Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D022106.5ON77377338880.0
NDAI0I027306.5ON83271426530.0
CAGL0A01133g6.5ON80173823480.0
Suva_16.356.5ON76774123170.0
TDEL0G046606.5ON73966022950.0
YPL270W (MDL2)6.5ON77361722890.0
Smik_6.4786.5ON77358822860.0
Skud_16.76.5ON77358122680.0
ZYRO0F00396g6.5ON73270122560.0
TBLA0A071906.5ON79466022290.0
Kpol_1045.836.5ON74867522180.0
TPHA0J002206.5ON74059721970.0
KNAG0E028006.5ON74169621440.0
SAKL0E00748g6.5ON77458920930.0
Kwal_56.223296.5ON77662520770.0
KLLA0D00748g6.5ON78961720480.0
KLTH0C11616g6.5ON74059920290.0
KAFR0B064806.5ON75166420020.0
ACR022W6.5ON75460920020.0
Ecym_30076.5ON76970219830.0
Kpol_2000.791.67ON70768213751e-180
NCAS0B087001.67ON71562113611e-178
TPHA0B046201.67ON72063213601e-178
YLR188W (MDL1)1.67ON69565113531e-177
AFR683C1.67ON67761713421e-175
SAKL0C02244g1.67ON71264013431e-175
KLLA0C01991g1.67ON70666313391e-175
Ecym_10721.67ON68363813361e-174
NDAI0A005601.67ON71460913361e-174
Smik_12.2481.67ON69661513281e-173
Skud_12.2531.67ON69266413271e-173
TDEL0C063501.67ON69362813091e-170
Suva_10.2841.67ON69360012991e-169
ZYRO0F17050g1.67ON71469012921e-167
KLTH0F02024g1.67ON73465612701e-164
Kwal_33.133081.67ON70664012651e-163
TBLA0A053001.67ON70759312351e-159
CAGL0E00385g1.67ON60860311771e-152
SAKL0H00968g5.20ON7003915157e-55
Kwal_26.94805.20ON7194355141e-54
KLTH0B09482g5.20ON6944375061e-53
Skud_13.4755.20ON6913894991e-52
Suva_13.4915.20ON6933934962e-52
KLLA0A10131g5.20ON7203934963e-52
KNAG0E013205.20ON6953904911e-51
YMR301C (ATM1)5.20ON6903874901e-51
Smik_13.5185.20ON6873894892e-51
KAFR0I025805.20ON7094514822e-50
TBLA0C070005.20ON7253914796e-50
TPHA0L022705.20ON7113924761e-49
Ecym_56495.20ON6963874724e-49
NDAI0I024405.20ON7304574717e-49
NCAS0D024305.20ON7023174707e-49
Kpol_1018.1851.527ON12765284761e-48
TDEL0F003401.527ON12575514743e-48
YKL209C (STE6)1.527ON12905344691e-47
TDEL0G004305.20ON6963894583e-47
Kpol_513.235.20ON7083154541e-46
AGL335W5.20ON6914284521e-46
CAGL0M13739g5.20ON7273384461e-45
Skud_11.111.527ON12955294493e-45
KAFR0E002301.527ON12704954484e-45
ZYRO0D07106g5.20ON7093854391e-44
SAKL0A10208g1.527ON13104924432e-44
NDAI0D015401.527ON12935284404e-44
ZYRO0G02244g1.527ON12734054404e-44
Suva_11.111.527ON12905134388e-44
Ecym_36121.527ON13155414262e-42
KNAG0G001901.527ON12754894219e-42
AFR432W1.527ON12845024192e-41
TBLA0B100701.527ON12965014182e-41
CAGL0K00363g1.527ON12274314173e-41
TPHA0C009608.303ON15234934149e-41
Smik_11.141.527ON13165064131e-40
KLTH0B01100g1.527ON12983694111e-40
TPHA0O001601.527ON12535184102e-40
KLLA0B14256g1.527ON12715784075e-40
NCAS0G035101.527ON12885154058e-40
Kwal_33.155611.527ON12975524003e-39
TDEL0E056104.52ON15355343933e-38
YHL035C (VMR1)4.6ON15925863916e-38
NDAI0J011508.303ON15174783881e-37
SAKL0H00704g5.10ON14395093835e-37
KNAG0J027304.52ON15375453772e-36
NCAS0C059304.6ON16575523773e-36
KAFR0B056308.303ON15154823755e-36
Skud_7.6145.10ON14776533755e-36
Ecym_42658.303ON15054933721e-35
ZYRO0G07612g4.6ON16955553702e-35
Suva_8.164.6ON15995533702e-35
Skud_4.3958.303ON15164763692e-35
NCAS0B034708.303ON15124783683e-35
Smik_12.484.52ON15575413665e-35
KNAG0E011204.6ON17175103659e-35
CAGL0E03982g4.6ON16595433641e-34
YGR281W (YOR1)5.10ON14775713631e-34
YDR135C (YCF1)8.303ON15154773632e-34
Smik_4.3808.303ON15164793622e-34
NDAI0B006405.10ON14915433622e-34
Smik_8.64.6ON15855263594e-34
Suva_7.5775.10ON14785023594e-34
Kwal_34.157704.6ON14365453594e-34
SAKL0H16016g8.303ON14994803594e-34
CAGL0E03355g4.52ON15355353585e-34
CAGL0C03289g4.6ON16485073585e-34
CAGL0G00242g5.10ON14775193586e-34
Smik_16.275.10ON14775713578e-34
Kwal_56.22747na 1ON15385293551e-33
Suva_2.2978.303ON15164733551e-33
KNAG0K001705.10ON14425133541e-33
AGR047W8.303ON14924793541e-33
SAKL0H26026g4.6ON16535003542e-33
Ecym_84184.6ON16784943532e-33
NCAS0E041605.10ON15065153523e-33
KAFR0C065105.10ON14575123523e-33
ZYRO0D06160g8.303ON15254813523e-33
TBLA0G007104.6ON16915013514e-33
KLTH0H16038g4.6ON16494993498e-33
Kpol_1033.288.303ON15314923462e-32
KNAG0I009908.303ON15354743452e-32
NCAS0J00160singletonON16545423452e-32
KLTH0C09240gna 1ON15463113443e-32
KLLA0F20075g8.303ON15165613443e-32
Suva_10.234.6ON16615053443e-32
Skud_12.524.52ON15615453425e-32
TDEL0G018504.6ON16425083417e-32
TDEL0F043008.303ON15144753417e-32
YLL015W (BPT1)4.52ON15595443391e-31
KLLA0E00529g4.6ON16504953372e-31
Skud_8.94.6ON15875793363e-31
TPHA0F001804.6ON16464803353e-31
Kpol_311.34.6ON16575673354e-31
TPHA0K023104.6ON16494963345e-31
KAFR0L001904.6ON16534953345e-31
Kwal_56.238448.303ON14944663335e-31
NDAI0H001904.6ON16825063336e-31
TPHA0A056205.10ON14775073336e-31
Kpol_1060.75.10ON14605033336e-31
Suva_10.594.52ON15615453328e-31
YLL048C (YBT1)4.6ON16615493328e-31
KLTH0G12716g8.303ON15004713301e-30
KAFR0I013004.52ON15365323301e-30
Suva_10.60singletonON9902663272e-30
Smik_12.114.6ON16615083273e-30
Skud_12.224.6ON16615073256e-30
CAGL0L06402g8.303ON15354683141e-28
ZYRO0G22176g4.52ON15703353141e-28
ACL072C4.6ON16275623122e-28
TPHA0F004104.52ON15705573113e-28
TBLA0C06400singletonON13775613113e-28
KLTH0B00396gsingletonON15072323104e-28
TBLA0A038008.303ON15465323086e-28
TDEL0G003305.10ON14654893087e-28
SAKL0H23958g4.52ON15585023087e-28
KLTH0B09724g5.10ON14865033061e-27
KLLA0D04059g4.52ON15682663042e-27
Zrou_YGOB_Anc_5.105.10ON9925102961e-26
YKR104WsingletonON3062502802e-26
Kwal_26.95325.10ON14714962925e-26
KLLA0C14234g5.10ON14544962916e-26
TBLA0C071005.10ON14855092917e-26
Kpol_YGOB_1041.454.52ON15685332872e-25
TBLA0A06840singletonON10582702862e-25
Smik_11.367na 2ON15955442872e-25
Kpol_1041.45singletonOFF15965332872e-25
Skud_18.2singletonON15805362863e-25
AGL346W5.10ON14004992666e-23
Ecym_56605.10ON15362392193e-17
YKR103W (NFT1)na 2ON12182272023e-15
ZYRO0E08800g3.534ON6102291968e-15
SAKL0F01606g3.534ON6081771896e-14
Ecym_11943.534ON6091801871e-13
NCAS0E004803.534ON6102291815e-13
Kwal_47.191163.534ON6072381815e-13
CAGL0C02343g3.534ON7202321816e-13
AFR232C3.534ON6072351791e-12
TBLA0I033303.534ON6101741771e-12
Kpol_175.1singletonON13772191782e-12
TDEL0D060203.534ON6101741772e-12
TPHA0A058903.534ON6102311762e-12
NDAI0I030203.534ON6092291762e-12
YER036C (ARB1)3.534ON6102331743e-12
KAFR0J027003.534ON6081801734e-12
Suva_5.1343.534ON6101741734e-12
Smik_5.1593.534ON6101741726e-12
Skud_5.1453.534ON6101741727e-12
TBLA0D043501.427ON11192461728e-12
SAKL0D10208g1.366ON7522361728e-12
KLTH0G01452g3.534ON6072321701e-11
Kpol_1050.263.534ON6101741691e-11
KNAG0C019601.366ON7522381692e-11
KNAG0B004603.534ON6601741673e-11
ACR128C8.661ON8271891673e-11
ZYRO0D11836gna 3ON14622371683e-11
AGL142CsingletonON14972191673e-11
NDAI0H035701.366ON7552071664e-11
CAGL0K10472g1.366ON7522111664e-11
KAFR0C045401.366ON7522381655e-11
ZYRO0G01144g1.366ON7522341646e-11
KNAG0I005301.427ON10472421639e-11
TDEL0B057601.427ON10362611631e-10
KLLA0A01452g3.534ON6071741621e-10
Kwal_26.87308.661ON8311991621e-10
ZYRO0D11880g5.500ON14982221631e-10
ZYRO0E04092g1.427ON10622411602e-10
YPL147W (PXA1)8.661ON8701991593e-10
Suva_16.1638.661ON8701991593e-10
TBLA0D01820singletonON15512391593e-10
TBLA0C012201.366ON7512331583e-10
TDEL0A036405.500ON15092361593e-10
Ecym_24108.661ON8281931583e-10
TBLA0D017805.500ON15952391594e-10
Kpol_1043.431.366ON7522211574e-10
KAFR0C052205.500ON14992481585e-10
CAGL0I04862g3.220ON15072391575e-10
Smik_6.3448.661ON8701961575e-10
AEL032W1.366ON7532401567e-10
SAKL0C11616g3.220ON14842401567e-10
Kwal_0.3271.427ON10192421567e-10
KAFR0C05210na 4ON14932391559e-10
KNAG0B038705.500ON15132191559e-10
KLLA0F11484g8.661ON8452131541e-09
Ecym_8014na 5ON15172351541e-09
ZYRO0D11858gna 4ON15032411541e-09
Skud_14.404na 6ON14242371541e-09
YNR070W (PDR18)na 6ON13332401541e-09
YDR406W (PDR15)5.500ON15292391541e-09
ZYRO0A04114g3.220ON15182381541e-09
KLTH0D10890g8.661ON8302091531e-09
YFR009W (GCN20)1.366ON7522111531e-09
KAFR0F014601.427ON10572421531e-09
Smik_7.3131.366ON7522111532e-09
KNAG0A029808.661ON8711971532e-09
TPHA0A023101.366ON7522111522e-09
NCAS0E016303.220ON15652411522e-09
ZYRO0B05588g3.133ON12702691522e-09
Smik_4.6785.500ON15332381522e-09
Skud_4.6805.500ON14452391522e-09
Skud_4.681na 4ON14452391522e-09
TPHA0O010001.427ON10112501513e-09
KLLA0A10857g1.366ON7522281503e-09
KNAG0C045005.500ON15552181513e-09
KAFR0A037908.661ON8762031503e-09
YOR328W (PDR10)na 7ON15642361513e-09
Skud_16.1358.661ON8701991504e-09
KLLA0D03432g3.220ON14832421504e-09
TPHA0D011708.661ON9152141494e-09
Ecym_27141.366ON7482291494e-09
Suva_6.841.366ON7522111495e-09
KLTH0A01914g3.220ON14992361495e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02210
         (773 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5     1502   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...  1026   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   909   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   897   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   888   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   886   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   885   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   878   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   873   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   863   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   858   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   850   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   830   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   810   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   804   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   793   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   786   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   775   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   775   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   768   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   534   e-180
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   528   e-178
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   528   e-178
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   525   e-177
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   521   e-175
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   521   e-175
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   520   e-175
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   519   e-174
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   519   e-174
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   516   e-173
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   515   e-173
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   508   e-170
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   504   e-169
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   502   e-167
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   493   e-164
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   491   e-163
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   480   e-159
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   457   e-152
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   202   7e-55
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   202   1e-54
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   199   1e-53
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   196   1e-52
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   195   2e-52
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   195   3e-52
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   193   1e-51
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   193   1e-51
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   192   2e-51
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   190   2e-50
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   189   6e-50
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   187   1e-49
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   186   4e-49
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   186   7e-49
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     185   7e-49
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   187   1e-48
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   187   3e-48
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   185   1e-47
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   181   3e-47
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   179   1e-46
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   178   1e-46
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   176   1e-45
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   177   3e-45
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   177   4e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   173   1e-44
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   175   2e-44
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   174   4e-44
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   174   4e-44
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   173   8e-44
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   168   2e-42
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   166   9e-42
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   166   2e-41
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   165   2e-41
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   165   3e-41
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   164   9e-41
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   163   1e-40
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   162   1e-40
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   162   2e-40
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   161   5e-40
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   160   8e-40
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   158   3e-39
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   155   3e-38
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   155   6e-38
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   154   1e-37
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   152   5e-37
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   149   2e-36
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   149   3e-36
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   149   5e-36
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   149   5e-36
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   147   1e-35
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   147   2e-35
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   147   2e-35
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   146   2e-35
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   146   3e-35
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   145   5e-35
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   145   9e-35
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   144   1e-34
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   144   1e-34
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   144   2e-34
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   144   2e-34
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    144   2e-34
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   142   4e-34
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   142   4e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   142   4e-34
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   142   4e-34
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   142   5e-34
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   142   5e-34
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   142   6e-34
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   142   8e-34
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   141   1e-33
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   141   1e-33
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   140   1e-33
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   140   1e-33
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   140   2e-33
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   140   2e-33
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    140   3e-33
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   140   3e-33
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   140   3e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   139   4e-33
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   139   8e-33
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   137   2e-32
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   137   2e-32
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   137   2e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   137   3e-32
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   137   3e-32
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   137   3e-32
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   136   5e-32
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   135   7e-32
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   135   7e-32
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   135   1e-31
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   134   2e-31
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   134   3e-31
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   133   3e-31
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   133   4e-31
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   133   5e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   133   5e-31
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   132   5e-31
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   132   6e-31
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   132   6e-31
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   132   6e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   132   8e-31
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   132   8e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   131   1e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   131   1e-30
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   130   2e-30
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   130   3e-30
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   129   6e-30
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   125   1e-28
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   125   1e-28
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   124   2e-28
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   124   3e-28
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   124   3e-28
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   124   4e-28
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   123   6e-28
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   123   7e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   123   7e-28
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   122   1e-27
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   121   2e-27
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   118   1e-26
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   112   2e-26
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   117   5e-26
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   116   6e-26
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           116   7e-26
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   115   2e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   114   2e-25
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   115   2e-25
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   115   2e-25
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   114   3e-25
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   107   6e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    89   3e-17
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    82   3e-15
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    80   8e-15
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    77   6e-14
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    77   1e-13
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 74   5e-13
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    74   5e-13
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    74   6e-13
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    74   1e-12
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    73   1e-12
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    73   2e-12
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    73   2e-12
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    72   2e-12
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    72   2e-12
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    72   3e-12
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    71   4e-12
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    71   4e-12
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    71   6e-12
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    71   7e-12
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    71   8e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    71   8e-12
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    70   1e-11
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    70   1e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    70   2e-11
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    69   3e-11
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    69   3e-11
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    69   3e-11
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    69   3e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    69   4e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    69   4e-11
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    68   5e-11
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    68   6e-11
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    67   9e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    67   1e-10
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    67   1e-10
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    67   1e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    67   1e-10
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    66   2e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    66   3e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    66   3e-10
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              66   3e-10
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    65   3e-10
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    66   3e-10
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    65   3e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    66   4e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    65   4e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    65   5e-10
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    65   5e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    65   5e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    65   7e-10
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    65   7e-10
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    65   7e-10
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   9e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    64   9e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    64   1e-09
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    64   1e-09
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    64   1e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    64   1e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    64   1e-09
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    64   1e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    64   1e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    64   1e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    64   2e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    64   2e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    63   2e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    63   2e-09
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    63   2e-09
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    63   2e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   2e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    63   2e-09
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    63   3e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    62   3e-09
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    63   3e-09
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    62   3e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    63   3e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    62   4e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    62   4e-09
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    62   4e-09
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    62   4e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    62   5e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    62   5e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    62   5e-09
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    62   5e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              62   5e-09
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    62   5e-09
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    62   6e-09
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    62   6e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    61   7e-09
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    62   7e-09
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    61   8e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    61   9e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    61   1e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    61   1e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    61   1e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    61   1e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    61   1e-08
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    61   1e-08
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    61   1e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    61   1e-08
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    60   1e-08
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    61   1e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    60   1e-08
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    60   1e-08
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    60   2e-08
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    60   2e-08
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    60   2e-08
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     60   2e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    60   2e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    60   2e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    60   2e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    60   2e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    60   2e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                60   2e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    60   2e-08
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    60   2e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    59   3e-08
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    60   3e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    60   3e-08
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    59   3e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    59   3e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    59   3e-08
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    59   3e-08
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    59   3e-08
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    59   4e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    54   4e-08
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    59   4e-08
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    59   4e-08
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    59   4e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    59   5e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    59   5e-08
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    59   5e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    59   6e-08
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    59   6e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    59   6e-08
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    59   6e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            58   8e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    58   8e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       58   9e-08
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    58   9e-08
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    58   9e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    58   1e-07
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    58   1e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    58   1e-07
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    57   1e-07
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             57   2e-07
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    57   2e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    57   2e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    57   2e-07
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    57   2e-07
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    57   2e-07
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    57   2e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    57   2e-07
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    57   2e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    57   2e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    57   2e-07
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    57   2e-07
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    56   3e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    56   3e-07
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    56   3e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    56   3e-07
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    56   3e-07
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    56   4e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    56   4e-07
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    55   4e-07
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    56   4e-07
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    56   4e-07
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    55   5e-07
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    55   5e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    55   5e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    55   5e-07
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    55   5e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    55   6e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    55   6e-07
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    55   6e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    55   9e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    54   1e-06
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    54   1e-06
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    54   1e-06
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    54   1e-06
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    54   1e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    54   1e-06
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    54   1e-06
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    54   2e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    54   2e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    54   2e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    54   2e-06
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     53   2e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    53   3e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    52   3e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    53   3e-06
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    53   4e-06
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    52   4e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    52   4e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    52   4e-06
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    52   4e-06
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    51   5e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    52   5e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    50   5e-06
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    50   6e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    52   7e-06
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    51   7e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    52   7e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    52   8e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    51   9e-06
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    51   9e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    51   1e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    50   1e-05
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    51   1e-05
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    51   1e-05
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    51   1e-05
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    51   1e-05
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    51   1e-05
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    51   1e-05
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    51   1e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    50   2e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    50   2e-05
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    49   2e-05
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    50   2e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    49   2e-05
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    50   2e-05
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          49   2e-05
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    50   2e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              50   2e-05
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    50   2e-05
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    50   2e-05
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    50   2e-05
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    50   3e-05
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    49   3e-05
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    50   3e-05
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    50   3e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    50   3e-05
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    50   3e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    50   3e-05
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    49   3e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    49   4e-05
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    49   4e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              49   4e-05
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    49   4e-05
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    49   5e-05
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    49   5e-05
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    49   5e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    49   5e-05
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    49   6e-05
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    49   7e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    49   7e-05
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    49   7e-05
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    48   8e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    48   1e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    48   1e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    47   1e-04
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    47   1e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    47   2e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    47   2e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    47   2e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    47   2e-04
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    45   3e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    45   3e-04
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    46   4e-04
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    45   4e-04
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    46   4e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    46   5e-04
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    46   5e-04
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    45   5e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    45   5e-04
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    45   5e-04
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    45   6e-04
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    45   7e-04
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    44   8e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    45   8e-04
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    44   9e-04
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    45   9e-04
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    45   9e-04
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    45   0.001
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    45   0.001
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    44   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.001
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    44   0.001
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    44   0.001
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    43   0.001
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    44   0.002
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    44   0.002
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    44   0.002
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.002
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    44   0.002
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    44   0.002
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.002
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    43   0.003
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.003
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    43   0.003
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    43   0.003
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    43   0.004
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    43   0.004
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    43   0.004
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    42   0.005
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    42   0.006
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    42   0.006
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    42   0.006
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.007
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.007
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    41   0.008
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    42   0.008
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    42   0.009
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    40   0.009
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    41   0.010
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    41   0.010
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    41   0.011
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    41   0.011
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    41   0.012
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    41   0.013
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    41   0.016
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    40   0.016
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    40   0.018
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    40   0.027
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    40   0.028
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    40   0.029
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.033
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    39   0.042
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    39   0.049
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    39   0.059
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.078
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.088
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    38   0.10 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    38   0.11 
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    37   0.15 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.22 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    37   0.30 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    36   0.31 
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    37   0.32 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    36   0.36 
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    35   0.37 
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    36   0.38 
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    36   0.41 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   0.58 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    35   0.62 
YER172C Chr5 complement(529530..536021) [6492 bp, 2163 aa] {ON} ...    35   0.66 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.82 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   0.84 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.87 
Skud_6.83 Chr6 (155917..156978) [1062 bp, 353 aa] {ON} YFR007W (...    35   0.93 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.93 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    35   1.00 
NCAS0C04460 Chr3 complement(914189..915700) [1512 bp, 503 aa] {O...    34   1.5  
KAFR0A01410 Chr1 (275674..276186) [513 bp, 170 aa] {ON} Anc_1.27...    33   1.9  
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    33   2.2  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    33   2.2  
Kpol_1076.4 s1076 (7022..8185) [1164 bp, 387 aa] {ON} (7022..818...    32   4.5  
KLTH0G16808g Chr7 (1458675..1459718) [1044 bp, 347 aa] {ON} simi...    32   5.2  
Skud_8.213 Chr8 (368590..370329) [1740 bp, 579 aa] {ON} YHR150W ...    32   6.2  
Suva_6.73 Chr6 (124236..125297) [1062 bp, 353 aa] {ON} YFR007W (...    32   6.9  

