLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFA 123
                +  SL+  +    LDG I  T      S + + S+++ V     +   A Q  + 
Sbjct: 99  KTFKWVLTSLWTNSALSALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYG 158

Query: 124 RASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATDF 183
           + SDI GR   L    I + +G  +   + ++ +         +G +G   +  II +D 
Sbjct: 159 KISDIIGRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDM 218

Query: 184 SNLNWR------------------------------LLALFIPALPFIINT-WIS----G 208
           + L+ R                              +  LFIP +PF + T ++S     
Sbjct: 219 APLSERGKYWGYGSMLGGVFQSLGGPLGGILLTYFGVSGLFIPQIPFCLATLYLSWKYVQ 278

Query: 209 DVTAAVNGNWK 219
           D      G+WK
Sbjct: 279 DYNQDTKGSWK 289

>NDAI0A07110 Chr1 complement(1620110..1621918) [1809 bp, 602 aa]
           {ON} Anc_3.84
          Length = 602

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 77/168 (45%), Gaps = 17/168 (10%)

Query: 6   TTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIE-----IYAEQY 60
           TTD +   L+ Q  +      K+T ++     +S +++ ++   VN+ +     I   Q 
Sbjct: 35  TTDYE-EFLNEQEESTKKMKNKQTTTSFDYENASDNDDRIQIKPVNDEDNTSVIITFNQK 93

Query: 61  QNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTV 113
            +PF+  + F +  +  + +G D G I     ++ T       SY +  +++    +  +
Sbjct: 94  ISPFIITLTFVAS-ISGFMFGYDTGYISSALISIGTDLDNKVLSYGDKEIVTAATSLGAL 152

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
           I++   I+   A+D+FGR   L  S + +IIG +++  A    +  AG
Sbjct: 153 ISS---IFAGTAADVFGRKPCLMFSNVMFIIGAILQISAHKFWQMAAG 197

>KLTH0F06864g Chr6 complement(601480..603192) [1713 bp, 570 aa] {ON}
           similar to uniprot|P25297 YML123C Saccharomyces
           cerevisiae PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
          Length = 570

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQ--ATNVA 156
           S  +LL     + TVI   GQ+ F   +D+ GR  I G+ +I  I  T+++    A    
Sbjct: 94  STSTLLKVSTSVGTVI---GQLGFGIMADVVGRKKIYGLELIIMIAATILQCTIGAAPGV 150

Query: 157 RFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR 189
            F A   FY++     +     +  II ++FS   WR
Sbjct: 151 SFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 187

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 112 TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYT 170
           +V  + G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  
Sbjct: 119 SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 171 G-----AMLIIEIIATD 182
           G      ML+ EI  TD
Sbjct: 179 GCSVLCPMLLSEIAPTD 195

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 112 TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYT 170
           +V  + G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  
Sbjct: 119 SVGCSIGGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 171 G-----AMLIIEIIATD 182
           G      ML+ EI  TD
Sbjct: 179 GCSVLCPMLLSEIAPTD 195

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 11/83 (13%)

Query: 79  AYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVS 138
           +YG+  +++ T          E SL+S++  +    A  G I     S+ FGR   L +S
Sbjct: 117 SYGMKASLKLT--------SDEDSLISSLMPLG---AVGGSILLTPLSEYFGRKVALVIS 165

Query: 139 IIFYIIGTVIESQATNVARFTAG 161
            IFY IG ++ + A +V    AG
Sbjct: 166 CIFYTIGGILCAAAQDVHTMYAG 188

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYTG--- 171
           A G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  G   
Sbjct: 120 AIGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSV 179

Query: 172 --AMLIIEIIATD 182
              ML+ EI  TD
Sbjct: 180 LCPMLLSEIAPTD 192

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 50/125 (40%)

Query: 58  EQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIAAA 117
            +Y     +  + FSL+L ++   LD  I           +SE S    +     +   A
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTA 86

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIE 177
            Q  + + SDI GR + L  +  F+ +G ++   A NV  F+       +G  G   I  
Sbjct: 87  FQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISS 146

Query: 178 IIATD 182
           I  +D
Sbjct: 147 IAVSD 151

>KNAG0G03530 Chr7 (750723..752477) [1755 bp, 584 aa] {ON} Anc_8.858
           YML123C
          Length = 584

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 9/97 (9%)

Query: 99  SEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNV--A 156
           S  +LL     + TVI   GQ+ F   +D+ GR  I G  +I  I+ T+ +         
Sbjct: 98  STQTLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGTELIVMIVCTIFQCTTGGAPGV 154