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score = 1502 bits (3888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 739/773 (95%), Positives = 739/773 (95%)

Query: 1   MMIPKITTPLTRYTYAHSYRPYANISRRLIHNVNPCHQHILPYTLGIRFLPSQSTYQSIR 60
           MMIPKITTPLTRYTYAHSYRPYANISRRLIHNVNPCHQHILPYTLGIRFLPSQSTYQSIR
Sbjct: 1   MMIPKITTPLTRYTYAHSYRPYANISRRLIHNVNPCHQHILPYTLGIRFLPSQSTYQSIR 60

Query: 61  TLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEP 120
           TLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEP
Sbjct: 61  TLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEP 120

Query: 121 KSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGE 180
           KSNFSDVIRLFLLVKTDWK          ISCVIGMMIPKVIGIILDSLKVQTATQSEGE
Sbjct: 121 KSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQSEGE 180

Query: 181 EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQ 240
           EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFG        SERLVARLRSTVIKRTIHQ
Sbjct: 181 EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRTIHQ 240

Query: 241 DAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVL 300
           DAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVL
Sbjct: 241 DAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVL 300

Query: 301 GVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFN 360
           GVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFN
Sbjct: 301 GVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFN 360

Query: 361 EAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 420
           EAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT
Sbjct: 361 EAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 420

Query: 421 EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFS 480
           EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFS
Sbjct: 421 EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFS 480

Query: 481 YPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 540
           YPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK
Sbjct: 481 YPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 540

Query: 541 MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHT 600
           MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHT
Sbjct: 541 MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHT 600

Query: 601 YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKT 660
           YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKT
Sbjct: 601 YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKT 660

Query: 661 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXT 720
           KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP                T
Sbjct: 661 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSSRKKT 720

Query: 721 KSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMSTTDTL 773
           KSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMSTTDTL
Sbjct: 721 KSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMSTTDTL 773

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/714 (71%), Positives = 574/714 (80%), Gaps = 34/714 (4%)

Query: 92  RLNSTVST--------QSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXX 143
           R NST +T        +S ++ + S + N +   ++ +SNF DV RLFLLVK D+K    
Sbjct: 121 RFNSTTNTTDTIPPHTESTESTKASTEPNEIE-PDQGESNFKDVFRLFLLVKKDYKLLIV 179

Query: 144 XXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIA 203
                 ISC IGMMIPK+IG+ILD+LK   AT  +G  +PPP +MFGLT+YEFLGGFS+A
Sbjct: 180 SLTLLTISCTIGMMIPKIIGLILDALK-SVATTPDGGSSPPPTIMFGLTLYEFLGGFSVA 238

Query: 204 LLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYI 263
           L  GC AN+G        SERLVARLRS V+K T+HQD++F+D+HK GDLISRLGAD+YI
Sbjct: 239 LFIGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYI 298

Query: 264 VSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSR 323
           VSRSITQKISDG KSLICGGVG+GMM  LS+DLS+VL   +IPVV+SASIFGKQIRINSR
Sbjct: 299 VSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSR 358

Query: 324 ELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTS 383
           ELQDATGQLTRVSEEQLNGV+TVQSFVAEQREIKRFN +IR IF VGKR+AFINAKFFTS
Sbjct: 359 ELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTS 418

Query: 384 TSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGA 443
           TSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGN+IFGLSTFYSEIMQGAGA
Sbjct: 419 TSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGA 478

Query: 444 ASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNV 503
           ASRLFELTD VP IRPTLGKTY PGKGEIEFKNVSF+YPTRP NQIFK+LNFKI+PGSNV
Sbjct: 479 ASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNV 538

Query: 504 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
           CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK+NSKSLRR++ +VQQEPVLMSG+
Sbjct: 539 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGT 598

Query: 564 IRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIA 623
           IRDNITYGLT  PTKEEIR VAKQCFCHNFI KFP+TYDT IGP GTLLSGGQKQRIAIA
Sbjct: 599 IRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIA 658

Query: 624 RALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIV 683
           RALIKKPNILILDEATSALDVESEGAINYTFGQLMK+KSMTIVSIAHRLSTIRRSEN+IV
Sbjct: 659 RALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIV 718

Query: 684 LGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISSA--------------- 728
           LGNDGSV+EMGKFKELF+DP                  +  +                  
Sbjct: 719 LGNDGSVVEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVSSANGSSIHH 778

Query: 729 ---------PEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMSTTDTL 773
                     + D ++   P       +ED++ SVLNDV++ESKPIK+S  D L
Sbjct: 779 EGTILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSPKDPL 832

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/738 (63%), Positives = 547/738 (74%), Gaps = 52/738 (7%)

Query: 83  SLTSQLTITRLNSTVSTQS-------KDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVK 135
           +L ++   T  N++V +QS       +D K    +    S ++E  S F D++RL LLV+
Sbjct: 69  ALNNEYNTTAGNASVKSQSATKEKNEEDRKYSKKEKEEQSETKENHSEFRDIVRLMLLVR 128

Query: 136 TDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQS-EGE----EAPPPIMMFG 190
            DWK          ISC IGM IPKVIG+ILD LK   A  S +G+    +  PPI+ FG
Sbjct: 129 RDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDKLPPIV-FG 187

Query: 191 LTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKT 250
           L+ YEFLGGF++ALL G  AN+G        SERLVARLR+TVIK+TIHQDA+F+D HK 
Sbjct: 188 LSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKV 247

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           GDLISRLG+DAY+VSRS+TQK+SDGFK+LICG VG+GMM +LS  LS +L V   PV++S
Sbjct: 248 GDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILS 307

Query: 311 ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVG 370
           AS+FGKQI   SRELQ+ATG LT+V+EEQL+G+KTVQSFVAEQREI R+N AIR+IF++G
Sbjct: 308 ASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIG 367

Query: 371 KRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGL 430
           K++A INAKFF+STS +GDLSFLTVL +GSYLVL  SLTIGDLTAFM+YTEYTGNSIFGL
Sbjct: 368 KKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGL 427

Query: 431 STFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIF 490
           STFYSEIMQGAGAASRLFELTD VP I  T G  Y PG GEIEFKNVSF+YPTRP N IF
Sbjct: 428 STFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIF 487

Query: 491 KNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKL 550
           KNLNFKIE GSNVCIVGPSG+GKST+ALLL  YY P+SG+ILIDGQ+I  +NSKSLRR +
Sbjct: 488 KNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHI 547

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGT 610
           G+VQQEP+LMSG+IRDNI YGLT  PTK+EIR+VAKQCFCHNFIT+F  +YDT IGP GT
Sbjct: 548 GLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGT 607

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLMK K MTIVSIAH
Sbjct: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKS-------- 722
           RLSTIRRSENVIVLG+DGSV+EMGKFKEL+ DP                T +        
Sbjct: 668 RLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQTTNITVTPPPT 727

Query: 723 ---------------------DP------ISSAPEVDADATGEPVEPIDPAIEDALHSVL 755
                                DP      IS+  EV A+      E I+  IED + +V+
Sbjct: 728 TMAEKVVEEVVENAEPETVIEDPGSPPMYISTVSEVSAEGH----ELINEQIEDTIENVM 783

Query: 756 NDVTSESKPIKMSTTDTL 773
            DVTSE KP+K+   + L
Sbjct: 784 KDVTSERKPLKLQKDENL 801

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/741 (63%), Positives = 550/741 (74%), Gaps = 35/741 (4%)

Query: 56  YQSIRTLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGN--P 113
           ++S+ T  S+   P   L  +      SL SQ    R NST  TQ      PS   +  P
Sbjct: 31  FRSLATTSSSHLIPIHHLCTRPAPISKSLLSQFV--RFNST-KTQQDIPPLPSTSASKQP 87

Query: 114 LSTSEEPKSN-FSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQ 172
              + + KS+ + D+IRLF+L K DWK          ISC IGM IPKVIGI+LD+LK  
Sbjct: 88  AKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK-- 145

Query: 173 TATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRST 232
           T++ S+  +   PI  F L +YEFL  F++ALL GC+ANFG        SER+VARLR+ 
Sbjct: 146 TSSGSDFFDLKIPI--FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAH 203

Query: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
           VIK+T+HQDA+F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSL
Sbjct: 204 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSL 263

Query: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
           S  LS +L     PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE
Sbjct: 264 SPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 323

Query: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
             E+ R+N AIR+IF VGK +AF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGD
Sbjct: 324 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 383

Query: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472
           LTAFMLYTEYTGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT+G  Y P +G I
Sbjct: 384 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVI 443

Query: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
           EFK+VSFSYPTRP  QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+
Sbjct: 444 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 503

Query: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592
           ID QDITKMN KSLRR +GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHN
Sbjct: 504 IDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 563

Query: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
           FITKFP+TYDT IGP+GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINY
Sbjct: 564 FITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINY 623

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXX 712
           TFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL+S+P         
Sbjct: 624 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLN 683

Query: 713 XXXX------XXXTKSDPISSAPEVDA----------------DATGEPVEPIDPA---I 747
                         + D     P  D                 D+  +P+E  D     I
Sbjct: 684 ERTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPLESKDKKSDDI 743

Query: 748 EDALHSVLNDVTSESKPIKMS 768
           E+++  VL D   E+ PIK+S
Sbjct: 744 EESVEHVLKDAAKEANPIKLS 764

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/660 (66%), Positives = 526/660 (79%), Gaps = 16/660 (2%)

Query: 119 EPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSE 178
           E KS   DV+RL +L K DWK          +SC IGM IPKVIG+ILD LK    T +E
Sbjct: 86  EQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLET-NE 144

Query: 179 GEEAP------PPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRST 232
           G++ P      PPI M G +IYEFLGGF+  ++ G +AN+G        SER+VARLR+ 
Sbjct: 145 GKDGPISMADVPPIFM-GYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203

Query: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
           VIK+TIHQD++F+D HK GDLISRLG+DAY+VSRS+TQK+SDGFK+LICGGVGVGMM S+
Sbjct: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSI 263

Query: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
           S  LS +L +   PV+ SASIFG++IR  S +LQ+ATGQLTRVSEEQL+GV+TVQSFVAE
Sbjct: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323

Query: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
           Q+EI R++ AIR+IF+VGKR+A+INA+FFT+TS +GD+SFL VL YGSYLVL G LTIGD
Sbjct: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD 383

Query: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472
           LTAFMLYTEYTG+S+FGL++FYSE+MQG GAA+RLFELTD VP I+PT GK ++PGKGEI
Sbjct: 384 LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEI 443

Query: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
            FK+V+FSYPTRP N IF++++ KI  GSNVC+VGPSG+GKSTIALLLL +YNP+SGQI 
Sbjct: 444 VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503

Query: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592
           IDGQDI+K+N KSLRR +G+VQQEPVLMSG++RDNITYGLT TP+KEEIR VAKQCFCHN
Sbjct: 504 IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563

Query: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
           FI KFPH YDT IGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINY
Sbjct: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXX--- 709
           TFGQLMK+KS+TIVSIAHRLSTIRRSEN+IVLGNDGSV+E GKFKELF+DP         
Sbjct: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLN 683

Query: 710 -XXXXXXXXXXTKSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKMS 768
                      + S   S  PE +A+    P E  D ++E+    +L DVT+E KPIK+S
Sbjct: 684 EKSSRSENSSSSYSPNASEQPEDEANQKNAPEEAHDDSVEE----ILKDVTAEGKPIKIS 739

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/617 (71%), Positives = 508/617 (82%), Gaps = 9/617 (1%)

Query: 92  RLNS--TVSTQSKDNKQPSLQGNPLSTSEEPKS---NFSDVIRLFLLVKTDWKXXXXXXX 146
           R NS  TV   S  +  P  +G+  S   + +S   ++ D+IRLF+L K DWK       
Sbjct: 65  RCNSSKTVPETSLPSASPISKGSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLLTAIL 124

Query: 147 XXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLA 206
              ISC IGM IPKVIGI+LD+LK  T++ S+  +   PI  F L +YEFL  F++ALL 
Sbjct: 125 LLTISCSIGMSIPKVIGIVLDTLK--TSSGSDFFDLKIPI--FSLPLYEFLSFFTVALLI 180

Query: 207 GCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSR 266
           GC ANFG        SER+VARLR+ VIK+T+HQDA+F+D HK GDLISRLG+DAY+VSR
Sbjct: 181 GCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSR 240

Query: 267 SITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ 326
           S+TQK+SDG K+LICG VGVGMMCSLS  LS +L     PV+ SAS+FGKQIR  S++LQ
Sbjct: 241 SMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQ 300

Query: 327 DATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL 386
           +ATGQLTRV+EEQL+G+KTVQSFVAE  E+ R+N AIR+IF VGK +AF NAKFFT+TSL
Sbjct: 301 EATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSL 360

Query: 387 VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
           +GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEYTGN++FGLSTFYSEIMQGAGAASR
Sbjct: 361 LGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASR 420

Query: 447 LFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
           LFELTD  P I PT+G  Y P +G IEFK+VSFSYPTRP  QIFKNLNFKI PGS+VCIV
Sbjct: 421 LFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIV 480

Query: 507 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           GPSG+GKSTIALLLL YYNPT+G I ID QDI+K+N KSLRR +GIVQQEPVLMSG+IRD
Sbjct: 481 GPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRD 540

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           NITYGLTYTPTKEEIR VAKQCFCHNFITKFP+TYDT IGP GTLLSGGQKQRIAIARAL
Sbjct: 541 NITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARAL 600

Query: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
           IKKP ILILDEATSALDVESEGAINYTFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLG+
Sbjct: 601 IKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGH 660

Query: 687 DGSVIEMGKFKELFSDP 703
           DGSV+EMGKFKEL+++P
Sbjct: 661 DGSVVEMGKFKELYANP 677

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/588 (73%), Positives = 497/588 (84%), Gaps = 4/588 (0%)

Query: 115 STSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTA 174
           ST +    ++ D+IRLF+L K DWK          ISC IGM IPKVIGI+LD+LK  T+
Sbjct: 93  STEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK--TS 150

Query: 175 TQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVI 234
           + S+  +   PI  F L +YEFL  F++ALL GC ANFG        SER+VARLR+ VI
Sbjct: 151 SGSDFFDLKIPI--FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVI 208

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           K+T+HQDA+F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSLS 
Sbjct: 209 KKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSP 268

Query: 295 DLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR 354
            LS +L     PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE  
Sbjct: 269 QLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGN 328

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E+ R+N AIR+IF VGK +AF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLT
Sbjct: 329 ELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLT 388

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEF 474
           AFMLYTEYTGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT+G  Y P +G IEF
Sbjct: 389 AFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEF 448

Query: 475 KNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 534
           K+VSFSYPTRP  QIFK+LNFKI PGS+VCIVGPSG+GKSTIALLLL YYNPT+G I+ID
Sbjct: 449 KDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMID 508

Query: 535 GQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFI 594
            QDITK+N KSLRR++GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHNFI
Sbjct: 509 NQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 568

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 654
           TKFP+TYDT IGP GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTF
Sbjct: 569 TKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTF 628

Query: 655 GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           GQLMK+KSMTIVSIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL+++
Sbjct: 629 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYAN 676

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/581 (74%), Positives = 491/581 (84%), Gaps = 4/581 (0%)

Query: 123 NFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEA 182
           ++ D+IRLF+L K DWK          ISC IGM IPKVIGI+LD+LK  T++ S+  E 
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK--TSSGSDFFEL 158

Query: 183 PPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDA 242
             PI  F L +YEFL  F++ALL GC ANFG        SER+VARLR+ VIK+T+HQDA
Sbjct: 159 KIPI--FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDA 216

Query: 243 QFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGV 302
           +F+D HK GDLISRLG+DAY+VSRS+TQK+SDG K+LICG VGVGMMCSLS  LS +L  
Sbjct: 217 EFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLF 276