Query: 157 RFTAGGCFYQLGYTGAML----IIEIIATDFSNLNWR 189
            F A   FY++     +     +  II  +FS   WR
Sbjct: 155 SFVAVLTFYRIIMGIGIGGDYPLSSIITAEFSTTKWR 191

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 73/197 (37%), Gaps = 25/197 (12%)

Query: 7   TDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNP--- 63
           + +  +NL+       +S + E +++ + SV      +VK     N+ +     + P   
Sbjct: 2   SSEGNNNLNPSVTGSSNSTEIEELNSILTSVQDNDALNVKKTQTPNLSVGEPLLEIPKRN 61

Query: 64  --------FLRAMLFFSLFLVAYAYGLDGN--------IRYTFQALATSSYSEHSLLSTV 107
                    +  M+ F  F+  +  G  G         IR+  +    + Y        +
Sbjct: 62  PTEYITVCLMCLMVAFGGFINGWDIGTIGGFINHTDFLIRFGTRRADGTYYLSKVRTGLI 121

Query: 108 NCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAG 161
             I  V  A G +   R  D++GR   L ++ I +I+G VIE  +        + R  AG
Sbjct: 122 VSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIGRIVAG 181

Query: 162 GCFYQLGYTGAMLIIEI 178
                +     MLI E+
Sbjct: 182 VGMGVIAVLSPMLISEV 198

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 78/194 (40%), Gaps = 14/194 (7%)

Query: 276 FWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYI------ 329
           F+R D++  + +      +L+ FT  GG K +W +   I   V+G    L  ++      
Sbjct: 278 FYRFDIVEFVFMTLGSVLILLAFTF-GGNKYKWNSGSTISMFVLGILFTLGAFVYDFFIY 336

Query: 330 --LWEIKFSRH--PLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESV- 384
                +K   H  PL  W + K  GV+   I  F +   + +Q +Y+     +  +++  
Sbjct: 337 PKFEAVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLVFNDTAW 396

Query: 385 KAATRITSLYSFVSVITGTILGLFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHA 444
           KAA  + +    V +   +  G+   K    KP  +F      I  GLL     +  + A
Sbjct: 397 KAAIHLIATVVPVVITVVS-SGIVNSKTGYVKPIAIFSGVTGIIGAGLLTLLD-NHASSA 454

Query: 445 GIIGSLCLLGFCAG 458
             IG L L G   G
Sbjct: 455 KKIGLLILPGVTFG 468

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 310 TAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQG 369
           T+  ++P +    + L L++  E K S   + P EL++    +  L I+ L+ F  Y   
Sbjct: 285 TSPSVLPLLFASGIILVLFVYNEAKTSARAIIPLELMRSSFSFVVLTISILVGFASYA-- 342

Query: 370 DYMYTV----LIVAVHESVKAATRITSLYSFVSVITGTILGL 407
            Y++T+     IV    + KA  R+T + S  + + G I G+
Sbjct: 343 -YLFTLPLFFQIVLGDSTAKAGLRLT-IPSLFTPVGGLITGI 382

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 106/287 (36%), Gaps = 38/287 (13%)

Query: 5   STTDQDIHNLSTQAHTQDDSIKKETVSAT--INSVSSLSEESVKDAGVNNIEIYAEQYQN 62
           ST     +  +T+        K+E  S T  +++V S+S E   D           +Y  
Sbjct: 22  STDSYKRYRSATKIEENSFGTKEEICSETREVSTVGSISSEKPTDI---------WKYTT 72

Query: 63  PFLRA-MLFFSLFLVAYAYGLDGNIRYT---FQALATSSYSEHSLLSTVN-----CIKTV 113
             L   M+ F  F++ +  G  G         Q   T +      LST+       I  +
Sbjct: 73  VCLMCIMVAFGGFMMGWDIGTIGGFMAQTDFIQRFGTKNEDGVLYLSTIRMGLLVSIFNI 132

Query: 114 IAAAGQIWFARASDIFGRL--TILGVSIIFYIIGTVIESQATN------VARFTAGGCFY 165
             A G ++  +  D++GR    I G SI  +++G +I+  + +      + R  AG    
Sbjct: 133 GCAIGSVFLGKLGDLYGRRWGLIFGTSI--FVVGVIIQIASVSKWFQYFIGRIIAGIGMG 190

Query: 166 QLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMW 225
            +     MLI E+   +          L I    F+ N    G  +   +  W+  +G+ 
Sbjct: 191 VIAVLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYQNSKQWRIAVGLQ 250

Query: 226 AFIFPLACIPLACCMLHM----RYLAHKNAKDRLMPSFTIPKDVSRK 268
                L CI +   M  +    RYL  +N  +    S  I   +S++
Sbjct: 251 F----LWCIIMVSGMTFVPESPRYLVQQNMFEEAKESIAISNKLSKE 293

>KLTH0C09372g Chr3 (778251..780077) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C ITR1 Myo-inositol transporter with strong
           similarity to the minor myo-inositol transporter Itr2p,
           member of the sugar transporter superfamily; expression
           is repressed by inositol and choline via Opi1p and
           derepressed via Ino2p and Ino4p
          Length = 608

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 56/308 (18%), Positives = 118/308 (38%), Gaps = 62/308 (20%)

Query: 12  HNLSTQAHTQDDS------IKKETVSATINSVSSLSEESVKDAGVNN-----IEIYAEQY 60
           H +     + DDS      I+ +  +  +++  +L ++ ++   VN+     + I   Q 
Sbjct: 36  HEIDASKDSNDDSAQSITVIEPDVTNGKLDADGALLDDRIQIRPVNDEDDTSVMITFNQK 95

Query: 61  QNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTV 113
            +PF+  + F +  +  + +G D G I     ++ T       +Y +  +++    +  +
Sbjct: 96  VSPFIIVLTFVAS-ISGFMFGYDTGYISSALVSIGTDLDHRALTYGDKEIITAATSLGAL 154

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAM 173
           I++   I+   ++DI+GR   L  S + + +G V++  A +  +   G      G     
Sbjct: 155 ISS---IFAGTSADIWGRKPCLMFSNLLFTVGAVLQISARSFWQMAVGRLIMGFGVGIGS 211

Query: 174 LIIEIIATDFSNLNWRLLALFIPALPFIINTWIS---GDVTAAVNGNWKWGIGMWAFIFP 230
           LI  +   + +  N R   + I +L       ++   G     V+  W+  +G+   + P
Sbjct: 212 LISPLFIGEIAPKNIRGRLVVINSLCLTGGQLVAYGCGAGLDKVHNGWRILVGLS--LIP 269

Query: 231 LACIPLACC---------------------------------MLHMRYLAHKNAKDRLMP 257
             CI   C                                  ++H + +   NA +R +P
Sbjct: 270 -TCIQFVCFWFLPDTPRYYVMKGRLDKAAEVLGKSYVDAPSELIHQK-IQELNALNRTIP 327

Query: 258 SFTIPKDV 265
             TIPK V
Sbjct: 328 GDTIPKKV 335

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 6/121 (4%)

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAGGC 163
           I  V  A G +   R  DI+GR   L ++   +++G VIE  + +      + R  AG  
Sbjct: 123 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIG 182

Query: 164 FYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIG 223
              +     MLI E+   D          L I    F+ +    G  T + +  W+ G+G
Sbjct: 183 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLG 242

Query: 224 M 224
           +
Sbjct: 243 L 243

>KAFR0C01480 Chr3 complement(301605..303338) [1734 bp, 577 aa] {ON}
           Anc_3.84 YDR497C
          Length = 577

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 11/124 (8%)

Query: 45  VKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------S 97
           V D    ++ I   Q  +PF+  + F +  +  + +G D G I     ++ T       +
Sbjct: 60  VNDEDDTSVMITFNQSVSPFIITLTFVAS-ISGFMFGYDTGYISSALVSIGTDLDNKELT 118

Query: 98  YSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVAR 157
           Y +   ++    +  +I++   I+   A+D++GR   L  S + ++IG +++  A+N  +
Sbjct: 119 YGDKEFITAATSLGALISS---IFAGVAADMYGRKPCLMFSNVMFLIGAILQISASNFWQ 175

Query: 158 FTAG 161
            T G
Sbjct: 176 MTVG 179

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 91/203 (44%), Gaps = 29/203 (14%)

Query: 212 AAVNGNWKWGIG-MWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPS-FTIPKDVSRKE 269
           A+  G     IG  W F+  +  I +   +L   Y+ ++   +R   S F  P  + R  
Sbjct: 108 ASFGGTIASSIGWRWCFLIQVP-ISVISSILMNYYVPNQKEYNRQNSSIFQNPGKILRD- 165

Query: 270 YFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGG---MKEQWRTAHIIVPEVIGWCVALP 326
                    +D++G +LI+   G  L    L+ G    K  W +  +++  ++G  + L 
Sbjct: 166 ---------IDVMGSILIIT--GLTLQLLYLSLGCSTSKLSWTSPSVLL-LLVGSVIILL 213