Query: 303 LIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEA 362
              PV+ SAS+FGKQIR  S++LQ+ATGQLTRV+EEQL+G+KTVQSFVAE  E+ R+N A
Sbjct: 277 FTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVA 336

Query: 363 IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 422
           IR+IF VGK +AF NAKFFT+TSL+GDLSFLTVL YGSYLVL   L+IGDLTAFMLYTEY
Sbjct: 337 IRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEY 396

Query: 423 TGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYP 482
           TGN++FGLSTFYSEIMQGAGAASRLFELTD  P I PT G  Y P +G +EFK+VSFSYP
Sbjct: 397 TGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYP 456

Query: 483 TRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMN 542
           TRP  QIFKNLNFKI PGS+VCIVGPSG+GKSTIALLLL YYNP++G I+ID QDITKMN
Sbjct: 457 TRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMN 516

Query: 543 SKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYD 602
            KSLRR +GIVQQEPVLMSG+IRDNITYGLTYTPTKEEIR VAKQCFCHNFITKFP+TYD
Sbjct: 517 CKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYD 576

Query: 603 TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKS 662
           T IG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG LMK+KS
Sbjct: 577 TVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKS 636

Query: 663 MTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           MTI+SIAHRLSTIRRSENVIVLG+DGSV+EMGKFK+L+++P
Sbjct: 637 MTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANP 677

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/701 (63%), Positives = 537/701 (76%), Gaps = 21/701 (2%)

Query: 83  SLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXX 142
           SL S     R NS +S   ++N+ P      L   ++ +S++ D +RLF L K DW+   
Sbjct: 37  SLISIRIGVRWNSQLSPSQEENR-PKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLC 95

Query: 143 XXXXXXXISCVIGMMIPKVIGIILDSLKVQTA---TQSEGEEAPPPIMMFGLTIYEFLGG 199
                  ISCVIGM IPKVIG++LD L+        Q+   +   PI  FGLTIY+FLG 
Sbjct: 96  AAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIA-FGLTIYQFLGV 154

Query: 200 FSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGA 259
           F+  LL G  ANF         SER+VARLRS V+ +T+HQD++FYD HK GDLISRLG+
Sbjct: 155 FAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGS 214

Query: 260 DAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIR 319
           DAY+VSRS+TQK+SDGFK+LICGGVG+GMM S+S +LS VL     P++ SAS+FGK+IR
Sbjct: 215 DAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIR 274

Query: 320 INSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAK 379
             S++LQ+ATGQLTRV+EEQL+GVKTVQSFVAEQRE+ R+N AIR I++VG+++AFINA+
Sbjct: 275 HTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAE 334

Query: 380 FFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQ 439
           FFTST+++GD+SF+ VL+YGSYLVL GSLTIGDLTAFMLYTEYTG+S+FGL+TFYSE+MQ
Sbjct: 335 FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394

Query: 440 GAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEP 499
           G GAASRLF+LTD++  I PT G+ Y+PGKG+IEFKNVSFSYPTRP+NQIFK++N K+ P
Sbjct: 395 GVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPP 454

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559
           GSNVCIVGPSG+GKSTIALLLL YYNPT+GQIL+DGQDI+K+N K+LRR +G+VQQEP+L
Sbjct: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPIL 514

Query: 560 MSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQR 619
           MSG+IRDNITYGL    TKEEIR VAKQCFCHNFITKFP  YDT IG  G LLSGGQ+QR
Sbjct: 515 MSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQR 574

Query: 620 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSE 679
           IAIARALIKKPNIL+LDEATSALDVESEGAINYTFGQLMK+ SMTIVSIAHRLSTI+RSE
Sbjct: 575 IAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634

Query: 680 NVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISSAPEVDADATGEP 739
           NVIVLG DGSVIE GKFKELF++P                ++SD   S P    +AT + 
Sbjct: 635 NVIVLGKDGSVIEAGKFKELFANP----NSELCKLLTEKSSRSDGNDSLPPPPPNATQDK 690

Query: 740 -VEPIDPAI-----------EDALHSVLNDVTSESKPIKMS 768
            VE I   I           +  +  +  DV+SE KPIK++
Sbjct: 691 VVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKIT 731

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/660 (65%), Positives = 519/660 (78%), Gaps = 12/660 (1%)

Query: 117 SEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLK-VQTAT 175
           +E+ K   S++ RL L+   DWK          ISC IGM IPKVIG++LD+LK V T +
Sbjct: 138 AEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDS 197

Query: 176 QSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIK 235
            S  E +  P + FGLT+Y FLG F+ AL+ G M N+G        SER+VARLRS VIK
Sbjct: 198 PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIK 257

Query: 236 RTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLD 295
           +T+HQDA+F+D +K GDLISRLG+DAY+VSRS+TQK+SDGFK+++CGG G+GMM S+S  
Sbjct: 258 KTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQ 317

Query: 296 LSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQRE 355
           LS+ L +    VVISASIFGK+IR  S  LQ+ATGQLTRVSEEQLNGVKTVQSFVAEQ+E
Sbjct: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377

Query: 356 IKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415
           I+R+N AIR+I+++GK SA +N+KF TSTS++GD+SFL VL YGSYLVLHGSLTIGDLTA
Sbjct: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437

Query: 416 FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFK 475
           FMLYT+YT NSIFGLS FYSEIMQG GAA RLF+LTD +P IRPT+G+ ++PG G IEF+
Sbjct: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFR 497

Query: 476 NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
           N+ F+YPTRP+NQ+FKNLNFKIEPG++VCIVGPSG+GKSTIALLLL YYNP+SGQILID 
Sbjct: 498 NLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557

Query: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
           QDI K+N KSLR+ +GIVQQEPVLMSGSIRDNITYGL    T +EIR+V+KQCFCHNFIT
Sbjct: 558 QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFIT 617

Query: 596 KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 655
           KFP  Y+T IGP GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG
Sbjct: 618 KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFG 677

Query: 656 QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXX 715
           +LMK+KS+TIVSIAHRLSTIRRSE +IVLGNDGSV+E GKFKEL++DP            
Sbjct: 678 KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQ 737

Query: 716 XXXXTKSDPISSAPEVDA------DATGEPVEPIDPAIEDAL-HSVLNDVTSESKPIKMS 768
                K  P+   P+ D       +  G P  P  P++ + L   VL +V+ +S P+K++
Sbjct: 738 SRANKKEAPL--PPQSDGENGDDFEGNGTPASP--PSLHNNLVTDVLKEVSDDSSPLKIA 793

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/675 (62%), Positives = 521/675 (77%), Gaps = 18/675 (2%)

Query: 107 PSLQGNPLSTSEEPKS----------NFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGM 156
           PS + N  +T E+  S            SD+ RL  L K DWK          +SC+IGM
Sbjct: 72  PSKRFNSTNTKEQESSTHTDGSNDKFELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGM 131

Query: 157 MIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXX 216
            +PK+IGI+LD LK Q  +  +      P + FGL +YEF+    ++LL G  AN+G   
Sbjct: 132 SLPKIIGIVLDELK-QIMSNPDFTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVI 190

Query: 217 XXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGF 276
                SER+VARLR+ VIK+T+HQDA+F+D +K GDLISRL +DAY+VSRS+TQK+SDGF
Sbjct: 191 LLRVLSERVVARLRANVIKKTMHQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGF 250

Query: 277 KSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS 336
           K+++CG VG+GMM S+S  LSA L  L  PV++SAS FG+ IR NSR+LQ+ATG LT+V+
Sbjct: 251 KAMLCGSVGIGMMISISPQLSAFLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVA 310

Query: 337 EEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
           EEQ +G+KTVQSFVAEQ+EIKR+N AIR+IF+VGK+SAFINAKFF+ T+++GD+SFL VL
Sbjct: 311 EEQFSGIKTVQSFVAEQKEIKRYNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVL 370

Query: 397 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE 456
            YGSYLVLHGSL+IGDLTA+M+YTEYTG+SIFGLSTFYSEIMQGAGAASRLFELTD +P 
Sbjct: 371 AYGSYLVLHGSLSIGDLTAYMMYTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPS 430

Query: 457 IRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTI 516
           I PTLGK ++P KGEIEFKNVSFSYPTR  NQIFKNL+FKI+ GSNVCIVGPSG+GKSTI
Sbjct: 431 ISPTLGKKFVPNKGEIEFKNVSFSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTI 490

Query: 517 ALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP 576
           A LLL YYNPT+GQI +DGQDI+K++SKSLRR + IVQQEPVLMSG+IRDNITYGL   P
Sbjct: 491 ASLLLRYYNPTTGQIFVDGQDISKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKP 550

Query: 577 TKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILD 636
           T++E+R + K+CFCHNFITKFP++YDT +GP GTLLSGGQKQRIAIARALIKKP ILILD
Sbjct: 551 TQDEVRSITKKCFCHNFITKFPNSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILD 610

Query: 637 EATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKF 696
           EATSALDVESEGAINYTFG+LMK+KS+TI+SIAHRLSTIRRSENVIVLGNDGSV E+GKF
Sbjct: 611 EATSALDVESEGAINYTFGKLMKSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKF 670

Query: 697 KELFSDPXXXXXXXXXXXXXXXXTKSDPISSAPEVDADAT-----GEPVEPI-DPAIEDA 750
           KEL++DP                 + +  +   E+D + T       P   I    +E+ 
Sbjct: 671 KELYADPGSELSKLLHEKATRSERQQN-TAEDQEIDPEETINIENSTPESDITQELLENP 729

Query: 751 LHSVLNDVTSESKPI 765
           +   + DV +++KPI
Sbjct: 730 IKEAIMDVAADNKPI 744

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/597 (69%), Positives = 486/597 (81%), Gaps = 15/597 (2%)

Query: 120 PKS--NFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQS 177
           PKS  + +D+ RL  L K DWK          +SC IGM +PKVIG++LD LK   +   
Sbjct: 68  PKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSE 127

Query: 178 EGE-----------EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLV 226
           + E           E PP  + FGL++YEFLG    ALL G  ANFG        SER+V
Sbjct: 128 DAELGSADLSIESSELPP--IAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVV 185

Query: 227 ARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV 286
           ARLRS VIK+TIHQDA+F+D +K GDLISRLG+DAY+VSRS+TQK+SDGFK+L+CGGVGV
Sbjct: 186 ARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGV 245

Query: 287 GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTV 346
           GMM S+S +LSA L     PV++S+  FG+ IR NSR+LQ+ATGQLTRVSEEQ +GVKTV
Sbjct: 246 GMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTV 305

Query: 347 QSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 406
           Q+FVAEQREIKR+N  I+++++VGK SAFINAK FT TS +GD+SFL VL YGSYLVLHG
Sbjct: 306 QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365

Query: 407 SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYL 466
            L+IGDLTA+M+YTE TG+++FGLS+FYSEIMQG GAASRLFELTD +P I PT GK Y+
Sbjct: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425

Query: 467 PGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
           PGKGEIEFKNVSF+YPTRP +QIFK+LNFKIEPGSNVCIVGPSG+GKSTIA LLL YY P
Sbjct: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485

Query: 527 TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK 586
           T+G I +DGQDI+K+NSKSLRR +GIVQQEP+LMSGSIRDNITYGLTY  T EEIR+V K
Sbjct: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545

Query: 587 QCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
           QCFCHNFITKFP  Y T +GP+GTLLSGGQKQRIAIARAL+KKPN+LILDEATSALDVES
Sbjct: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           E AINYTFG+LMK K +TI+SIAHRLSTIRRSE VIVLGNDGSV+E+GKFK LF +P
Sbjct: 606 ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNP 662

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/696 (62%), Positives = 517/696 (74%), Gaps = 39/696 (5%)

Query: 93  LNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISC 152
           L ST  T  +  KQP++  +P     E +  + D+ RLFLLVK+DWK          +SC
Sbjct: 60  LYSTDVTPKEPEKQPAVVVHP---KPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSC 116

Query: 153 VIGMMIPKVIGIILDSLK-VQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMAN 211
            IGM IPKVIG +LDSLK +Q    SE       +M++ +++  F  G S  LL GC AN
Sbjct: 117 GIGMCIPKVIGTVLDSLKDIQGKEFSE-------LMIWDMSLKHFFYGLSGLLLLGCGAN 169

Query: 212 FGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQK 271
           +         SE LVA+LR+ VIK  IHQDAQF+D +K GDLISR+G DA+IVSRSITQK
Sbjct: 170 YVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQK 229

Query: 272 ISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLI-IPVVISASIFGKQIRINSRELQDATG 330
           ISDG K++  G  GVGMM S+S+ LS  + +L+  P+++SA +FGKQIR NS++LQ+ T 
Sbjct: 230 ISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTA 289

Query: 331 QLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL 390
            LTRVSEEQ NG+KT+QSFVAEQ E+ +FN +IR IF VGK +AFINAKFFT+ S++GDL
Sbjct: 290 NLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDL 349

Query: 391 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
           SFL VL YGS+LV    L++GDLTAFMLYTEYTGN+IF LS F+SEIMQGAGAASR+FEL
Sbjct: 350 SFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFEL 409

Query: 451 TDYVPEIRPTLGKTYLPGKG-EIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPS 509
           TD  P I PT G  ++P KG EIEFKNVSF+YPTRP   IF+NLNFKIE GSNVCIVGPS
Sbjct: 410 TDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPS 469

Query: 510 GKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT 569
           GKGKSTIA LLLHYYNP+ GQILIDGQDI+ +++KSLRR +GIVQQEP+LMSG+IRDNIT
Sbjct: 470 GKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNIT 529

Query: 570 YGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629
           YGLTYTPTKEEIR VAKQCFCHNFIT+FP TYDT IGP GTLLSGGQKQRIAIARALIKK
Sbjct: 530 YGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKK 589

Query: 630 PNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGS 689
           P +LILDEATSALDVESEGAINYTFGQLMK+KSMTIVSIAHRLSTIRRSENVIVLGNDGS
Sbjct: 590 PTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGS 649

Query: 690 VIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISSAPEVDADATGEPVEPIDPAIE- 748
           V+E GKFKELF++P                 KS   ++APE+      + +E  DP+   
Sbjct: 650 VVEQGKFKELFANP-------ASELSKLLREKSSGNNAAPEIQPQEISQTIEE-DPSFSG 701

Query: 749 -----------------DALHSVLNDVTSESKPIKM 767
                            + ++ VL D+++E KP+K+
Sbjct: 702 EATPASSVTGFKAETEAETINEVLKDISTEGKPLKI 737

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/589 (66%), Positives = 477/589 (80%), Gaps = 3/589 (0%)

Query: 115 STSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTA 174
           STS    + + ++ RLF L + DWK          ISC IGM +PKVIG++LD  K    
Sbjct: 115 STSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAIT 174

Query: 175 TQSEGEEAP--PPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRST 232
           +  + ++    PP++ +GL +Y+FL  F+ AL+    ANFG         E+LVARLRS 
Sbjct: 175 SDEKPKDLRDLPPVV-WGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSN 233

Query: 233 VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
           VIK+TIHQDA+F+D +K GDLISRL +DAY+VSRS+TQ ISDGFK++ICGGVG+GMM  +
Sbjct: 234 VIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHI 293

Query: 293 SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
           S  L+  L +   P+++ A+I+G++IR  SR+LQ +TG LT+V+EEQL+GVKTVQSFVAE
Sbjct: 294 SSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAE 353

Query: 353 QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
           Q+EIKR+N AIR +F VGKR A  NA FF+STS++GD SFL VL YGS+LVL GSL+IGD
Sbjct: 354 QKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGD 413

Query: 413 LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEI 472
           LTAFMLYTEY+G+++FGLS FYSE+M+GAGAASRLFELTD+ P I  T G  Y+PGKGEI
Sbjct: 414 LTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEI 473

Query: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
           +F+NVSFSYPTR  NQIF NLNF I+ GSNVC+VGPSG+GKSTIA LLL YYNPTSG+I 
Sbjct: 474 KFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRIT 533

Query: 533 IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592
           IDGQDI+K+++KSLRR LG+VQQEP+LMSGSIRDNITYG+ YTPT +EIR V+K+CFCHN
Sbjct: 534 IDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHN 593

Query: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
           FITKF   Y+T IGP G LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY
Sbjct: 594 FITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 653

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           T GQLMK++ +TI+SIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL++
Sbjct: 654 TLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYA 702

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/625 (63%), Positives = 494/625 (79%), Gaps = 6/625 (0%)

Query: 83  SLTSQLTITRLNS--TVSTQSKD-NKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWK 139
           S+   L +TRL S  TV +Q+K    + S +   +   E P   + +VIRLF L   DWK
Sbjct: 95  SVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEVIRLFKLATHDWK 154

Query: 140 XXXXXXXXXXISCVIGMMIPKVIGIILDSLK--VQTATQSEGEEAPPPIMMFGLTIYEFL 197
                     IS VIGM IPKVIG++LD++K    +AT   G +  PPI+   L++YEFL
Sbjct: 155 LLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPPIVN-DLSMYEFL 213

Query: 198 GGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRL 257
           G F+ AL+ G +ANFG         E+LVARLRS VI++ IHQDA+F+D +K GDLISRL
Sbjct: 214 GIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFDRNKVGDLISRL 273

Query: 258 GADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQ 317
            +DAY+VSRS+TQ +SDGFK++ICGGVG+GMM ++S+ L++ L +   P++I A I+GK+
Sbjct: 274 SSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPPLLIGALIYGKR 333

Query: 318 IRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFIN 377
           IR+ SR+LQ++TG LTRVSEEQL+GVKT+QSFVAE +E++R+N AIR +F  GK+ A  N
Sbjct: 334 IRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKVFLYGKKEALTN 393

Query: 378 AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEI 437
           A FF+ST+++GDLSFL VL YGS+LVL G LT+GDLTAFMLYTEYTG+++FGLS FYSE+
Sbjct: 394 ATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSAVFGLSNFYSEL 453

Query: 438 MQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKI 497
           M+GAGAASRLFE+TD+ P I+PT GK Y+PG G+I FK+VSFSYPTRP NQIF  LNF I
Sbjct: 454 MKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPGNQIFNKLNFTI 513

Query: 498 EPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEP 557
           EPGSNVCIVGPSG+GKSTI  LLL YYNP+SGQI ID QDI++++ KSLRR LG+VQQEP
Sbjct: 514 EPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSLRRHLGVVQQEP 573

Query: 558 VLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQK 617
           +LMSGSI+ N+TYGL    + +EIR VAK+CFCH F+TKFP+ YDT IGP G  LSGGQK
Sbjct: 574 MLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIGPRGASLSGGQK 633

Query: 618 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
           QRIAIARAL+KKP ILILDEATSALDVESEGAINYT G+LMK+K +TI+SIAHRLSTIRR
Sbjct: 634 QRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIAHRLSTIRR 693

Query: 678 SENVIVLGNDGSVIEMGKFKELFSD 702
           SENVIVLGNDGSV+E+GKFK+L++D
Sbjct: 694 SENVIVLGNDGSVVEVGKFKDLYAD 718

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/617 (62%), Positives = 484/617 (78%), Gaps = 18/617 (2%)

Query: 100 QSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIP 159
           Q  ++K P  + N  S++       +DV RLF L + DWK          +SC IGM +P
Sbjct: 90  QEGEDKTPDKKTNKPSST--VSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVP 147

Query: 160 KVIGIILDSLK--------------VQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALL 205
           KVIG++LD+ K              ++ +     ++ PP  ++  + +Y+F   F  ALL
Sbjct: 148 KVIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPP--IVGDIQLYDFFLLFGGALL 205