Query: 327 LYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTV----LIVAVHE 382
           L+IL E K S   + P EL+        L I+ L+ F  Y    Y++T+     IV    
Sbjct: 214 LFILHERKTSARAIIPMELVNSSYSVVVLSISILVGFASY---AYLFTLPLFFQIVLGDS 270

Query: 383 SVKAATRIT--SLYSFV-SVITG 402
           + KA  R+T  SL++ V S+ITG
Sbjct: 271 TAKAGLRLTIPSLFTPVGSLITG 293

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 49/239 (20%), Positives = 91/239 (38%), Gaps = 32/239 (13%)

Query: 8   DQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEES------VKDAGVNNIEIYAEQYQ 61
           D D      +  +   + K    S  I   S+  +E       V D    ++ I   Q  
Sbjct: 23  DADSVEFDNERDSPTKTTKITLESHEIRRASANDDEDRIQIKPVNDEDDTSVMITFNQSL 82

Query: 62  NPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTVI 114
           +PF+  +L F   +  + +G D G I     ++ T       +Y E  +++    +  +I
Sbjct: 83  SPFI-IILTFVASISGFMFGYDTGYISSALISIGTDLDNKVLTYREKEIVTAATSLGALI 141

Query: 115 AAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAML 174
            +   I+   A+D+FGR   L  S + ++IG +++  A    +  AG      G     L
Sbjct: 142 TS---IFAGTAADVFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAAGRLIMGFGVGIGSL 198

Query: 175 IIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA---------VNGNWKWGIGM 224
           I  +  ++ +    R        L  I + W++G    A         VN  W+  +G+
Sbjct: 199 IAPLFISEIAPKMIR------GRLTVINSLWLTGGQLVAYGCGAGLNYVNNGWRILVGL 251

>Skud_4.771 Chr4 complement(1363449..1365203) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 105/281 (37%), Gaps = 40/281 (14%)

Query: 8   DQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSEES------VKDAGVNNIEIYAEQYQ 61
           D D    S Q  +   + K    S  I    +  +E       V D    ++ I   Q  
Sbjct: 23  DADSLGSSNQRESPAKTTKVMLESHEIQRAPASDDEDRIQIKPVNDEDDTSVMITFNQSL 82

Query: 62  NPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTVI 114
           +PF+  + F +  +  + +G D G I     ++ T       +Y E  +++    +  +I
Sbjct: 83  SPFIITLTFVA-SISGFMFGYDTGYISSALISIGTDLDNKVLTYGEKEIVTAATSLGALI 141

Query: 115 AAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAML 174
            +   I+   A+D+FGR   L  S + ++IG +++  A    +   G      G     L
Sbjct: 142 TS---IFAGTAADLFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSL 198

Query: 175 IIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA---------VNGNWKWGIGMW 225
           I  +  ++ +    R        L  I + W++G    A         VN  W+  +G+ 
Sbjct: 199 IAPLFISEIAPKMIR------GRLTVINSLWLTGGQLVAYGCGAGLNHVNNGWRILVGLS 252

Query: 226 AFIFPLACIPLACCML--HMRYLAHK----NAKDRLMPSFT 260
             + P A      C L    RY   K    NA + L  S+T
Sbjct: 253 --LVPTAVQFTCLCFLPDTPRYYVMKGDLHNATEVLKRSYT 291

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 38/195 (19%), Positives = 76/195 (38%), Gaps = 26/195 (13%)

Query: 14  LSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSL 73
           +ST   ++      +  + T   V+  +E+   D   +N  +  +  + P    + +  +
Sbjct: 70  MSTVQSSRGSDADIQNATNTDVYVAPPAEKDCSDEFDDNEILNGDTIEPPKRGLLGYLVI 129

Query: 74  FLVAYAYGLDG-----------------NIRYTFQALATSS---YSEHSLLSTVNCIKTV 113
           +L+ Y     G                 N +  F +   S+   Y  +  +  +  + +V
Sbjct: 130 YLLCYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSV 189

Query: 114 IAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYTG- 171
             A G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  G 
Sbjct: 190 GCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGC 249

Query: 172 ----AMLIIEIIATD 182
                ML+ EI   D
Sbjct: 250 SVLCPMLLSEIAPKD 264

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 77/157 (49%), Gaps = 8/157 (5%)

Query: 259 FTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEV 318
           ++IP ++       ++  + +D IG ++ V   G +L+ F    G    W+ A+IIV  +
Sbjct: 257 YSIPNNIPT-----NIHGFAMDWIGSIMAVI--GLILLNFVWNQGPIVGWQKAYIIVLLI 309

Query: 319 IGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGDYMYTVLIV 378
           I   +AL L+  +EIK+++ P+ P E+ K+R +   L   FL    + +   Y ++ L+ 
Sbjct: 310 IS-IIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLN 368