Query: 206 AGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVS 265
            G MANFG         ERLVARLRS VIK+T+H D +FYD +K GDL+SRLGADAYIVS
Sbjct: 206 IGTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVS 265

Query: 266 RSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSREL 325
           RS+TQ ISDGFK+LICGGVG+GMM  +S  L++VL +   P+++ A+I+G +IR  SREL
Sbjct: 266 RSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISREL 325

Query: 326 QDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTS 385
           Q A+G LT+V+EEQL+G+KTVQSFVAE +E+ R+N A+R +F+VGK+ AF NA FF+ST+
Sbjct: 326 QQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTN 385

Query: 386 LVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAAS 445
           ++GD SFL VL YGS+LVL G+LTIGDLTAFMLYTEYTG+++FGLSTFYSE+M+GAGAA+
Sbjct: 386 VLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAAT 445

Query: 446 RLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCI 505
           RLFEL DY P I+ T GK + P  G++EF++VSFSYPTR  NQIFK+LNF IEPGSNVCI
Sbjct: 446 RLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCI 505

Query: 506 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
           VGPSG+GKSTIA LLL YYNPTSG+IL+DGQDITK++SKSLRR+LG+VQQEP+LMSG+IR
Sbjct: 506 VGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIR 565

Query: 566 DNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARA 625
           +NITYG++  P+ EEIR VAK+CFCH FI+KFP+ Y+T IGP G LLSGGQKQRIAIARA
Sbjct: 566 ENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARA 625

Query: 626 LIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLG 685
           L+ KP ILILDEATSALDVESEGAINYT G+LMK+K +TI+SIAHRLSTIRRSENVIVLG
Sbjct: 626 LLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLG 685

Query: 686 NDGSVIEMGKFKELFSD 702
            DGSV+EMGKFK+L+++
Sbjct: 686 IDGSVVEMGKFKDLYAN 702

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/599 (62%), Positives = 477/599 (79%), Gaps = 11/599 (1%)

Query: 110 QGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSL 169
           + N  ST E+ K+N+ +++RL  L + DWK          IS  +GM IPKVIGI+LD++
Sbjct: 92  KANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV 151

Query: 170 KVQTATQSEGEEAP------PPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSE 223
           K      S G   P      PPI+ +GL +++FL  F+  L+ G +ANFG         E
Sbjct: 152 K----NASGGFSGPMTLEDLPPII-YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGE 206

Query: 224 RLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGG 283
           +LVARLRS VIK+ IHQDA+F+D +K GDLISRL +DAY+VSRS+TQ +SDGFK++ICGG
Sbjct: 207 KLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGG 266

Query: 284 VGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
           VG+GMM ++S  L++ L +   P+++ A I+GK+IR+ SRELQ++TG LT+VSEEQL+GV
Sbjct: 267 VGIGMMINISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGV 326

Query: 344 KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
           KT+Q+FVAE +E+ R+N AIR +F  GK+ A  NA FF+ST ++GDLSFL VL YGS+LV
Sbjct: 327 KTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLV 386

Query: 404 LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK 463
           L G L++GDLTAFMLYTEYTG+++FGLS FYSE+M+GAGAASRLFE+TD+  +I+P+ GK
Sbjct: 387 LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK 446

Query: 464 TYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY 523
            Y+P  GEI+F++VSFSYPTRP NQIF  LNF IEPGSNVC+VGPSG+GKSTIA LLL Y
Sbjct: 447 PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRY 506

Query: 524 YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRK 583
           Y+P SG+I+IDGQ+I+K++ KSLRR LG+VQQEP+LMSGSIR N+TYG+    T +EIR 
Sbjct: 507 YDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566

Query: 584 VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
           VAK+CFCH FITKFP  Y+T IGP G  LSGGQKQRIAIARALIKKP ILILDEATSALD
Sbjct: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626

Query: 644 VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           VESEGAINYT G+LM+++ +TI+SIAHRLSTIRRSENVIVLGNDGSV+EMGKFKEL+++
Sbjct: 627 VESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAN 685

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/664 (60%), Positives = 483/664 (72%), Gaps = 11/664 (1%)

Query: 115 STSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTA 174
           + S +  S++ D+ RL +L+K D K          ISC IGM IPK+IG ILD+L+    
Sbjct: 74  TASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLR---- 129

Query: 175 TQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVI 234
              E   +   I +  + +  FL G  I L+ GC ANFG        SERLV+RLRS V+
Sbjct: 130 NNYENLTSLSQIKILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVV 189

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           K  IH+D +F+D  K GDL+SR+G DA++VSRSIT K++DG +S   G  G+G+M +LS 
Sbjct: 190 KNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSR 249

Query: 295 DLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR 354
           +L+  L  ++ P++   S+FGKQIR+NS++LQD TG LTRV+EEQ NG++TVQ FVAE+ 
Sbjct: 250 ELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERN 309

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           EIKRFN  +R IF VGK SAFIN KFFTS SL+GDL FL VL YGSYLV+HGS++IGDLT
Sbjct: 310 EIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLT 369

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP-----GK 469
           AFMLYTEYTGN+IFGLS+FYSE+MQG GAASR+FE+ D  P+I+ T G+         G 
Sbjct: 370 AFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGG 429

Query: 470 GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
            EIEFKNVSF YPTRP NQIFKNLNFK+  GSNVCIVGPSG+GKSTIA LLLH+YN  SG
Sbjct: 430 CEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSG 489

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
           QILIDGQDI  +N+KSLRRK+GIVQQEP+LMSG+IRDNITYGLT  P+KEEIR VAKQCF
Sbjct: 490 QILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCF 549

Query: 590 CHNFITKFPHTYD--TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 647
           CHNFITKFP TYD     G SGT LSGGQKQRIAIARALIKKPNILILDEATSALDVESE
Sbjct: 550 CHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 609

Query: 648 GAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXX 707
           GAINYTFGQ+MK+KSMTIVSIAHRLSTIRR E+VIVLGNDGSV+EMGKFKEL+ +P    
Sbjct: 610 GAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSEL 669

Query: 708 XXXXXXXXXXXXTKSDPISSAPEVDADATGEPVEPIDPAIEDALHSVLNDVTSESKPIKM 767
                           P++  P +D     E  +  D A E+    + +     S P  M
Sbjct: 670 SKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEADNASEENGAKLDDSKEDVSVPDNM 729

Query: 768 STTD 771
           +++D
Sbjct: 730 TSSD 733

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/609 (61%), Positives = 467/609 (76%), Gaps = 9/609 (1%)

Query: 100 QSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIP 159
           + K  K+P+    P        + + +V RL  LVK DWK          ISC IGM +P
Sbjct: 82  ERKVEKRPA---EPSRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVP 138

Query: 160 KVIGIILDSLKVQTATQSEGEEAPP------PIMMFGLTIYEFLGGFSIALLAGCMANFG 213
           KVIG++LD+ K   A   + E   P      P ++   T+ + L  F+ ALL G  ANFG
Sbjct: 139 KVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFG 198

Query: 214 XXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKIS 273
                    ERLVARLR+ VIK+T+H DA+F+D +K GDLISRLG+DAYIVSRS+T  IS
Sbjct: 199 RMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNIS 258

Query: 274 DGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLT 333
           DG K+ +CGGVGVGMM  +S  L++ + +   P++I+A+I+GK+IR  SRELQ +TG LT
Sbjct: 259 DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318

Query: 334 RVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL 393
           RVSEEQ NG+KT++SFVAE +E++R+N A+R +F+V KR    +A FF+ T+++GD+SFL
Sbjct: 319 RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFL 378

Query: 394 TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY 453
            VL YGS+LVL G L++G LTAFMLYTEYTG+S+FGLS FYSE+M+GAGAASRLFELTDY
Sbjct: 379 LVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDY 438

Query: 454 VPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
              +  T+G+T++P  G IEFK+VSFSYPTRP +QIFK L   I PGSNVCIVGPSG+GK
Sbjct: 439 KKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498

Query: 514 STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
           STIA LLL +Y+  SG ILIDGQDI+K+++KSLR+ LG+VQQEPVLMSG+IRDNITYGL+
Sbjct: 499 STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558

Query: 574 YTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNIL 633
           YTP+ +EIR VAK+CFCHNFITKFP  YDT IGP G LLSGGQ+QRIAIARALIKKP IL
Sbjct: 559 YTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618

Query: 634 ILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
           ILDEATSALDVESEGAINYT G+LM++K +TIVSIAHRLSTIRRSEN++VLGNDGSVIE 
Sbjct: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678

Query: 694 GKFKELFSD 702
           GKF +L+ D
Sbjct: 679 GKFADLYRD 687

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/702 (55%), Positives = 503/702 (71%), Gaps = 39/702 (5%)

Query: 95  STVSTQSKDNKQPSL----QGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXI 150
           S++S   KDN           N     +E    + +V+RL  L K DWK          +
Sbjct: 64  SSLSKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSV 123

Query: 151 SCVIGMMIPKVIGIILDSLK------VQTATQ-----SEGEE-----------APPPIMM 188
           SC IGM +PKVIG++LD+ K       +  +Q     +E +E           A PPI+ 
Sbjct: 124 SCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVG 183

Query: 189 FGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIH 248
             L+I +F+G F+ AL+ G  ANFG         ERLV+RLRS VIKRT+H D +F+D +
Sbjct: 184 -TLSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRN 242

Query: 249 KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV 308
           K GDLISR G+DAY+VSRS+TQ +SDGFK++ICGGVG+GMM  +S  L++V+ +   P++
Sbjct: 243 KVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLL 302

Query: 309 ISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFH 368
           + A I+GK+I   SR+LQ ++G LTRV+EEQLNG++T++SFVAE++EI+R+N+AIR +F+
Sbjct: 303 VGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFY 362

Query: 369 VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIF 428
           VGKR AF NA FF+ST+++GD+SF+ VL+YG+ LVL G+L+IGDLTAFMLYTEYTG+S+F
Sbjct: 363 VGKREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVF 422

Query: 429 GLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQ 488
           GLSTFYSE+M+GAGAASRLFEL D+   +R  +     P +G+IEF++VSFSYPTRP NQ
Sbjct: 423 GLSTFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQ 482

Query: 489 IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548
           IFK+++F IEPGSNVCIVGPSGKGKSTI  LLL +Y+P  G ILID  DI+K  +KSLRR
Sbjct: 483 IFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRR 542

Query: 549 KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608
            LG+VQQEP LMSG+IRDNITYGL+YTPT +EIR V+KQCFCH FITKFP  YDT IGP 
Sbjct: 543 HLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPR 602

Query: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668
           G  LSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYT G LM++K +TI+SI
Sbjct: 603 GASLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISI 662

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISSA 728
           AHRLSTIRRSEN+IV+GNDGSV+E+GKF +L+ +                 +KS+  S  
Sbjct: 663 AHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNEKDHDLVSKSENTSDI 722

Query: 729 P---EVDADATG------EPVEPIDPAIEDALHSVLNDVTSE 761
           P     + DA+G      E V  I+  +   + +VLND+T +
Sbjct: 723 PPDSPKNDDASGLEHLVAEDVASINDKV---VKNVLNDITHD 761

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  534 bits (1375), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 294/682 (43%), Positives = 421/682 (61%), Gaps = 29/682 (4%)

Query: 41  LPYTLGIRFLPSQSTYQSIRTLVSTPPSPYFLLKCKNTGTVSSLTSQL----TITRLNST 96
           L  ++ IRFLP  S     R ++  P      L+  N     S  +Q+     I+  +ST
Sbjct: 15  LKRSMNIRFLPKAS-----RLIIGNPIK--VKLQINNCYGGLSAFNQVRWTSNISDASST 67

Query: 97  VSTQSKDNKQ----PSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISC 152
           V+  +   ++    P +Q   L+  E  +S F DV RLF L + +            IS 
Sbjct: 68  VNAVAAQERELKIPPKIQ--KLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISS 125

Query: 153 VIGMMIPKVIGIILDSLKVQTATQSEG--------EEAPPPIMMFGLTIYEFLGGFSIAL 204
            + M++P VIG +LD  K  +A +  G        E+      ++GLT  +F     +  
Sbjct: 126 AVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVF 185

Query: 205 LAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIV 264
             G +AN G         ERLVARLR+  +K  + Q+A F D +K GDLISRL  DA IV
Sbjct: 186 TVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIV 245

Query: 265 SRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRE 324
           ++S+TQ +SDG ++++ G VG GMM  +S  L++V+ +LI P+   A I+G++IR  SR+
Sbjct: 246 AKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQ 305

Query: 325 LQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTST 384
           LQ + G LT+V+EEQLN  +T+Q++  E++EI R+   +RN+F +G + A  +  FF ST
Sbjct: 306 LQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGST 365

Query: 385 SLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAA 444
            LVG+ + L++LV G+ ++  G+LT+G+L++FM+Y  YTG+S+FGLSTFYSE+M+GAGAA
Sbjct: 366 GLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAA 425

Query: 445 SRLFELTDYVPEIRPTLGKTYLPGKGE-IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNV 503
           +R+FEL+D  P I+PT+GK  +   G+ +EFKNVSF YPTRP+ QIF++ + KIEPG +V
Sbjct: 426 ARVFELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHV 485

Query: 504 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
           C VGPSG GKST++ LLL YY+   G IL+ G+DI   + +  RR LG+VQQEP+L +G+
Sbjct: 486 CFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGT 545

Query: 564 IRDNITYGLTYTPTKE--EIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIA 621
           I +NI Y +      E   I +  +   C  F+  FP   +T +GP GT LSGGQKQRIA
Sbjct: 546 ILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIA 605

Query: 622 IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENV 681
           +AR  +  P+ILILDEATSALD +SE  I     Q    K  T +SIAHRLSTI+ S  V
Sbjct: 606 LARTFLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRV 664

Query: 682 IVLGNDGSVIEMGKFKELFSDP 703
           +VLG +G V+E G F+EL S+P
Sbjct: 665 VVLGKNGCVVETGTFQELISNP 686

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  528 bits (1361), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 278/621 (44%), Positives = 397/621 (63%), Gaps = 11/621 (1%)

Query: 88  LTITRLNSTVSTQSKDNKQP--SLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXX 145
           L I R NS++    K    P  S++   LS      +   D+ RLF L K + K      
Sbjct: 55  LEIRRWNSSIVDVKKKRSSPPPSIEVQKLSNEVSKSNGMKDIKRLFKLAKPEAKYILLAL 114

Query: 146 XXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPP-PIMMFGLTIYEFLGGFSIAL 204
               IS  + M IP +IG +LD  K     +     A    +M+FGLT  +F        
Sbjct: 115 LFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNAKKEKLMIFGLTKPQFYTALGGLF 174

Query: 205 LAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIV 264
           LAG +AN           ERLVARLR+  +K  ++QDA F D ++ GDLISRL +DA IV
Sbjct: 175 LAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLDTNRVGDLISRLSSDASIV 234

Query: 265 SRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRE 324
           ++++TQ +SDG +++I G VG GMM  +S  L+ V+ +++ P+ + A ++G++IR  SR+
Sbjct: 235 AKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQ 294

Query: 325 LQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTST 384
           LQ + G LT+V+EEQLN  +T+Q++  E  EI R+   +R +F VG + A  +  FF ST
Sbjct: 295 LQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRKVFDVGLKEAVTSGLFFGST 354

Query: 385 SLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAA 444
            LVG+++ +++L+ G+ ++ +G+LT+GDL++FM+Y  YTG+S+FGLS FYSE+M+GAGAA
Sbjct: 355 GLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGSSLFGLSGFYSELMKGAGAA 414

Query: 445 SRLFELTDYVPEIRPTLG--KTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSN 502
           +R+FEL D  P I+PT+G     L GK  IEF+NVSF+YPTRP + I  NL+  I+PG +
Sbjct: 415 TRVFELNDRKPLIKPTIGYDPKSLLGK-SIEFQNVSFAYPTRPTHSILNNLSISIQPGEH 473

Query: 503 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG 562
           VCIVGPSG GKST++ LLL YY+ ++G I IDGQ+I + N +  RR LG+VQQEP+L +G
Sbjct: 474 VCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNG 533

Query: 563 SIRDNITYGL----TYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQ 618
           +I DNI Y +    T T    ++++  +Q  C  F+  FP   +T +GP GT LSGGQKQ
Sbjct: 534 TILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQ 593

Query: 619 RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRS 678
           RIA+ARA +  P +LILDEATSALD +SE  +     + ++   +T +SIAHRLSTI+ S
Sbjct: 594 RIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVEL-GLTTISIAHRLSTIKHS 652

Query: 679 ENVIVLGNDGSVIEMGKFKEL 699
             VIVL   GSV+E G F+EL
Sbjct: 653 TRVIVLDKSGSVVETGPFEEL 673

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  528 bits (1360), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 280/632 (44%), Positives = 406/632 (64%), Gaps = 24/632 (3%)

Query: 91  TRLNST------VSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXX 144
           TR NST      ++T+  + +Q   +   LS+ E   + F DV RLF L K +       
Sbjct: 57  TRFNSTNESSKGINTKLTETQQ---KLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLA 113

Query: 145 XXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGE----------EAPPPIMMFGLTIY 194
                IS  + M++P VIG +LD L   T+    G+          E      ++G T  
Sbjct: 114 LVLILISSTVSMVVPSVIGKLLD-LSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHT 172

Query: 195 EFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLI 254
           +F  G  I  + G +AN G         E+LVARLR+  +K  + QDA F D ++ GDLI
Sbjct: 173 QFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLI 232

Query: 255 SRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIF 314
           SRL +DA IV++S+T  +SDG ++++ G VG  MM  +S  L++V+ +LI P+ I A ++
Sbjct: 233 SRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVY 292

Query: 315 GKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSA 374
           GK+IR  SR+LQ A G LT+V+EEQLN  KT+Q++  E++EI+R+   +R++F VG + A
Sbjct: 293 GKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEA 352

Query: 375 FINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
             +  FF ST LVG+ + L++L+ G+ ++  GSLT+GDL++FM+Y  YTG+S+FGLS+FY
Sbjct: 353 ITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFY 412

Query: 435 SEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGE-IEFKNVSFSYPTRPQNQIFKNL 493
           SE+M+GAGAA+R+FEL D  P I+PT+GK  +  KG+ I F++VSF YPTRP +++F  +
Sbjct: 413 SELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKI 472

Query: 494 NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIV 553
           +FKIEPG ++C VGPSG GKST++ LLL YY+ T G ILI   +I  ++ +  R+ LG+V
Sbjct: 473 SFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVV 532

Query: 554 QQEPVLMSGSIRDNITYGL--TYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
           QQEP+L +G+I DNI Y +       K ++    K+  C  F+  FP   +T +GP GT 
Sbjct: 533 QQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQ 592

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
           LSGGQKQRIAIAR+ +  P+IL+LDEATSALD +SE  I  T  +  + + +T +SIAHR
Sbjct: 593 LSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHR 651

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           LSTI+ S  V+VL  +GSV+E GKF EL ++P
Sbjct: 652 LSTIKYSSRVVVLNKNGSVVETGKFTELIANP 683

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  525 bits (1353), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 284/651 (43%), Positives = 401/651 (61%), Gaps = 26/651 (3%)

Query: 56  YQSIRTLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLS 115
           YQ     +  P   +FLL+                 RL S ++ Q K + +P+L+   LS
Sbjct: 37  YQKAEINLIIPHRKHFLLRS---------------IRLQSDIA-QGKKSTKPTLK---LS 77