Query: 379 AVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415
             H S   A     +++    +   I+G F+ ++  +
Sbjct: 369 LRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKRISAS 405

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 16/110 (14%)

Query: 256 MPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIV 315
           +PS TIP ++           + +D IG +L V   G +L+ F         W  A+IIV
Sbjct: 252 IPS-TIPTNIHH---------FSMDWIGSVLGVI--GLILLNFVWNQAPISGWNQAYIIV 299

Query: 316 PEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCW 365
             +I   + L ++I++EI+F++ PL P  ++KDR +   ++  F   F W
Sbjct: 300 ILIIS-VIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALF---FGW 345

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 69/335 (20%), Positives = 130/335 (38%), Gaps = 34/335 (10%)

Query: 33  TINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQA 92
            ++  + L E++      + +E    ++     +  +  SL+L ++   LDG I      
Sbjct: 3   NLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMN 62

Query: 93  LATSSYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQA 152
                + E      +     +   A Q  + + SD+ GR   +  +  F+ +G ++   A
Sbjct: 63  RVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFA 122

Query: 153 TNVARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTA 212
            +V +F        +G  G   +  I  +D      R +      + F +     G +  
Sbjct: 123 NSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANIVFGL-----GQILG 177

Query: 213 AVNGNWKWGIGMWAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFI 272
           A  G        W  +F L    +  C      L HKN   +L  S  +P +    E F 
Sbjct: 178 APIGGLFIDTLGWRILFGLQVPTILLC----SSLVHKNVNIKL--SHLLPVE----ERFK 227

Query: 273 DVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGM---KEQWRTAHIIVPEVIGWCVALPLYI 329
                R+D++G   +V         FT++G +     +   A + +  VI +      +I
Sbjct: 228 WSNLSRIDILGSSTLV---------FTISGVLFLCSTELNKALLSIFTVISFIA----FI 274

Query: 330 LWEIKFSRHPLTPWELLKDR-GVYSA--LIIAFLI 361
           L E+ +S+  + P+ELLK   G+ SA  +I +F+I
Sbjct: 275 LIELYYSKERIMPFELLKGSFGLASAATVISSFII 309

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 54/259 (20%), Positives = 108/259 (41%), Gaps = 27/259 (10%)

Query: 123 ARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLIIEIIATD 182
            R + I G  + L VSI+ +  G++I + + ++     G     +G +G   +  +IA+ 
Sbjct: 174 GRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVIAST 233

Query: 183 FSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIPLACCMLH 242
            +    R++ + + +  + +   +   +  A+  +  W    W F   L    LA  +L 
Sbjct: 234 LTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFVVLA 290

Query: 243 MRYLAHKNAKDRLMPSFTIPKDVSRK--------EYFIDVFFW---RLDMIGLLLIVCFF 291
           M Y  + + +  +   F++ K   R+         ++  +  W   ++D +G +L    F
Sbjct: 291 MVY--NPSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAGF 348

Query: 292 GCVLIPFTLAGGMKEQWRTAHIIVPEVIG---------WCVAL-PLYILWEIKFSRHPLT 341
             +L+  T  G M   W +  IIV  V+G         +  AL P +       S  PL 
Sbjct: 349 TLLLLGLTFGGSMYA-WSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPLL 407

Query: 342 PWELLKDRGVYSALIIAFL 360
           PW ++   G++++    FL
Sbjct: 408 PWRVVSRPGIFTSNTAVFL 426

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 33/174 (18%)

Query: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSSLSE---------ESVKDAGVNN 52
           S+ ++T+ + +N  +   T   + +    S  +  VSS S          E ++    N 
Sbjct: 15  SATASTNSNSYNEKSGNSTAPGAARYNDDSPQVKPVSSYSSHGGPPKDELEELQREADNQ 74

Query: 53  IEIYAEQYQNPFLRAMLFFSLFLVAYAYG----------LDGNIRYT--FQALATSSYSE 100
           +E  ++         +LF S+  +  A+G          + G +R T   +   T+  + 
Sbjct: 75  LETKSKS-------DLLFVSICCLMVAFGGFVFGWDTGTISGFVRQTDYIRRFGTTRANG 127

Query: 101 HSLLSTVN-----CIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE 149
            S LS V       I  +  A G I  +R  D++GR   L + ++ Y +G +I+
Sbjct: 128 TSYLSNVRTGLLVSIFNIGCAIGGIVLSRLGDMYGRKIGLVIVVVIYSVGIIIQ 181

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 75/194 (38%), Gaps = 32/194 (16%)

Query: 16  TQAHTQDDSIKKETVSATINSVSSLS-----EESVKDAGVNNIEIYAEQYQNPFLRAMLF 70
           T   +Q   I+     A I  V S+S     EE  +D    + E+       P   A  +
Sbjct: 2   TDVASQHTEIEGSYTPADITDVHSISSGKDAEELKQDYSEEDSEVPEPAIDIPKKPASAY 61

Query: 71  FSLFLV-------AYAYGLDGNIRYTFQA-------LATSSYSEHSLLSTVN-----CIK 111
            S+ ++        Y  G D      F++         ++S S    LS V       + 
Sbjct: 62  LSVCIMCVMVAFGGYISGWDSGTIGGFESHTDFLARFGSTSGSGKRYLSKVRTGLLTSMF 121

Query: 112 TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAG-GCF 164
            +  A G  +  R  D++GR   + V+ I +I+GTVI+  +        + R  AG GC 
Sbjct: 122 NIGQAIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLGCG 181

Query: 165 YQLGYTGAMLIIEI 178
             +  +  MLI E+
Sbjct: 182 I-IAISSPMLISEV 194

>Kwal_56.22724 s56 complement(253699..255435) [1737 bp, 578 aa] {ON}
           YDR497C (ITR1) - myo-inositol transporter [contig 184]
           FULL
          Length = 578

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 56/124 (45%), Gaps = 11/124 (8%)

Query: 45  VKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS------S 97
           V D    ++ I   Q  +PF+  +L F   +  + +G D G I     ++ T       +
Sbjct: 50  VNDEDDTSVMITFNQKVSPFI-IILTFVASISGFLFGYDTGYISSALISIGTDLDNRVLT 108

Query: 98  YSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVAR 157
           Y +  +++    +  +I+A         +DI+GR   L +S +F++IG V++  A+   +
Sbjct: 109 YGDKEIITAATSLGALISAVAA---GTCADIWGRKPCLMISNLFFVIGAVLQVSASTFWQ 165

Query: 158 FTAG 161
              G
Sbjct: 166 MAVG 169

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 6/77 (7%)

Query: 112 TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYT 170
           +V  A G + FAR +D  GR   + + ++ Y++G +I+ S +    ++  G   Y LG  
Sbjct: 116 SVGCAIGGLIFARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAG 175

Query: 171 G-----AMLIIEIIATD 182
           G      ML+ EI   D
Sbjct: 176 GCSVLCPMLLSEIAPKD 192

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 118 GQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYTG----- 171
           G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  G     
Sbjct: 122 GGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 181

Query: 172 AMLIIEIIATDFSNLNWRLLALF 194
            ML+ EI   D   L   L++LF
Sbjct: 182 PMLLSEIAPKD---LRGGLVSLF 201

>YDR497C Chr4 complement(1443713..1445467) [1755 bp, 584 aa] {ON}
           ITR1Myo-inositol transporter with strong similarity to
           the minor myo-inositol transporter Itr2p, member of the
           sugar transporter superfamily; expression is repressed
           by inositol and choline via Opi1p and derepressed via
           Ino2p and Ino4p
          Length = 584

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 79/198 (39%), Gaps = 26/198 (13%)

Query: 43  ESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLD-GNIRYTFQALATS----- 96
           + V D    ++ I   Q  +PF+  + F +  +  + +G D G I     ++ T      
Sbjct: 64  KPVNDEDDTSVMITFNQSLSPFIITLTFVA-SISGFMFGYDTGYISSALISIGTDLDHKV 122

Query: 97  -SYSEHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNV 155
            +Y E  +++    +  +I +   I+   A+DIFGR   L  S + ++IG +++  A   
Sbjct: 123 LTYGEKEIVTAATSLGALITS---IFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTF 179

Query: 156 ARFTAGGCFYQLGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAA-- 213
            +   G      G     LI  +  ++ +    R        L  I + W++G    A  
Sbjct: 180 WQMAVGRLIMGFGVGIGSLIAPLFISEIAPKMIR------GRLTVINSLWLTGGQLVAYG 233

Query: 214 -------VNGNWKWGIGM 224
                  VN  W+  +G+
Sbjct: 234 CGAGLNYVNNGWRILVGL 251

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 6/77 (7%)

Query: 112 TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIE-SQATNVARFTAGGCFYQLGYT 170
           +V  A G + FAR +D  GR   + + ++ Y++G +I+ S      ++  G   Y LG  
Sbjct: 119 SVGCAIGGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAG 178