Query: 116 TSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTAT 175
            +    S F D+ RLF+L K + K          IS  + M +P VIG +LD   + + +
Sbjct: 78  NANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD---LASES 134

Query: 176 QSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIK 235
             E EE      ++G T  +F        + G +AN           ERLVARLR+  +K
Sbjct: 135 DGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMK 194

Query: 236 RTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLD 295
             + QDA F D ++ GDLISRL +DA IV++S+TQ +SDG +++I G VG GMM  LS  
Sbjct: 195 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 254

Query: 296 LSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQRE 355
           L+ V+ +L  P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  +T+Q++  E+ E
Sbjct: 255 LTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 314

Query: 356 IKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415
           ++R+ + +RN+FH+G + A  +  FF ST LVG+ + L++L+ G+ ++  GS+T+G+L++
Sbjct: 315 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 374

Query: 416 FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP-GKGEIEF 474
           FM+Y  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL D  P IRPT+GK  +   +  I F
Sbjct: 375 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 434

Query: 475 KNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 534
           KNVSF+YPTRP++QIFK+LN  I+PG +VC VGPSG GKSTIA LLL YY+  SG I   
Sbjct: 435 KNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 494

Query: 535 GQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL--TYTPTKEEIRKVAKQCFCHN 592
            +DI   N +  RR +G VQQEP+L +G+I DNI Y +        + IR+   +  C  
Sbjct: 495 DEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTK 554

Query: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
           F+  FP    T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 614

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
              Q    +  T +SIAHRLSTI+ S  VIVLG  GSV+E G F++L + P
Sbjct: 615 NL-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIP 664

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  521 bits (1342), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 282/617 (45%), Positives = 389/617 (63%), Gaps = 9/617 (1%)

Query: 91  TRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXI 150
           TRLNST + ++   ++P  +   LST+    S   DV RLF L + + K          I
Sbjct: 49  TRLNSTANPRASTEEKPHQERLELSTATGNASGAKDVRRLFQLARPELKSLVCALVLIVI 108

Query: 151 SCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMA 210
           S  + M IP VIG +LD  +     +S  EE     +++GL   +F    S     G +A
Sbjct: 109 SGAVSMTIPSVIGKLLDVAREDVEQESGDEEEA---VLYGLPEKQFYLALSGIFAVGALA 165

Query: 211 NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQ 270
           N G         ERLVARLR+  +K  + Q+  F D ++ GDLISRL +DA IVS+SITQ
Sbjct: 166 NMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQ 225

Query: 271 KISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATG 330
             SDG +++I G VG GMM  +S  L+AV+ +L  P+V+ A+ +G+++R  SRELQ   G
Sbjct: 226 NTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVG 285

Query: 331 QLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL 390
            LT+V+EEQLN  +TVQ++  E+REI+R+   +RN+F VG + A I+  FF +T  VG+ 
Sbjct: 286 GLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNA 345

Query: 391 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
           + L +L+ G+ ++  G +++G+L++FM+Y  YTG+S+F LS+FYSE+M+GAGAA R+FEL
Sbjct: 346 TLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFEL 405

Query: 451 TDYVPEIRPTLGK--TYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGP 508
            D  P I PT+GK    L GK  I F +V+F+YPTRP +Q+F  ++  I PG +VCIVGP
Sbjct: 406 NDRKPLIHPTIGKDPVSLTGK-TIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGP 464

Query: 509 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
           SG GKST+A LLL +Y+P SG I I G+DI   N    RR +GIVQQEPVL + SI +NI
Sbjct: 465 SGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENI 524

Query: 569 TYGLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           TY L    TK+  R  +  +   C  F+  FP    T +GP GT LSGGQKQR+A+ARA 
Sbjct: 525 TYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAF 584

Query: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
           ++ P ILILDEATSALD +SE  +  T  Q  +   +TI SIAHR STI+ S  VIVL  
Sbjct: 585 LQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITI-SIAHRKSTIQHSTRVIVLDK 643

Query: 687 DGSVIEMGKFKELFSDP 703
            G V+E G +++L  DP
Sbjct: 644 LGHVLETGTYQQLIGDP 660

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  521 bits (1343), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 282/640 (44%), Positives = 405/640 (63%), Gaps = 24/640 (3%)

Query: 83  SLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXX 142
           +L+ QL   R  +T + Q +   Q +L+   LS  +   S F D+ RLFLL K +     
Sbjct: 62  ALSHQLLQARRLNTSTEQDQKTLQ-TLKTLKLSPHDSKASGFKDIKRLFLLAKPETNSMI 120

Query: 143 XXXXXXXISCVIGMMIPKVIGIILDSLK-------------VQTATQSEGEEAPPPIMMF 189
                  IS  + M IP VIG +LD+ K             V ++  S+ +E     +++
Sbjct: 121 LALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIY 180

Query: 190 GLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHK 249
           GLT  +F        + G  AN G         E+LVARLR+  +K  + QDA F D ++
Sbjct: 181 GLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTRTMKAALQQDATFLDNNR 240

Query: 250 TGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVI 309
            GDLISRL +DA IVS+S+TQ +SDG +++I G VG GMM  +S  L+ V+ ++  P+ +
Sbjct: 241 VGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAV 300

Query: 310 SASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHV 369
            A ++GK+IR  SR+LQ + G LT+V+EEQL+  +TVQ++  E++EI+R+   +RN+F++
Sbjct: 301 MAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNI 360

Query: 370 GKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFG 429
           G + A  +  FF  T  VG+++ L +L+ G+ ++  G++T+GDL++FM+Y  YTG+S+FG
Sbjct: 361 GLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFG 420

Query: 430 LSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGE-IEFKNVSFSYPTRPQNQ 488
           LS+FYSE+M+GAGAA+R+FEL D  P I PT G   +  +G+ IEF+NV+F+YPTR +N+
Sbjct: 421 LSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENR 480

Query: 489 IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548
           IF  L+  I+PG +VCIVGPSG GKSTIA LLL YY+  +G+I I GQDI + N +  RR
Sbjct: 481 IFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRR 540

Query: 549 KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDTQIG 606
            LG+VQQEP+L +G+I DNITY +      ++ R  +   Q  C  F+  FP   +T +G
Sbjct: 541 LLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVSRAIGQANCTKFLANFPDGLETLVG 600

Query: 607 PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM--- 663
           P G  +SGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     Q ++++S    
Sbjct: 601 PRGAQMSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV----AQSLRSRSRRGK 656

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           T VSIAHRLSTI+ S  VIVL   G V E G F+EL SDP
Sbjct: 657 TTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISDP 696

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  520 bits (1339), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/663 (43%), Positives = 409/663 (61%), Gaps = 20/663 (3%)

Query: 55  TYQSIRTLVSTPP----SPYFLLKCK-NTGTVSSLTSQLTITRLNSTVSTQS-KDNKQPS 108
           T   +R +V   P    SP  +L+   N G  S L S  + +    +++ Q+ K   +PS
Sbjct: 4   TMLRLRYIVQNVPLRVNSPSTILRYPINLGKRSPLISFQSRSFARCSIALQAAKKQGKPS 63

Query: 109 L----QGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGI 164
           L    +G  LS  +   S + D+ RLFLL K + +          +S  + M +P VIG 
Sbjct: 64  LTATVKGLRLSPHDSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGK 123

Query: 165 ILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSER 224
           +LD  +     + E  E     M+FGLT  +F        + G +AN G         ER
Sbjct: 124 LLDIAR----EEHEQPETEKETMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGER 179

Query: 225 LVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGV 284
           LVARLR+  +K  + QDA F D ++ GDLISRL +DA IVS+S+TQ +SDG +++I G V
Sbjct: 180 LVARLRTRTMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFV 239

Query: 285 GVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVK 344
           G GMM  +S  L+ V+ +L  P+ + A ++GK+IR  SR+LQ + G+LT+VSEEQL+  K
Sbjct: 240 GFGMMSFISWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATK 299

Query: 345 TVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 404
           T+Q++  E++EI R+ + +R +FHVG + A  +  FF  T  VG+++ L +L+ G+ ++ 
Sbjct: 300 TIQAYCGEKKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIK 359

Query: 405 HGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK- 463
            G +T+GDL++FM+Y  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL D  P I PT+GK 
Sbjct: 360 TGLMTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKD 419

Query: 464 -TYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
              L  K  I F +V FSYPTRPQ+ IF++LNF + PG +VCIVGPSG GKST+A LLL 
Sbjct: 420 PVTLENK-SIHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLR 478

Query: 523 YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR 582
           YY+  SG+I +   +I   N +  RR LG+VQQEP+L SG+I DNITY +      +E R
Sbjct: 479 YYDIGSGEIKLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETR 538

Query: 583 --KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATS 640
             +   Q  C  F+  FP    T +GP GT LSGGQKQRIA+ARA +  P+ILILDEATS
Sbjct: 539 ISRAIGQANCTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATS 598

Query: 641 ALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
           ALD +SE  +  +  Q    +  T +SIAHR+STI+ S  VIVL   G+V E G F +L 
Sbjct: 599 ALDSQSEEVVAQSLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLI 657

Query: 701 SDP 703
           + P
Sbjct: 658 AIP 660

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  519 bits (1336), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 288/638 (45%), Positives = 395/638 (61%), Gaps = 18/638 (2%)

Query: 81  VSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNP------------LSTSEEPKSNFSDVI 128
           +S +  +L+   L S +  Q +     +++G P            LS ++  +  F +V 
Sbjct: 25  LSPIRGRLSQVVLKSEIHVQRRWQNSINVRGVPPSEASNRLQVLRLSGADSKEYGFKNVR 84

Query: 129 RLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMM 188
           RLF L + + K          IS  + M IP VIG +LD  K + A     EE    I  
Sbjct: 85  RLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDGDEEQETRI-- 142

Query: 189 FGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIH 248
           +GLT  +F        + G  AN G         E+LVARLR+  +K  + QDA F D +
Sbjct: 143 YGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQQDAAFLDYN 202

Query: 249 KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV 308
           + GDLISRL +DA IVS+SITQ  SDG +++I G VG GMM  +S  L+ V+ +L  P+V
Sbjct: 203 RVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGVMLLLAPPLV 262

Query: 309 ISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFH 368
           + A ++G++IR  +RELQ   G LT+V+EEQLN  +T+QS+  E++EI+R+ E +R++F 
Sbjct: 263 LMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRYAEEVRSVFR 322

Query: 369 VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIF 428
           VG R A  +  FF +T L+G+++ L +L+ G+ ++  G++T+G+L++FM+Y  YTG+S+F
Sbjct: 323 VGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMYAVYTGSSLF 382

Query: 429 GLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP-GKGEIEFKNVSFSYPTRPQN 487
           GLS+FYSE+M+GAGAASR+FEL D VP I PT GK  +     EIEFKNV FSYP+R  +
Sbjct: 383 GLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVKFSYPSRSNH 442

Query: 488 QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLR 547
            +F  LN KI PG +VC+VGPSG GKSTI+ LLL +Y+  SG I I GQ+I   N +  R
Sbjct: 443 TVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNIKDFNLRKYR 502

Query: 548 RKLGIVQQEPVLMSGSIRDNITYGL--TYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQI 605
           R LGIVQQEP+L +GSI+DNI Y L       K  + +  +   C  FI+ FP   DT +
Sbjct: 503 RSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISNFPDGLDTMV 562

Query: 606 GPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTI 665
           GP GT LSGGQKQRIAIARA I  P+ILILDEATSALD +SE  I        ++  +TI
Sbjct: 563 GPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRARSESGKITI 622

Query: 666 VSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            SIAHR+STI  S  VIVL  +G V E G F +L + P
Sbjct: 623 -SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQP 659

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  519 bits (1336), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 280/609 (45%), Positives = 390/609 (64%), Gaps = 20/609 (3%)

Query: 107 PSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIIL 166
           P ++G  L  S+   S F D+ RLF L + + +          IS  + M +P +IG +L
Sbjct: 79  PDIKGQMLRDSKS--SGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLL 136

Query: 167 DSLKVQTATQSEGEEAP-----PPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXX 221
           D+ K     Q E EE       P I  FGLT  +F     +  L G +AN G        
Sbjct: 137 DAAK---KGQKENEEEDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVT 193

Query: 222 SERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLIC 281
            ERLVARLR+  +K  + QDA F D ++ GDLISRL +DA IVS+++TQ +SDG +++I 
Sbjct: 194 GERLVARLRTRTMKAALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQ 253

Query: 282 GGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLN 341
           G VG GMM  LS  L+ V+ +++ P+ I A ++G++IR  S++LQ++ G L++V+EEQLN
Sbjct: 254 GFVGFGMMGYLSWKLTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLN 313

Query: 342 GVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSY 401
             KT+Q++V E+ EI R+   +RN+F +G + A  +  FF ST LVG+++ +++L+ G+ 
Sbjct: 314 ATKTIQAYVGERLEIHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTN 373

Query: 402 LVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTL 461
           ++  G+LT+G+L++FM+Y  YTG+S+FGLS+FYSE+M+GAGAASR+FEL D  P I+ T+
Sbjct: 374 MIQSGTLTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTV 433

Query: 462 G---KTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIAL 518
           G   KT L GK  I+F+NVSF+YP+RP ++IF NLN +I PG +VCIVG SG GKSTIA 
Sbjct: 434 GIDPKT-LFGK-SIKFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIAS 491

Query: 519 LLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG----LTY 574
           LLL YY+  +G I I   DI   + +  RR +G VQQEP L +GSI DNI Y     LT 
Sbjct: 492 LLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTS 551

Query: 575 TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
               E ++   KQ  C+ F+ KFP    T +GP G  LSGGQKQRIA+ARA +  P +LI
Sbjct: 552 EKQHERVQLAIKQANCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLI 611

Query: 635 LDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
           LDE+TSALD  SE  +  T  Q    + +T +SIAHRLSTI+ S  VIV+G  GSV+E G
Sbjct: 612 LDESTSALDSLSEELVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESG 670

Query: 695 KFKELFSDP 703
            F  L  +P
Sbjct: 671 PFDRLIDNP 679

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  516 bits (1328), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 281/615 (45%), Positives = 392/615 (63%), Gaps = 10/615 (1%)

Query: 92  RLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXIS 151
           RL S+VS + K   +P+L+   LS +    S F D+ RLF+L K + K          IS
Sbjct: 58  RLQSSVS-EGKTFTKPTLK---LSDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILIS 113

Query: 152 CVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMAN 211
             + M +P VIG +LD          E EE      ++GLT  +F     +  + G +AN
Sbjct: 114 SSVSMAVPSVIGKLLD--LASETEDEEKEEKAKSNKLYGLTKRQFFTALGLVFIIGAVAN 171

Query: 212 FGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQK 271
                      ERLVARLR+  +K  + QDA F D ++ GDLISRL +DA IV++S+TQ 
Sbjct: 172 ASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQN 231

Query: 272 ISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQ 331
           +SDG +++I G VG GMM  LS  L+ V+ VL  P+   A I+G++IR  SR+LQ + G 
Sbjct: 232 VSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGG 291

Query: 332 LTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLS 391
           LT+V+EEQLN  +T+Q++  E+ E++R+ + +RN+FH+G + A  +  FF ST LVG+ +
Sbjct: 292 LTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTA 351

Query: 392 FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 451
            L++L+ G+ ++  GS+T+G+L++FM+Y  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL 
Sbjct: 352 MLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELN 411

Query: 452 DYVPEIRPTLGKTYLP-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSG 510
           D  P IRPT+GK  +   +  I FKNVSF+YPTRP++QIFK+LN  I PG +VC VGPSG
Sbjct: 412 DRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSG 471

Query: 511 KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570
            GKSTIA LLL YY+  SG I    +DI   N +  RR +G VQQEP+L +G+I DNI Y
Sbjct: 472 SGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILY 531

Query: 571 GLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
            +     ++E R  +   Q  C  F+  FP    T +G  G  LSGGQKQRIA+ARA + 
Sbjct: 532 CIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLL 591

Query: 629 KPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDG 688
            P +LILDEATSALD +SE  +     Q    + +T +SIAHRLSTI+ S  V+VLG  G
Sbjct: 592 DPAVLILDEATSALDSQSEEIVAKNL-QRRVERGLTTISIAHRLSTIKHSTRVVVLGKHG 650

Query: 689 SVIEMGKFKELFSDP 703
           SV+E G F++L + P
Sbjct: 651 SVVETGSFQDLIAIP 665

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  515 bits (1327), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 285/664 (42%), Positives = 416/664 (62%), Gaps = 15/664 (2%)

Query: 46  GIRFLPSQSTYQSIRTLVSTPPSPYFLL--KCKNTGTVSSLTSQLTIT-RLNSTVSTQSK 102
           G + L SQ T+  +  L ST PS   ++  K +    +S   + L+ + RL S+++ + K
Sbjct: 11  GPKMLRSQFTW--VGALYSTKPSFKTIVCPKVRLNSIISHKKALLSQSIRLQSSIA-EGK 67

Query: 103 DNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVI 162
            + +P+L+   LS +    S F D+ RLF+L + + K          IS  + M +P VI
Sbjct: 68  ASTKPTLK---LSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVI 124

Query: 163 GIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXS 222
           G +LD        + E +       ++GLT  +F     +  + G +AN           
Sbjct: 125 GKLLDVASESDDEEDEEKARDSK--LYGLTKKQFFTALGLVFVIGAVANASRIIILKITG 182

Query: 223 ERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICG 282
           ERLVARLR+  +K  + QDA F D ++ GDLISRL +DA IV++S+TQ +SDG +++I G
Sbjct: 183 ERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQG 242

Query: 283 GVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNG 342
            VG GMM  LS  L+ V+ +L  P+   A ++GK+IR  SR+LQ + G LT+V+EEQLN 
Sbjct: 243 FVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNA 302

Query: 343 VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYL 402
            +T+Q++  E+ E+ R+ + +RN+FH+G + A  +  FF ST LVG+ + L++L+ G+ +
Sbjct: 303 TRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNM 362

Query: 403 VLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLG 462
           +  G +TIG+L++FM+Y  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL D  P I PT+G
Sbjct: 363 IQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIG 422

Query: 463 KTYLP-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL 521
           K  +      + FKNVSF+YPTRP++QIFK+LN  I+PG +VC VGPSG GKSTIA LLL
Sbjct: 423 KDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLL 482

Query: 522 HYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEI 581
            YY+  SG I  D +D+   N +  RR +G VQQEP+L +G+I DNI Y +     + E 
Sbjct: 483 RYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAERED 542

Query: 582 R--KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEAT 639
           R  +  +Q  C  F+  FP    T +G  G  LSGGQKQRIA+ARA +  P +LILDEAT
Sbjct: 543 RVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEAT 602

Query: 640 SALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           SALD +SE  +     + ++ + +T +SIAHRLSTI+ S  +IVLG  GSV+E G F++L
Sbjct: 603 SALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDL 661

Query: 700 FSDP 703
            + P
Sbjct: 662 IAIP 665

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  508 bits (1309), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 280/628 (44%), Positives = 389/628 (61%), Gaps = 15/628 (2%)

Query: 87  QLTI---TRLNSTVSTQSKDNKQPSLQG---NPLSTSEEPKSNFSDVIRLFLLVKTDWKX 140
           QLT+    R NST       N   S+       LS S+   S F D+ RLF L K +   
Sbjct: 47  QLTVERQVRWNSTQRAPVNVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLFRLAKPETLQ 106