Query: 171 G-----AMLIIEIIATD 182
           G      ML+ EI   D
Sbjct: 179 GCSVLCPMLLSEIAPKD 195

>KLLA0C12309g Chr3 (1046848..1048557) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P30606 Saccharomyces cerevisiae
           YOL103W ITR2 Myo-inositol transporter with strong
           similarity to the major myo-inositol transporter Itr1p,
           member of the sugar transporter superfamily; expressed
           constitutively
          Length = 569

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 64/144 (44%), Gaps = 19/144 (13%)

Query: 16  TQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFSLFL 75
           +Q+  +D S  + T    I  V+   + SV         I   Q  +PF+  +L F+  +
Sbjct: 20  SQSKLKDSSENETTDRIIIKPVNDEDDTSVM--------ITFNQKISPFI-LILTFTASI 70

Query: 76  VAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTVIAAAGQIWFARASDI 128
             + +G D G I     ++ T       +Y +  +++    +  +I+A   ++   ++DI
Sbjct: 71  SGFMFGYDTGYISSALVSIGTDLDNKALTYGDKEIITAATSLGALISA---VFAGISADI 127

Query: 129 FGRLTILGVSIIFYIIGTVIESQA 152
           FGR   L  S I ++IG  ++  A
Sbjct: 128 FGRKPCLMFSNILFVIGAALQVSA 151

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 15/106 (14%)

Query: 260 TIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVI 319
           TIP +V      +D   W    IGLL      G +L  F    G    W TA+IIV  ++
Sbjct: 239 TIPTNVRGSS--MD---WIGSGIGLL------GMILFNFVWNQGPIVGWDTAYIIVLLIV 287

Query: 320 GWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCW 365
               A+  + L+E K++  PL P   + +  +   L+  F   F W
Sbjct: 288 S-VAAIVAFFLYETKYANDPLIPRPAMHNHRLLMTLLAVF---FGW 329

>TPHA0A00620 Chr1 (111175..113079) [1905 bp, 634 aa] {ON} Anc_3.84
           YDR497C
          Length = 634

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 15/157 (9%)

Query: 12  HNLSTQAHTQDDSIKKETVSATINSVSSLSEESVKDAGVNNIEIYAEQYQNPFLRAMLFF 71
           H L  + H    +  KE +         +  + V D    ++ I   Q  +PF+  +L F
Sbjct: 84  HELDDELHNSGSNDYKEFLENN----DRIRIKPVNDEDDTSVIINFNQGISPFI-VILTF 138

Query: 72  SLFLVAYAYGLD-GNIRYTFQALATS------SYSEHSLLSTVNCIKTVIAAAGQIWFAR 124
              +  + +G D G I     ++         +Y +   ++    +  +I++   I+   
Sbjct: 139 VASISGFLFGYDTGYISSALISIGNDLDNRPLTYGDKEFITAATSLGALISS---IFAGT 195

Query: 125 ASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
           A+D+FGR   L  S + +++G +++  A    + TAG
Sbjct: 196 AADVFGRKPCLMFSNLMFVVGAIVQITAHKFWQMTAG 232

>NCAS0I02520 Chr9 complement(472075..473838) [1764 bp, 587 aa] {ON}
           Anc_3.84
          Length = 587

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINSVSS--LSEESVKDAGVNNIEIYAEQ 59
           + V T D  I +   +  T   S KK  VS + +   +  +  + V D    ++ I   Q
Sbjct: 24  THVKTNDNSITSFFDEEPTHHTS-KKGNVSLSDDEEDNDRIQIKPVNDEDDVSVIITFNQ 82

Query: 60  YQNPFLRAMLF---FSLFLVAYAYGLDGN--IRYTFQALATSSYSEHSLLSTVNCIKTVI 114
             +PF+  + F    S F+  Y  G   +  I        T +Y +  +++    +  +I
Sbjct: 83  GISPFILILTFVASISGFMFGYDTGYISSALISINKDLGRTLTYGDKEIITAATSLGALI 142

Query: 115 AAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAG 161
           ++   I+   A+DIFGR   L  S + ++IG +++  A    +  AG
Sbjct: 143 SS---IFAGTAADIFGRKPCLMFSNVLFVIGAILQITAHRFWQMNAG 186

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 15/131 (11%)

Query: 110 IKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAGGC 163
           I  V +A G ++ ++  DI+GR T L + I+ Y++G VI+  + +      + R  AG  
Sbjct: 119 IFNVGSAIGCLFLSKLGDIYGRCTGLIIVIVVYMVGIVIQIASVDKWYQYFIGRIIAGIG 178