Query: 141 XXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGF 200
                    IS  + M IP ++G +LD  K +       E+   P  +FG+T  +F    
Sbjct: 107 IALALVLILISSAVSMTIPTIVGKLLDIAKDRKDADDTTEDDEGP-KIFGMTTKQFCTAL 165

Query: 201 SIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGAD 260
               L G  AN G         ERLVARLR+  +K  + QDA F D ++ GDLIS L +D
Sbjct: 166 LAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSD 225

Query: 261 AYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRI 320
           A IV++S+TQ +SDG +++I G VG GMM  +S  L++V+ ++I P+ I A ++G++IR 
Sbjct: 226 ASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRN 285

Query: 321 NSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKF 380
            SR+LQ + G LT+VSEEQL  VKT+QS+V E++EI R+   +RN+F++G + A  +  F
Sbjct: 286 LSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVF 345

Query: 381 FTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQG 440
           F ST LVG++S L +L+ G+ ++ +G +T+GDL++FM+Y  YTG+S+FGLS+FYSE+M+G
Sbjct: 346 FGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKG 405

Query: 441 AGAASRLFELTDYVPEIRPTLGKTYLP-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEP 499
           AGAA+R+FEL D  P I PT+G+  +      I F+NVSF+YPTR   +IF  L+  +EP
Sbjct: 406 AGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEP 465

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559
           G +VCIVGPSG GKST+A LLL YY+   G+I+I   +I   N +  RR LGIVQQEP L
Sbjct: 466 GEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQL 525

Query: 560 MSGSIRDNITYGLTYTPTKEE----IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGG 615
            +G+I DNI Y  T  P + +    I     Q  C  F+  FP    T +GP G  LSGG
Sbjct: 526 FNGTILDNILY--TVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGG 583

Query: 616 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI 675
           QKQRIA+ARA +  P++LILDEATSALD +SE  +  T  ++   + +T +SIAHRLSTI
Sbjct: 584 QKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTI 642

Query: 676 RRSENVIVLGNDGSVIEMGKFKELFSDP 703
           +    V+VLG  G V+E G F+EL  +P
Sbjct: 643 KNCTRVVVLGKCGQVVESGPFEELLRNP 670

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  504 bits (1299), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 272/600 (45%), Positives = 384/600 (64%), Gaps = 9/600 (1%)

Query: 107 PSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIIL 166
           P+L+   LS ++   S F D+ RLF+L + +            IS  + M +P VIG +L
Sbjct: 71  PTLK---LSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLL 127

Query: 167 DSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLV 226
           D        +   E       ++GL+  +F        L G +AN           ERLV
Sbjct: 128 DLASDDDDEEDAKETKDNK--LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLV 185

Query: 227 ARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV 286
           ARLR+  +K  + QDA F D ++ GDLISRL +DA IV++S+TQ +SDG +++I G VG 
Sbjct: 186 ARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGF 245

Query: 287 GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTV 346
           GMM  LS  L+ V+ VL  P+   A I+G++IR  SR+LQ + G LT+V+EEQLN  +T+
Sbjct: 246 GMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTI 305

Query: 347 QSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 406
           Q++  E+ E++R+ + +RN+FHVG + A  +  FF ST LVG+ + L++L+ G+ ++  G
Sbjct: 306 QAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSG 365

Query: 407 SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYL 466
           ++T+G+LT+FM+Y  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL D  P IRPT+GK  +
Sbjct: 366 AMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPV 425

Query: 467 P-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYN 525
                 I FK+VSF+YPTRP++QIFK+LN  I+PG +VC VGPSG GKSTIA LLL YY+
Sbjct: 426 SLAHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYD 485

Query: 526 PTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR--K 583
            ++G I    +DI   N +  RR +G VQQEP+L +G+I DNI Y +     ++E R  +
Sbjct: 486 TSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVAR 545

Query: 584 VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
              Q  C  F+  FP    T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD
Sbjct: 546 AIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALD 605

Query: 644 VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            +SE  +     + +K + +T +SIAHRLSTI+ S  VIVLG  GSV+E G F++L S P
Sbjct: 606 SQSEEVVAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIP 664

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  502 bits (1292), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 283/690 (41%), Positives = 414/690 (60%), Gaps = 45/690 (6%)

Query: 38  QHILPYTLGIRFLPSQS----TYQSIRTLVSTPPSPYFLLKCKNTGTVSSLTSQLTITRL 93
           Q  L + LG R LP+ +    ++  +R L    P P            S     L   R 
Sbjct: 12  QRQLHFGLG-RQLPTSTICPQSFNRLRKLAIRTPMP------------SKPLGSLMQARW 58

Query: 94  NSTVSTQ-SKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXXXXXXISC 152
           NS+ + Q +  N   + Q   LS++E+  S F D+ RL  L + +            IS 
Sbjct: 59  NSSNAKQPNTTNTDKTGQIAELSSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIVISS 118

Query: 153 VIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIM---------MFGLTIYEF---LGGF 200
            + M++P VIG +LD  K  + +++E +E+              ++G T  +F   +GG 
Sbjct: 119 TVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGI 178

Query: 201 SIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGAD 260
               +AG  AN G         ERLVARLR+  +K  + QD+ F D ++ GDLISRL +D
Sbjct: 179 ---FVAGAFANCGRIIILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSD 235

Query: 261 AYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRI 320
           + IV++S+TQ +SDG +++I G VG GMM  +S  L+ V+G+++ P+   A I+GK+IR 
Sbjct: 236 SSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRN 295

Query: 321 NSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKF 380
            S++LQ + G LT+V+EEQL   KT+QS+V E++EI+R+ + +R +F +G + A  +  F
Sbjct: 296 LSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMF 355

Query: 381 FTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQG 440
           F ST  VG++S L +L+ G+ ++  G +T+GDL++FM+Y  YTG S+FGLS FYSE+M+G
Sbjct: 356 FGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKG 415

Query: 441 AGAASRLFELTDYVPEIRPTLGK-----TYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNF 495
           AGAA+R+FEL D  P I PTLGK       LP    I FK+VSF+YPTR   +IF +LN 
Sbjct: 416 AGAAARVFELNDRKPAIAPTLGKGPTSIRNLP----ISFKDVSFTYPTRLNKKIFNHLNL 471

Query: 496 KIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQ 555
            I+PG ++CI GPSG GKSTIA LL+ YY+   G I I   D+   N +  RR +G+V Q
Sbjct: 472 TIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQ 531

Query: 556 EPVLMSGSIRDNITYGLTYTPTKEEIRKVAK--QCFCHNFITKFPHTYDTQIGPSGTLLS 613
           EPVL +G+I +NI Y +  +  ++E R  A   +  C  F++ FP   +T +GP G  LS
Sbjct: 532 EPVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLS 591

Query: 614 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLS 673
           GGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  T  + ++ + +T +SIAHR+S
Sbjct: 592 GGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQERVR-RGLTTISIAHRIS 650

Query: 674 TIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           TI  S  V+VLG DG V+E G F+EL   P
Sbjct: 651 TIAHSTRVVVLGRDGFVVESGPFQELIDRP 680

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  493 bits (1270), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/656 (41%), Positives = 403/656 (61%), Gaps = 23/656 (3%)

Query: 69  PYFLLKCKNT-GTVSSLTSQLTITRLNSTVSTQSK-DNKQPSLQGNPLSTSEEPKSNFSD 126
           P  LL+ ++     +S   QL     N T+  Q +  +   S     L++ E+  S++ D
Sbjct: 27  PSLLLQVRSLHNGKTSFERQLAAMLQNRTIMRQVRWQHSNASKPSTTLTSEEQNSSSWKD 86

Query: 127 VIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGE------ 180
           + RLF L + + K          +S  + M++P VIG ++D  K    + SE +      
Sbjct: 87  IKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDA 146

Query: 181 ----------EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLR 230
                     +     ++ GLT+ +F GG     + G  AN G         E+LVARLR
Sbjct: 147 TDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLR 206

Query: 231 STVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMC 290
           +  +K  + QDA F D +K GDLISRL +DA IVS+S+TQ +SDG +SLI G VG GMM 
Sbjct: 207 TRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMS 266

Query: 291 SLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFV 350
            +S  L+ V+ +L  P+ + A ++G++IR  SR LQ + G LT+ +EEQL+  +T+Q++ 
Sbjct: 267 YISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYG 326

Query: 351 AEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTI 410
            E++ I+ + + +R ++ VG + A  +  FF  T LVG+ + L +L+ G+ ++  G++T+
Sbjct: 327 GEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTV 386

Query: 411 GDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP-GK 469
           GDL++FM+Y  YTG+S+FG+S+FYSE+M+GAGAA+R+FEL D  P I PT G+  +   +
Sbjct: 387 GDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLAR 446

Query: 470 GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
             +EFK V F+YPTR Q+ IF++L+ +I+PG +VCIVGPSG GKST+A LLL +Y+  +G
Sbjct: 447 KPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAG 506

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK--- 586
            ILI GQ+I   N +  RR +GIVQQEP+L +G+I +NI Y +      EE  +VA+   
Sbjct: 507 AILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIG 566

Query: 587 QCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
           Q  C  F++ FP    T +GP GT LSGGQKQRIA+ARA +  P++LILDEATSALD  S
Sbjct: 567 QANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRS 626

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           E  I  T      T+  T +SIAHR+STI+ S  VIVLG +G V+E G F EL S+
Sbjct: 627 EEVIARTL-HSRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASN 681

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  491 bits (1265), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 274/640 (42%), Positives = 392/640 (61%), Gaps = 21/640 (3%)

Query: 75  CKNTGTVSSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLV 134
           CK     S+    +++  ++  +     +++QPS   + L+  E   S++ D+ RLF L 
Sbjct: 43  CK-----SAWVKPISLIHVSRQIRWNHAESRQPS---STLTPEEHNSSSWKDIKRLFQLA 94

Query: 135 KTDWKXXXXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPI-------M 187
           + + +          IS  + M++P VIG ++D+ K         E              
Sbjct: 95  RPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQ 154

Query: 188 MFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDI 247
           +FGLT+ +F G      + G  AN G         E+LVARLR+  +K ++ QDA F D 
Sbjct: 155 IFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDN 214

Query: 248 HKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPV 307
           +K GDLISRL +DA IVS+S+TQ +SDG +SLI G VG GMM  +S  L+ V+ +L  P+
Sbjct: 215 NKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPL 274

Query: 308 VISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIF 367
              A I+GK+IR  SR LQ + G LT+ +EEQL+  +T+Q++  E+  I ++ + +R ++
Sbjct: 275 AAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVY 334

Query: 368 HVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSI 427
            VG + A  +  FF  T LVG+++ L +L+ G+ ++  G++T+GDL++FM+Y  YTG+S+
Sbjct: 335 QVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSL 394

Query: 428 FGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLG--KTYLPGKGEIEFKNVSFSYPTRP 485
           FG+S+FYSE+M+GAGAA+R+FEL D  P I PT G     L GK  +EF+NV F+YPTR 
Sbjct: 395 FGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGK-PVEFQNVKFAYPTRH 453

Query: 486 QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKS 545
           Q+ IF+NL F+I  G +VCIVGPSG GKST+A LLL +Y+  +G I I GQ I   N + 
Sbjct: 454 QHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRK 513

Query: 546 LRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDT 603
            RR LG+VQQEP+L +G+I DNI Y +  +   +E R  +   Q  C  F++ FP    T
Sbjct: 514 YRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENRVARAIGQANCSAFLSSFPDGLQT 573

Query: 604 QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM 663
            +GP GT LSGGQKQRIA+ARA +  P++LILDEATSALD  SE  +         T+  
Sbjct: 574 LVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVVARALYS-RSTRGK 632

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           T +SIAHR+STI+ S  VIVLG  G V+E G F EL SDP
Sbjct: 633 TTISIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDP 672

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  480 bits (1235), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 251/593 (42%), Positives = 378/593 (63%), Gaps = 19/593 (3%)

Query: 126 DVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGIILD-SLKVQTAT-QSEGEEAP 183
           D+  LF L K +            I+  + M++P VIG +LD S  ++ A+ + E +E+ 
Sbjct: 98  DIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDESS 157

Query: 184 P-------------PIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLR 230
                           +++G T   F  G  +  + G +AN G         ER+VARLR
Sbjct: 158 KEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVARLR 217

Query: 231 STVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMC 290
           +  +K  + QD +F D +K GDLISRL +D+ IVS ++T+ +SDG +++I G VGVGMM 
Sbjct: 218 TRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMMS 277

Query: 291 SLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFV 350
            +SL LS V+  ++ P+ + A I+G++IR  S++LQ++ G LT++SEEQLNG +T+QS+V
Sbjct: 278 FISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSYV 337

Query: 351 AEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTI 410
            E+ EI ++ + +R ++HVG   A  +  FF  T L+G+ + L++L  G  ++ +G+L+I
Sbjct: 338 GEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLSI 397

Query: 411 GDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKG 470
           G L++FM+Y  YTG+S+FGLS+FYSEIM+G+GAASR+FE+  YVP+I  T G   +  + 
Sbjct: 398 GGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISFQD 457

Query: 471 E-IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           + IEF+++ F+YPTR  + IF++LN KI PG +VCI+GPSG GKSTI+ LLL YY+P +G
Sbjct: 458 KPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLAG 517

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL--TYTPTKEEIRKVAKQ 587
            I I G+DI + + +  R+ +G+V QEPVL +G+I +NI Y +       KE +    + 
Sbjct: 518 TISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSNAIES 577

Query: 588 CFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 647
             C+ F+   P   +T +GP GT LSGGQKQR+A+ARA + +P +L+LDEATSALD  SE
Sbjct: 578 SNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALDPRSE 637

Query: 648 GAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
             +  T  Q    K  T +SIAHR+STI+ S  V+VL   G V+E G ++EL 
Sbjct: 638 SIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELL 689

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  457 bits (1177), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 255/603 (42%), Positives = 370/603 (61%), Gaps = 31/603 (5%)

Query: 106 QPSLQGNPLSTSEEPKSN-FSDVIRLFLLVKTDWKXXXXXXXXXXISCVIGMMIPKVIGI 164
           +P +  N  + ++  K+  ++ V +L  L K + K          +S  + M +P VIG 
Sbjct: 12  RPVIHRNSSTKTDLKKTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGT 71

Query: 165 ILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSER 224
           ++D              + P   ++GLT  +FL       + G +AN G         E+
Sbjct: 72  LID------------HASTPDAPIYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEK 119

Query: 225 LVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGV 284
           LVARLR+  +K  + QDA F D H+ GDLISRL +DA IVS+S+T  +SDG ++ + G V
Sbjct: 120 LVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVV 179

Query: 285 GVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVK 344
           G+GMM  +SL L+ V+ +++ P+ I A ++G +I+  SR+LQD  GQL++ SEEQLN +K
Sbjct: 180 GIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLK 239

Query: 345 TVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 404
           TVQ++  E++E++R++  +R++F++G + A  +A FF ST L+G+++ + +L+ G+    
Sbjct: 240 TVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA--- 296

Query: 405 HGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLG-- 462
             S+T+G+L++FM+Y  YTG+S+FGL+ FYSE+M+G GAA R+ EL +   +I PT G  
Sbjct: 297 DSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGIS 356

Query: 463 --KTY--LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIAL 518
             KT   LP    I F NVSF+Y       +   +NF+I PG +VC VG SG GKSTI+ 
Sbjct: 357 PPKTLKGLP----ITFNNVSFAYSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISS 410

Query: 519 LLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK 578
           LLL YY   SG I I   DI+  N +  RR LG+VQQEP+L +G+I DNITYGL +  + 
Sbjct: 411 LLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSL 469

Query: 579 EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
            ++    K   C  FI +     DT +GP G  LSGGQ+QRIA+AR  ++ P+ILILDEA
Sbjct: 470 TDLNMALKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEA 529

Query: 639 TSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
           TSALD +SE  IN    Q  +   MT +SIAHRLSTIR S  VIV+  DG V+E G F +
Sbjct: 530 TSALDTKSEDIINKEL-QRRQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQ 587

Query: 699 LFS 701
           L S
Sbjct: 588 LRS 590

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  202 bits (515), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 203/391 (51%), Gaps = 22/391 (5%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R    A  +   V+ + L   + V+ F  E+    +++ ++ N       V +  AF+N+
Sbjct: 292 RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNS 351

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LT ++Y G   V+ G L++GDL             +  L + Y
Sbjct: 352 GQNLIFTSA--------LTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVY 403

Query: 435 SEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKG--EIEFKNVSFSYPTRPQNQIFKN 492
            E+ Q       LF+L      I+ +     LP     EI+F+NV+F Y   P  +I +N
Sbjct: 404 RELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILEN 461

Query: 493 LNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGI 552
            NF +  G    IVGPSG GKSTI  L+  +Y+P  G+ILIDG+DI +++ KSLRR +G+
Sbjct: 462 ANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGV 521

Query: 553 VQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLL 612
           V Q+  L + +I +N+ +G   T T ++IRK   +      I   P   +T +G  G ++
Sbjct: 522 VPQDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMI 580

Query: 613 SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRL 672
           SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T  +     S T + IAHRL
Sbjct: 581 SGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRL 640

Query: 673 STIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            TI  ++ ++VL N G V E GK  EL S P
Sbjct: 641 RTIADADKIVVLEN-GRVKEEGKHAELLSKP 670

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  202 bits (514), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 147/435 (33%), Positives = 217/435 (49%), Gaps = 27/435 (6%)

Query: 284 VGVGMMCS-LSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEE 338
           V +G +C  L+         +    ++  SIF  +      E +     A  +   V+ +
Sbjct: 268 VEIGAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKADNKAASVAVD 327

Query: 339 QLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINAK---FFTSTSLVGDLS 391
            L   + V+ F  EQ    ++++++         V +  AF+N+     FTS        
Sbjct: 328 SLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSA------- 380

Query: 392 FLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
            LT ++Y G   V+ G L++GDL             +  L + Y E+ Q       LF+L
Sbjct: 381 -LTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL 439

Query: 451 TDYVPEIRPTLGKTYLPGK--GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGP 508
                 I+ +     LP     EI FKNVSF Y   P   I KN +F I  GS   IVGP
Sbjct: 440 QRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGP 497

Query: 509 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
           SG GKSTI  L+  +Y+P  G+IL+DG+D+ +++ +SLRR +G+V Q+  L + SI DN+
Sbjct: 498 SGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNV 557

Query: 569 TYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
            +G     T +EI +   +      I + P   DT +G  G ++SGG+KQR+AIAR L+K
Sbjct: 558 KFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLK 616

Query: 629 KPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDG 688
              I+  DEATSALD  +E A+  T  +   T S T V IAHRL TI  ++ +IVL + G
Sbjct: 617 DAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-G 675

Query: 689 SVIEMGKFKELFSDP 703
            V E GK  EL + P
Sbjct: 676 RVKEEGKHAELLATP 690

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  199 bits (506), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 144/437 (32%), Positives = 220/437 (50%), Gaps = 31/437 (7%)

Query: 284 VGVGMMCS-LSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEE 338
           V +G +C  L+    A    +    ++  SIF  +      E +     A  +   V+ +
Sbjct: 240 VEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTTAWRTEFRKSANKADNKAATVAVD 299

Query: 339 QLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINAK---FFTSTSLVGDLS 391
            L   + V+ F  EQ    +++ ++         V +  AF+NA     FTS        
Sbjct: 300 SLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSA------- 352