Query: 164 FYQLGYTGAMLIIEIIATDFSNL---NWRLLALFIPALPFIINTWISGDVTAAVNGNWKW 220
              +     MLI E             W+L+  F   L +  N    G  + + +  W+ 
Sbjct: 179 AGSISVLAPMLISETAPKQIRGTLLACWQLMVTFAIFLGYCTNY---GTKSYSNSVQWRV 235

Query: 221 GIGM---WAFI 228
            +G+   WA I
Sbjct: 236 PLGLCFAWAII 246

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 104/273 (38%), Gaps = 50/273 (18%)

Query: 18  AHTQDDSIKKETVSAT----INSVSS-LSEESVKDAGVNNIEIYAEQYQNPFLRAMLFFS 72
           A    + + KE VS T    I S++S LS+   K  G+       EQ + P    +L  +
Sbjct: 11  AEKAIEVVTKEMVSLTNYSAIGSLTSQLSQNDTKSGGI-------EQKKLPLKPILLCLA 63

Query: 73  LFLVAYAYGLD----GNIR----------YTFQALATSSYSEHSLLSTVNCIKTVIAAAG 118
                + +G D    G I             F + + + Y    L+  +  I  +  A G
Sbjct: 64  TSFAGFIFGWDVGTIGGITNMVSFQNFFGTNFDSSSNTHYFPKLLIGLIVSIFNISCALG 123

Query: 119 QIWFARASDIFGRLTILGVSIIFYIIGTVIESQATN------VARFTAGGCFYQLGYTGA 172
            ++  + +DI GR   +  +I  Y +GT+I     +       ARF +G     LG    
Sbjct: 124 GLFLVKIADINGRKPGIYAAITIYSLGTLIGWTCGSSWWYFFFARFISG-----LGVGAT 178

Query: 173 MLIIEIIATDFSNLNWR-----LLALFIP---ALPFIINTWISGDVTAAVNGNWKWGIGM 224
            ++I +   + + +N R     L  L I     L  +IN      +    N  WK  +G+
Sbjct: 179 AVMIPMFIAESAPINIRGAMVVLYQLMITLGILLGNVINYCCRSTLHETDNATWKIPVGL 238

Query: 225 ---WAFIFPLAC--IPLACCMLHMRYLAHKNAK 252
              WA I  L    +P +   L  R  +   AK
Sbjct: 239 GNVWAAIVALGVHFMPESPVFLTKRLGSALKAK 271

>TPHA0B03900 Chr2 (920520..922184) [1665 bp, 554 aa] {ON} Anc_1.432
          Length = 554

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 19/107 (17%)

Query: 68  MLFFSLFLVAYAYGLDGNIRY------TFQALATSSYSEHSLLSTVNCIKTVIAAAGQIW 121
           M  F +  ++   G +G I Y      T Q   T+S +  SL              G + 
Sbjct: 42  MFGFDISSMSSMIGTEGYIEYFGTPDSTTQGGITASMAAGSL-------------GGALV 88

Query: 122 FARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLG 168
             + SD FGR   L +   F+IIG +I+  + NV    AG     +G
Sbjct: 89  SPKFSDAFGRRVSLHLCAAFWIIGAIIQCASQNVGMLVAGRVISGIG 135

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 82/188 (43%), Gaps = 26/188 (13%)

Query: 225 WAFIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGL 284
           W F+  +    ++  +++      K   D+    F  PK +             +D++G 
Sbjct: 122 WCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKI----------LTGIDVMGS 171

Query: 285 LLIVCFFGCVLIPFTLAGGMKE---QWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLT 341
           +LI+   G  L    L+ G       W +  +++  + G  + L L+IL E K +   + 
Sbjct: 172 ILIIT--GLTLQLLYLSLGCSTSNLSWTSPSVLL-LLFGSVIILLLFILHERKTTARAII 228

Query: 342 PWELLKDRGVYSALIIAFLINFCWYMQGDYMYTV----LIVAVHESVKAATRIT--SLYS 395
           P EL+     +  L I+ L+ F  Y    Y++T+     IV    + KA  R+T  SL++
Sbjct: 229 PMELVSSSYSFVVLSISILVGFASYA---YLFTLPLFFQIVLGDSTAKAGLRLTIPSLFT 285

Query: 396 FV-SVITG 402
            V S+ITG
Sbjct: 286 PVGSLITG 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,344,079
Number of extensions: 2386826
Number of successful extensions: 10003
Number of sequences better than 10.0: 281
Number of HSP's gapped: 9935
Number of HSP's successfully gapped: 282
Length of query: 634
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 518
Effective length of database: 40,180,143
Effective search space: 20813314074
Effective search space used: 20813314074
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)