Query: 392 FLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
            LT ++Y G   V+ G+L++GDL             +  L + Y E+ Q       LF+L
Sbjct: 353 -LTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQL 411

Query: 451 TDYVPEI----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
                +I    +P +  +  P K  I F+NVSF Y   P   I KN +F +  G    IV
Sbjct: 412 QRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSFTMPAGWKTAIV 467

Query: 507 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           GPSG GKSTI  L+  +Y+P  G+IL+DG+D+ +++ +SLRR +G+V Q+  L + SI +
Sbjct: 468 GPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWE 527

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           N+ +G   + + EEIR   ++    + + + P   DT +G  G ++SGG+KQR+AIAR L
Sbjct: 528 NVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVL 586

Query: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
           +K   I+  DEATSALD  +E A+  T      T S T V IAHRL TI  ++ +IV+  
Sbjct: 587 LKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-Q 645

Query: 687 DGSVIEMGKFKELFSDP 703
            G V E GK  EL + P
Sbjct: 646 QGQVKEEGKHAELLAKP 662

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  196 bits (499), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/389 (33%), Positives = 204/389 (52%), Gaps = 18/389 (4%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E+    ++N ++ N       V +  AF+N 
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLN- 344

Query: 379 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
              +  +L+   +   ++  G   V+ G LT+GDL             +  L + Y ++ 
Sbjct: 345 ---SGQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 401

Query: 439 QGAGAASRLFELTDYVPEI----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLN 494
           Q       LF+L     +I    RP +   ++P   EI F+NV+F Y   P  +I KN +
Sbjct: 402 QSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HPDRKILKNAS 457

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
           F I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LRR +G+V 
Sbjct: 458 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVP 517

Query: 555 QEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSG 614
           Q+  L + +I +N+ +G     T EE++   ++      I K P  ++T +G  G ++SG
Sbjct: 518 QDTPLFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISG 576

Query: 615 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLST 674
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL T
Sbjct: 577 GEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRT 636

Query: 675 IRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           I  ++ +IVL N G+V E GK  EL + P
Sbjct: 637 IADADKIIVLDN-GTVKEDGKHIELLATP 664

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  195 bits (496), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 205/393 (52%), Gaps = 26/393 (6%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E+    ++N ++ N       V +  AF+N+
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNS 347

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LT ++Y G   V+ G LT+GDL             +  L + Y
Sbjct: 348 GQNLIFTSA--------LTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY 399

Query: 435 SEIMQGAGAASRLFELTDYVPEI----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIF 490
            E+ Q       LF+L     +I    RP +   ++P   +I F+NV+F Y   P  +I 
Sbjct: 400 RELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPY--DITFQNVTFGY--HPDRKIL 455

Query: 491 KNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKL 550
           KN +F I  GS   IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ +
Sbjct: 456 KNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVI 515

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGT 610
           G+V Q+  L + +I +N+ +G     T EE+  V ++      I K P  ++T +G  G 
Sbjct: 516 GVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGL 574

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAH
Sbjct: 575 MISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAH 634

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           RL TI  ++ +IV  N G V E GK  EL + P
Sbjct: 635 RLRTIADADKIIVFDN-GKVREEGKHLELLATP 666

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  195 bits (496), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 135/393 (34%), Positives = 204/393 (51%), Gaps = 26/393 (6%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R    A  +   V+ + L   + V+ F  E+    ++++++         V +  AF+NA
Sbjct: 305 RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNA 364

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LT ++Y G+  V+ G+LT+GDL             +  L + Y
Sbjct: 365 GQNFIFTSA--------LTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVY 416

Query: 435 SEIMQGAGAASRLFELTDYVPEI----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIF 490
            E+ Q       LF+L      I    RP +   +LP   EI+F+NV+F Y  +P   I 
Sbjct: 417 RELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPC--EIKFENVTFGY--QPDRNIL 472

Query: 491 KNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKL 550
           KN  F I PG    IVGPSG GKSTI  L+  +Y+P  G+IL+DG+DI +++   LRR +
Sbjct: 473 KNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIV 532

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGT 610
           G+V Q+  L + +I +N+ +G     T  EI    ++    + I K P   +T +G  G 
Sbjct: 533 GVVPQDTPLFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGL 591

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           ++SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +     + T V IAH
Sbjct: 592 MISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAH 651

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           RL TI  ++ +IVL N G+V E G    L ++P
Sbjct: 652 RLRTIADADKIIVLEN-GAVREEGTHNALLANP 683

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/390 (34%), Positives = 198/390 (50%), Gaps = 23/390 (5%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R    A  +   ++ + L   + V+ F  E     ++N A+         V +  AF+N+
Sbjct: 275 RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNS 334

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LT ++Y G   +L G+LT+GDL             +  L + Y
Sbjct: 335 GQNLIFTSA--------LTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVY 386

Query: 435 SEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKG---EIEFKNVSFSYPTRPQNQIFK 491
            E+ Q       LF+L      I+       LP  G   EI F+NV+F Y   P   I K
Sbjct: 387 RELKQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILK 444

Query: 492 NLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLG 551
           N +F I  G  + IVGPSG GKSTI  L+  +Y+P  G+ILI+G D+ +++  SLR+ +G
Sbjct: 445 NASFVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIG 504

Query: 552 IVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
           +V Q+  L + +I +N+ +G     T EE+    ++      I+K     DT +G  G +
Sbjct: 505 VVPQDTPLFNDTIWENVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLM 563

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
           +SGG+KQR+AIAR L+K  +I+  DEATSALD  +E  +  T     KT S T + IAHR
Sbjct: 564 ISGGEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHR 623

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           L TI  ++ +IVL  DGSV E G   EL +
Sbjct: 624 LRTIADADKIIVL-EDGSVKEEGTHTELLA 652

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  193 bits (490), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 201/387 (51%), Gaps = 14/387 (3%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E+    ++N ++ N       V +  AF+N 
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLN- 343

Query: 379 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
              +  +L+   +   ++  G   V+ G+LT+GDL             +  L + Y ++ 
Sbjct: 344 ---SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 439 QGAGAASRLFELTDYVPEIRPTLGKTYLPGK--GEIEFKNVSFSYPTRPQNQIFKNLNFK 496
           Q       LF+L     +I+       LP     +I F+NV+F Y   P  +I KN +F 
Sbjct: 401 QSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFT 458

Query: 497 IEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQE 556
           I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ +G+V Q+
Sbjct: 459 IPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQD 518

Query: 557 PVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQ 616
             L + +I +N+ +G     T EE+  V ++      I K P  +DT +G  G ++SGG+
Sbjct: 519 TPLFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGE 577

Query: 617 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIR 676
           KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL TI 
Sbjct: 578 KQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIA 637

Query: 677 RSENVIVLGNDGSVIEMGKFKELFSDP 703
            ++ +IVL N G V E GK  EL + P
Sbjct: 638 DADKIIVLDN-GRVREEGKHLELLAMP 663

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  192 bits (489), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 131/389 (33%), Positives = 204/389 (52%), Gaps = 18/389 (4%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAI----RNIFHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E+    ++N ++     +   V +  AF+N 
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLN- 343

Query: 379 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
              +  +L+   +   ++  G   V+ G+LT+GDL             +  L + Y ++ 
Sbjct: 344 ---SGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLK 400

Query: 439 QGAGAASRLFELTDYVPEI----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLN 494
           Q       LF+L     +I    RP +   ++P   +I F+NV+F Y   P  +I KN +
Sbjct: 401 QSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY--DITFENVTFGY--HPDRKILKNAS 456

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
           F I  G    IVG SG GKSTI  L+  +Y+P SG+ILI+G+DI + +  +LR+ +G+V 
Sbjct: 457 FTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVP 516

Query: 555 QEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSG 614
           Q+  L + +I +N+ +G     T EE+  V ++      I K P  +DT +G  G ++SG
Sbjct: 517 QDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISG 575

Query: 615 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLST 674
           G+KQR+AIAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL T
Sbjct: 576 GEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRT 635

Query: 675 IRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           I  ++ +IVL N G V E GK  EL + P
Sbjct: 636 IADADKIIVLDN-GRVREEGKHLELLATP 663

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 146/451 (32%), Positives = 230/451 (50%), Gaps = 24/451 (5%)

Query: 261 AYIVSRSITQKISDGFK-SLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIR 319
           +Y++S  +   I   F+ S++CG +      S + +++ +  +L     I  + +  Q R
Sbjct: 243 SYVLSAMVFHIIPITFEISVVCGILTHQFGASFA-EITFMTMLLYSIFTIKTTAWRTQFR 301

Query: 320 INSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAI---RNI-FHVGKRSAF 375
              R+   A  +   ++ + L   + V+ F  E     ++N A+   RN    + K  AF
Sbjct: 302 ---RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAF 358

Query: 376 INA--KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTF 433
           +N+      +T+L G      ++  G   V+ G+LT+GDL             +  L + 
Sbjct: 359 LNSGQNLIFTTALTG------MMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSV 412

Query: 434 YSEIMQGAGAASRLFELTDYVPEIRPTLG-KTYLPGKG--EIEFKNVSFSYPTRPQNQIF 490
           Y E+ Q       LF+L     +I      K  L   G  EI F+NV+F Y      +I 
Sbjct: 413 YRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKIL 470

Query: 491 KNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKL 550
           KN +F I  G    IVGPSG GKSTI  L+  +Y+P  G+ILI+G D+ ++   SLR+ +
Sbjct: 471 KNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLI 530

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGT 610
           G+V Q+  L + SI +N+ +G        EI +V ++    + I K P +Y+T +G  G 
Sbjct: 531 GVVPQDTPLFNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGL 589

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           ++SGG+KQR+AIAR L+K  +++  DEATSALD  +E A+  T     KT S T + IAH
Sbjct: 590 MISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAH 649

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           RL TI  ++ +IVL  DG+V E G   EL +
Sbjct: 650 RLRTIADADKIIVL-EDGTVREEGTHNELLA 679

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  189 bits (479), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 204/391 (52%), Gaps = 24/391 (6%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   ++ + L   + V+ F  E+   +++++ +         V +  AF+N+
Sbjct: 305 RQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNS 364

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LTV++Y G   ++ G+LT+GDL             +  L + Y
Sbjct: 365 GQNLIFTSA--------LTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVY 416

Query: 435 SEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGE----IEFKNVSFSYPTRPQNQIF 490
            E+ Q       LF+L      I+       L  KG     I F+NV+F Y    Q +I 
Sbjct: 417 RELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYD--KQRKIL 474

Query: 491 KNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKL 550
           KN +F+IE G    IVGPSG GKSTI  LL  +Y+P  G+IL++G D  + +  SLR+ +
Sbjct: 475 KNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVI 534

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGT 610
           G+V Q+  L + +I +N+ +G     + +EI +V  +      + K P   +T +G  G 
Sbjct: 535 GVVPQDTPLFNDTIWENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGL 593

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T  +  K  S T V IAH
Sbjct: 594 MISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAH 653

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           RL TI  ++ +IVL  +G+V E GK  EL +
Sbjct: 654 RLRTIADADKIIVL-QEGTVREEGKHSELLA 683

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 130/392 (33%), Positives = 198/392 (50%), Gaps = 23/392 (5%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   ++ + L   + V+ F  EQ    ++N ++++       V +  AF+N+
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNS 361

Query: 379 K---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFY 434
                FTS         LT ++Y G   +L G+L++GDL             +  L + Y
Sbjct: 362 GQNLIFTSA--------LTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVY 413

Query: 435 SEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP---GKGEIEFKNVSFSYPTRPQNQIFK 491
            ++ Q       LF+L     +I        L    G   IEFKNV+F Y   P  +I +
Sbjct: 414 RDLKQSLIDMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILR 471

Query: 492 NLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLG 551
           N +F I  G    +VGPSG GKSTI  L+  +Y+P  G++L++G D+   +  SLRR +G
Sbjct: 472 NASFIIPAGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIG 531

Query: 552 IVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
           +V Q+  L + +I +N+ +G   T T E+I    ++      I K P  Y+T +G  G +
Sbjct: 532 VVPQDTPLFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLM 590

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
           +SGG+KQR+AIAR L+K   I+  DEATSALD  +E  +  T        S T V IAHR
Sbjct: 591 ISGGEKQRLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHR 650

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           L T+  S+ +IVL  +GS+ E G    L S P
Sbjct: 651 LRTVADSDKIIVL-KEGSIFEEGTHLGLLSKP 681

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  186 bits (472), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 125/387 (32%), Positives = 197/387 (50%), Gaps = 14/387 (3%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E+    ++++++         V +  AF+N+
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 379 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
                 +L+   +   V+      V+ GSLT+GDL             +  L + Y E+ 
Sbjct: 353 ----GQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELK 408

Query: 439 QGAGAASRLFELTDYVPEIRPTLGKTYLPGK--GEIEFKNVSFSYPTRPQNQIFKNLNFK 496
           Q       LF L      I+  L    LP K   +I F+NV+F Y   P+ +I KN  F 
Sbjct: 409 QSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFT 466

Query: 497 IEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQE 556
           I  G    IVGPSG GKSTI  L+  +Y P  G+ILIDG+DI +++  SLR+ +G+V Q+
Sbjct: 467 IPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQD 526

Query: 557 PVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQ 616
             L + +I +N+ +G     + ++I    ++      I   P   +T +G  G ++SGG+
Sbjct: 527 TPLFNDTIWENVKFG-RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGE 585

Query: 617 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIR 676
           KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + +S T V IAHRL TI 
Sbjct: 586 KQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIA 645

Query: 677 RSENVIVLGNDGSVIEMGKFKELFSDP 703
            ++ +IVL N+  V E G  K L   P
Sbjct: 646 DADKIIVL-NNSRVHEEGDHKTLLKTP 671

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  186 bits (471), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 144/457 (31%), Positives = 232/457 (50%), Gaps = 33/457 (7%)

Query: 261 AYIVSRSITQKISDGFK-SLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIR 319
           +Y++S  +   I  GF+ S++CG +      S +  ++    +L     I  + +  Q R
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFA-GITFTTMLLYSIFTIRTTAWRTQFR 315

Query: 320 INSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAI----RNIFHVGKRSAF 375
              R+   A  +   V+ + L   + V+ F  E     ++++++     +   V +  AF
Sbjct: 316 ---RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAF 372

Query: 376 INAK---FFTSTSLVGDLSFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLS 431
           +N+     FTS         LT+++Y G   V+ G+LT+GDL             +  L 
Sbjct: 373 LNSGQNLIFTSA--------LTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLG 424

Query: 432 TFYSEIMQGAGAASRLFELTDYVPEIR-------PTLGKTYLPGKGEIEFKNVSFSYPTR 484
           + Y E+ Q       LF+L     +I+       P + K+   G  EI+F+NV+F Y T 
Sbjct: 425 SVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSS-DGPFEIKFENVTFGYDT- 482

Query: 485 PQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSK 544
              +I KN +F I  G    +VGPSG GKSTI  L+  +Y+P  G++LI+G ++ + +  
Sbjct: 483 -NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDID 541

Query: 545 SLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQ 604
           SLRR +G+V Q+  L + +I +N+ +G       EEI++V ++      I K P    T 
Sbjct: 542 SLRRVMGVVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTI 600

Query: 605 IGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMT 664
           +G  G ++SGG+KQR+AIAR L+K  NI+  DEATSALD  +E A+  T      + + T
Sbjct: 601 VGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRT 660

Query: 665 IVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            + IAHRL TI  ++ +IVL  DG V E G   EL +
Sbjct: 661 SIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLA 696

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  185 bits (470), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 171/317 (53%), Gaps = 8/317 (2%)

Query: 391 SFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
           S LT ++Y G   V+ G LT+GDL             +  L + Y E+ Q       LF+
Sbjct: 351 SALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 410

Query: 450 LTDYVPEIRPTLGKTYLP---GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
           L     +I        L    G  EI F+NV+F Y ++   +I  N +F I  G    +V
Sbjct: 411 LRKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNNASFTIPGGLKTAVV 468

Query: 507 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           GPSG GKSTI  L+  +Y+P  G+ILI+G D+ + +  SLRR +G+V Q+  L + +I +
Sbjct: 469 GPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWE 528

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           N+ +G     T EE+  V ++      I K P  Y+T +G  G ++SGG+KQR+AIAR L
Sbjct: 529 NVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVL 587

Query: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
           +K   I+  DEATSALD  +E A+  T     ++ S T V IAHRL TI  ++ +IVL  
Sbjct: 588 LKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL-E 646

Query: 687 DGSVIEMGKFKELFSDP 703
           DG+V E G    L + P
Sbjct: 647 DGAVKEEGTHSGLLATP 663

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  187 bits (476), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 252/528 (47%), Gaps = 34/528 (6%)

Query: 196  FLGGFSIALL----AGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHK 249
            +L  +SI +L    A  ++NF         SE  +  LR+  ++    +  +++  + +K
Sbjct: 746  YLVKWSIIVLCVSGADAVSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENK 805

Query: 250  TGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVI 309
            + ++ + L  D   +   ++Q +S     L    VG+    +    LS V   +   +VI
Sbjct: 806  SPEIAALLMNDLRDLRSLVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVI 865

Query: 310  SASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHV 369
             + I+G  ++      +     L  +  E + GVKT++    +    K +++    +  +
Sbjct: 866  FSIIYGTVLKNYETTYKTKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQI 925

Query: 370  GKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL---TIGDLTAFMLYTEYTGNS 426
             ++ A +       T+ +       +  YG  LV+ G     T+      +L+T  T NS
Sbjct: 926  ARKRAIVTGLGIAITTAIATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS 985

Query: 427  IFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGK------GE--------I 472
               L +   +I +G  AAS ++ +   + E   T  +T   G+      GE        +
Sbjct: 986  ---LISQIPDISRGQRAASWIYRI---IEESEDTKEQTITDGRFDEIHCGEKVDKTQPLV 1039

Query: 473  EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
               N+ F+YPT     I+ NL+  +  G  V IVG SG GKST+  LL   Y      I 
Sbjct: 1040 SIHNLEFAYPTALDVNIYDNLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCID 1099

Query: 533  IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592
            IDG D+ + ++++LRR++ +V+Q+PVL  G++R+N+ YGL ++P + +I  + K    ++
Sbjct: 1100 IDGTDVNEWDNETLRRQISVVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYD 1159

Query: 593  FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
            FI   P   +T +  S  L+SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN 
Sbjct: 1160 FIESLPEGLETSVDTS--LISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIIND 1217

Query: 653  TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
               +     S+  +SI H    +R    V VL  DG + E G F +LF
Sbjct: 1218 IVAK--GPPSLLTISITHNEQMMRSCNTVAVL-KDGKICETGPFNKLF 1262

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 119/436 (27%), Positives = 206/436 (47%), Gaps = 31/436 (7%)

Query: 284 VGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
           +GV    S SL L  + G  ++  +I A IF + I+  +      +G    +    +N  
Sbjct: 166 IGVSFYYSWSLTLIILCGTPLL--IILAFIFSRSIQKYAALENTESGLAADLLAWSMNSA 223

Query: 344 KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV------LV 397
           + ++    + +EI+ F E       +     FI    + + + +  L FL++        
Sbjct: 224 QMIKLSCTQLKEIESFEE-----LTLKCNDYFIKLSLYVAAN-ISTLRFLSLAMFVQGFW 277

Query: 398 YGSYLVLHGSLTIGD-LTAF--MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE--LTD 452
           +G+  +  G+L I D +T F   L    T N+  G   F    +Q    A R  +  L D
Sbjct: 278 FGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIF----LQKGQVALRKIQSFLND 333

Query: 453 YVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKG 512
              EI  +  K     K +I F++VSFSYP+RP + +  +++     G    IVG SG G
Sbjct: 334 NKVEIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSG 393

Query: 513 KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG- 571
           KST++ LLL  Y+   G I I    I +++ + L + + +V+Q   L + ++ +NI  G 
Sbjct: 394 KSTLSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGS 453

Query: 572 ----LTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALI 627
                +    ++++++  K     + I    +  DT +G  G  LSGGQ+QR+A+ARA +
Sbjct: 454 QDEDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYM 513

Query: 628 KKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
           +   +LILDEA SALD+     +     +  + ++  I++  H LS I   + + V+  +
Sbjct: 514 RDTEVLILDEAVSALDIVHREQLMSNITKWRQGRTTIILT--HELSQISIQDYLYVV-EE 570

Query: 688 GSVIEMGKFKELFSDP 703
           G +IE G   +L  DP
Sbjct: 571 GRIIESGFQGQLMYDP 586

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  187 bits (474), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 152/551 (27%), Positives = 260/551 (47%), Gaps = 51/551 (9%)

Query: 174  ATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTV 233
            A Q +G  +P  ++ + L +     G +IA     + NF         SE  + +LR+ V
Sbjct: 720  APQFDGVGSPSYLLKWSLIVI----GVAIA---DAILNFLQYFLFGYCSEYWILQLRNQV 772

Query: 234  IKRTIHQDAQFY--DIHKTGDLISR----------LGADAYIVSRSITQKISDGFKSLIC 281
            ++R   ++  ++  + HK  ++ +           L +D  I   S     S G    + 
Sbjct: 773  MQRISFEELDWFQRERHKASEVSALLLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALI 832

Query: 282  GGVGVGMMCSLSLDLSAVLGVLIIP-VVISASIFGKQIRINSRELQDATGQLTRVSEEQL 340
             G  + ++C           + + P +VI ++++G  ++    + + A   L  +  E  
Sbjct: 833  IGWKLSLVC-----------ISMFPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEVA 881

Query: 341  NGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGS 400
             G+KT++    E   ++++     ++  +  R A I      +      +S   +L Y +
Sbjct: 882  TGIKTIRRLQLETNFLRQYKRLESHMRVIASRRA-ITTGLGVAVIEALAMSIQAILFYYA 940

Query: 401  Y-LVLHGSLTIGDL---TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYV-- 454
              LV+ G  T   +      +L+T  T N    L +   +I +G  AA+R+ ++ D    
Sbjct: 941  LKLVIDGQYTTKKMFETLTLLLFTIMTCNI---LISQVPDISRGQRAANRILQMLDEKLE 997

Query: 455  -----PEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPS 509
                  E + T   +       I  +NV+F+YP+ P   IF +L  ++  G    +VG S
Sbjct: 998  REKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQS 1057

Query: 510  GKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT 569
            G GKST+  LL   Y PTSG +L++ +D+ + N + LRR++ +V+Q P + SG++R+N+ 
Sbjct: 1058 GSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLL 1117

Query: 570  YGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629
            YGL + P + E+  V +    H+FI+K P   DT I     LLSGGQ QR+ IARA++K+
Sbjct: 1118 YGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAILKR 1175

Query: 630  PNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGS 689
            P ILILDE TSALD  S   IN    +     +   +SI H +  ++  + +I L N G 
Sbjct: 1176 PKILILDECTSALDPFSSHVINNIVRR--GCPAPLTISITHNVDMMKACDEIIFLKN-GR 1232

Query: 690  VIEMGKFKELF 700
            V   G F  L 
Sbjct: 1233 VAGTGSFDALL 1243

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 133/444 (29%), Positives = 215/444 (48%), Gaps = 38/444 (8%)

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ---DATGQLTRVS 336
           I   +G     S SL L  +      P++I    F       SR++Q   D   + T  +
Sbjct: 147 IIALIGTSFYASWSLTLVTLCSA---PLIIMCGWFF------SRKVQRYADLENEQTSKA 197

Query: 337 EEQLNGVKTVQSFV----AEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSF 392
            + L+   T   F+     E REIK F   ++N       + F+    ++S +L   L F
Sbjct: 198 SQLLDWSMTAAQFIRLSGTELREIKSFKNCVQNC-----TNNFVKMCQYSSINL-ATLKF 251

Query: 393 LTV------LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
           L++        +GS ++  G + IGD+          G++I G       I +G+ A + 
Sbjct: 252 LSLAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNI 311

Query: 447 LFE-LTD---YVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSN 502
           + + L D      +IR      +   KG+I F+NV FSYP+RP + + ++++     G  
Sbjct: 312 VSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKT 371

Query: 503 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG 562
             ++G SG GKS+++ LLL +Y   +G I +DG++I  ++   L + + +V+Q   + +G
Sbjct: 372 TFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNG 431

Query: 563 SIRDNITYGLTYTPTKEEIRKVAKQC---FCHNFITKFPHTYDTQIGPSGTLLSGGQKQR 619
           ++++NI  G+     +E + K+   C      NFI       +T IG  G  LSGGQ+Q+
Sbjct: 432 TLKENIIIGIDGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQK 491

Query: 620 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSE 679
           +AIARAL+K P ILILDE+ SALDV   G I        K K+  I++  H L+ I  S 
Sbjct: 492 VAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQI-GSN 548

Query: 680 NVIVLGNDGSVIEMGKFKELFSDP 703
           +   L   G  IE G  + L +DP
Sbjct: 549 DFCYLIESGQCIEHGLEETLVNDP 572

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  185 bits (469), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 260/534 (48%), Gaps = 39/534 (7%)

Query: 195  EFLGGFSIALLAGCMA----NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIH 248
             +L  +S+ +L    A    NF         SE  V  LR+ V+++   ++  ++  + +
Sbjct: 757  HYLAKWSLLVLGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENN 816

Query: 249  KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL--SLDLSAVLGVLIIP 306
            K  + IS L  +     RS+  +      S +     +G++ +L     LS V   +   
Sbjct: 817  KASE-ISALVLNDLRDLRSLVSEFLSAMTSFVTVST-IGLIWALVSGWKLSLVCISMFPL 874

Query: 307  VVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI 366
            ++I ++I+G  ++    + + +  QL     + +  +KT++   AE      +++    +
Sbjct: 875  IIIFSAIYGGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKM 934

Query: 367  FHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNS 426
              +  + A       + T+++       +  YG  LV+    T  ++        +T  S
Sbjct: 935  QQIASKRAIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMS 994

Query: 427  IFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTL-------------GKTYLPGKGE-- 471
               L +   +I +G  AAS ++ + D   E   TL             G TY  GK +  
Sbjct: 995  CTSLVSQIPDISRGQRAASWIYRILD---EKHNTLEVENNNARTVGIAGHTY-HGKEKKP 1050

Query: 472  -IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQ 530
             +  +N++F+YP+ P   ++KN+NF +  G  + I+G SG GKST+ LLL   YN   G+
Sbjct: 1051 IVSIQNLTFAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGK 1110

Query: 531  ILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
            I IDG D+   N  SLR+++ +V+Q+P+L +G+IRDN+TYGL     + E+    K    
Sbjct: 1111 IKIDGTDVNDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGI 1170

Query: 591  HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
            H+F+   P   DT+I    TLLSGGQ QR+ IARAL++K  ILILDE TSALD  S   I
Sbjct: 1171 HDFVISSPQGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSII 1228

Query: 651  NYTFGQLMKTK--SMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            N    +++K    ++  + I H    +R   ++ VL  DG V+E G F  L+++
Sbjct: 1229 N----EIVKKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNN 1277

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 148/512 (28%), Positives = 238/512 (46%), Gaps = 49/512 (9%)

Query: 223 ERLVARLRSTVIKRTIHQD-AQFYDIHKTGDLISRLGADAYIVSRSITQKISDG------ 275
           ER   R+RS +++  + +   ++YD ++      +L  D   ++R + +  S        
Sbjct: 101 ERQGFRIRSQILEAYLEEKPMEWYDNNE------KLLGDFTQINRCVEELRSSSAEASAI 154

Query: 276 -FKSL--ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQL 332
            F++L  IC  +G     S SL L  +    II     A +F + I + S +    T + 
Sbjct: 155 TFQNLVAICALLGTSFYYSWSLTLIILCSSPIITFF--AVVFSRMIHVYSEKENSETSKA 212

Query: 333 TRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSF 392
            ++    +N  + V+ +  ++ E K+F E I N       + FI + FF + +  G L F
Sbjct: 213 AQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNC-----NTFFIKSCFFVAAN-AGILRF 266

Query: 393 LTV------LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
           LT+        +GS ++  G L I D+          G+++         + +G  A  +
Sbjct: 267 LTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEK 326

Query: 447 LFELTDYVPEIRPTLGKTY---LP---GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPG 500
           +  L     +  P L KT     P      ++ F NVSFSYP+RP   + KN++     G
Sbjct: 327 IMTLLKDGSKRNP-LNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAG 385

Query: 501 SNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLM 560
               IVG SG GKST++ LLL +Y+  +G I I+G +I  ++ K L   + +V+Q   L 
Sbjct: 386 QFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLF 445

Query: 561 SGSIRDNITYGLTYT---------PTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
           + ++R NI  G T +           +  I+   +      FI   P   +T IG  G  
Sbjct: 446 NDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVT 505

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
           LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H 
Sbjct: 506 LSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HE 563

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           LS I  S++ + L  +G V+E G   EL +DP
Sbjct: 564 LSQI-ESDDYLYLMKEGEVVESGTQSELLADP 594

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  181 bits (458), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 198/389 (50%), Gaps = 17/389 (4%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           R+   A  +   V+ + L   + V+ F  E     +++ ++         + +  AF+NA
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 379 -KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEI 437
            + F  TS +  + ++     G   V+ G LT+GDL             +  L + Y E+
Sbjct: 341 GQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 395

Query: 438 MQGAGAASRLFELTDYVPEIRPTLGKTYLP---GKGEIEFKNVSFSYPTRPQNQIFKNLN 494
            Q       LF L +   +I        LP   G  EI+F+NV+F Y TR   +I +N +
Sbjct: 396 KQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNAS 453

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
           F I  G    IVGPSG GKSTI  L+  +Y+P SG++L++G+D+ + +  S R+ +G+V 
Sbjct: 454 FTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVP 513

Query: 555 QEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSG 614
           Q+  L + +I +N+ +G     T +E+    ++      I K P    T +G  G ++SG
Sbjct: 514 QDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISG 572

Query: 615 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLST 674
           G+KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +     S T V +AHRL T
Sbjct: 573 GEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRT 632

Query: 675 IRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           I  ++ ++VL  +G V E G   EL S P
Sbjct: 633 IADADKILVL-EEGCVREEGSHTELLSRP 660

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  179 bits (454), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 173/315 (54%), Gaps = 8/315 (2%)

Query: 391 SFLTVLVY-GSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
           S LT ++Y G   V+ G+LT+GDL             +  L + Y E+ Q       LF+
Sbjct: 365 SALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 424

Query: 450 LTDYVPEIRPTLGKTYLPGK---GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
           L     +I+       LP +    EI+F+NV+F Y    + +I KN +F I  G    +V
Sbjct: 425 LRKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYD--KERKILKNASFTIPAGWKTAVV 482

Query: 507 GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           GPSG GKSTI  L+  +Y+P  G+IL++G DI +++  SLR+ +G+V Q+  L + +I +
Sbjct: 483 GPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWE 542

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           N+ +G     T  EI +  ++      I K P   +T +G  G ++SGG+KQR+AIAR L
Sbjct: 543 NVKFG-RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVL 601

Query: 627 IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
           +K   I+  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL  
Sbjct: 602 LKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-K 660

Query: 687 DGSVIEMGKFKELFS 701
           DG V E G  ++L +
Sbjct: 661 DGQVEEEGTHRQLIA 675

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  178 bits (452), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/428 (29%), Positives = 209/428 (48%), Gaps = 21/428 (4%)

Query: 286 VGMMCS-LSLDLSAVLGVLIIPVVISASIF-----GKQIRINSRELQDATGQLTRVSEEQ 339
           + M+C  L+    A    +    ++  SIF       + R   R+   A  +   V+ + 
Sbjct: 242 ISMVCGILTYQFGASFAAITFSTMLLYSIFTFRTTAWRTRFR-RDANKADNKAASVALDS 300

Query: 340 LNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
           L   + V+ F  E+    +++ ++         V +  AF+N    T  +L+   +   +
Sbjct: 301 LINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLN----TGQNLIFTTALTAM 356

Query: 396 LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVP 455
           +      V+ GSLT+GDL             +  L + Y ++ Q       LF+L     
Sbjct: 357 MYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQV 416

Query: 456 EIRPTLGKTYLPGKG--EIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
            I+ +     LP     +I F+NV+F Y   P+ +I  N++F I  G    IVGPSG GK
Sbjct: 417 TIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSGK 474

Query: 514 STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
           STI  L+  +Y P  G+IL+ G DI  ++  SLR+ +G+V Q+  L + +I +N+ +G  
Sbjct: 475 STILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFG-N 533

Query: 574 YTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNIL 633
            + + +EI +  ++      +   P    T +G  G ++SGG+KQR+AIAR L+K   ++
Sbjct: 534 ISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLM 593

Query: 634 ILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
             DEATSALD  +E A+ +T  Q   + S T V +AHRL TI  ++ +IVL   GSV E 
Sbjct: 594 FFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVREE 652

Query: 694 GKFKELFS 701
           G    L +
Sbjct: 653 GTHSSLLA 660

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  176 bits (446), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 114/338 (33%), Positives = 181/338 (53%), Gaps = 15/338 (4%)

Query: 369 VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIF 428
           V +  AF+N    +  SL+   +   ++  G   V+ G LT+GDL             + 
Sbjct: 363 VAQSLAFLN----SGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLN 418

Query: 429 GLSTFYSEIMQGAGAASRLFELTDYVPEIR-----PTLGKTYLPGKGEIEFKNVSFSYPT 483
            L + Y E+ Q       LF+L     +I+      ++ K+   G  EI+F+NV+F Y  
Sbjct: 419 FLGSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKS--DGPFEIKFENVTFGYD- 475

Query: 484 RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNS 543
             Q +I KN +F I  G    I GPSG GKST+  L+  +Y+P  G++L++G D+ + + 
Sbjct: 476 -GQRKILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDI 534

Query: 544 KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDT 603
             LR+ +G+V Q+  L + +I +N+ +G     + EEI +V  +    + I K P    T
Sbjct: 535 DQLRKAIGVVPQDTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSST 593

Query: 604 QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM 663
            +G  G ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E ++  T  +   +   
Sbjct: 594 IVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEK 653

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           T V IAHRL TI  ++ +IVL  +G+V E G  +EL +
Sbjct: 654 TSVYIAHRLRTIADADKIIVL-EEGTVREEGTHQELLA 690

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  177 bits (449), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 148/529 (27%), Positives = 247/529 (46%), Gaps = 31/529 (5%)

Query: 196  FLGGFSIALLAGCMA----NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHK 249
            +L  +S  +L    A    NF         SE  +  LR+ ++++   ++  ++  + +K
Sbjct: 759  YLAKWSFVVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNK 818

Query: 250  TGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL--SLDLSAVLGVLIIPV 307
              + IS L  +     RS+  +      S I     +G++ +L     LS V   +   +
Sbjct: 819  AAE-ISALVMNDLRDLRSLVSEFLSAMTSFITVST-IGLVWALISGWKLSLVCISMFPLI 876

Query: 308  VISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIF 367
            +I + I+G  ++    + + +  QL     + +  +KT++   AE      +++    + 
Sbjct: 877  IIFSVIYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKME 936

Query: 368  HVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSI 427
             +  + A       + T+++       +  YG  LV+    T   + A      +T  S 
Sbjct: 937  GIASKRAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSC 996

Query: 428  FGLSTFYSEIMQGAGAASRLFELTDYVP---EIRPTLGK-------TYLPGKGE--IEFK 475
              L     +I +G  AAS ++ + D      EI    G+       TY     +  +  +
Sbjct: 997  TTLVGQIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQ 1056

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            N++F+YP+ P   I+K ++  +  G  V IVG SG GKST+ LLL   Y    G I IDG
Sbjct: 1057 NLTFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDG 1116

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             D+   N  SLRR++ +V+Q+P L  GSIRDN+TYG        E+    K    ++F+ 
Sbjct: 1117 TDVNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVA 1176

Query: 596  KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 655
              P + DT+I  +  LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN    
Sbjct: 1177 SLPQSLDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN---- 1230

Query: 656  QLMKTK--SMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
             ++K    ++  + I H    +R   +V+V   DG ++E G F  L++D
Sbjct: 1231 DIVKKGPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 243/508 (47%), Gaps = 43/508 (8%)

Query: 223 ERLVARLRSTVIKRTIHQD-AQFYDIHKT--GDL--ISRLGADAYIVSRSITQKISDGFK 277
           ER   R+RS +++  + +   ++YD ++T  GD   I+R   +   +  S  +  +  F+
Sbjct: 102 ERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDFTQINRCVEE---LRSSSAEASAITFQ 158

Query: 278 SL--ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRV 335
           +L  IC  +G     S SL L  +    II +   A  F + I I +++    TG+  ++
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVA--FCRMIHIYTKKENTETGKAAQL 216

Query: 336 SEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
               +N  + V+ +  +  E K+F E + N       + FI + F+ + +  G L FLT+
Sbjct: 217 LTWSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFYLAAN-AGVLRFLTL 270

Query: 396 ------LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
                   +GS ++  G L I D+          G ++         + +G  A  ++  
Sbjct: 271 TMFVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMT 330

Query: 450 LTDYVPEIRPTLG--KTYLP----GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNV 503
           L +  P+ R T    + Y P      G++ F+NVSF+YP+RP   I +N   K   G   
Sbjct: 331 LLENGPK-RNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFT 389

Query: 504 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
            IVG SG GKSTI+ LLL +Y+   G I I+G++I  +  KSL   + +V+Q   L + +
Sbjct: 390 FIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNT 449

Query: 564 IRDNITYGLTYTPTKEE---------IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSG 614
           +++NI  G T +    +         I++  +       I   P   +T IG  G  LSG
Sbjct: 450 LKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSG 509

Query: 615 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLST 674
           GQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H+LS 
Sbjct: 510 GQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT--HQLSQ 567

Query: 675 IRRSENVIVLGNDGSVIEMGKFKELFSD 702
           I  +++ + L  DG VIE G   EL  D
Sbjct: 568 I-EADDYLYLMQDGKVIESGIQSELLVD 594

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 148/495 (29%), Positives = 237/495 (47%), Gaps = 27/495 (5%)

Query: 222  SERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAYIVSRSITQKISDGFKSL 279
            SE  +  LR+  ++   +++ +++  D +K+ +L + +  D   +   I++ IS     +
Sbjct: 773  SENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAMSTFI 832

Query: 280  ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQ 339
            +    G+    +    LS V   +   +++ ++I+G  ++      +     L     E 
Sbjct: 833  VVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENCVYEI 892

Query: 340  LNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINA-KFFTSTSLVGDLSFLTVLVY 398
            + G+KT++    EQ  I+R++     + H+G++ A         +T+LV  +  + +  Y
Sbjct: 893  MLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAI-LFYY 951

Query: 399  GSYLVLHGSLTIGDLT---AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TD 452
            G  LV  G  T   +      +L+T  T  S+        ++ +G  AASR+F +   +D
Sbjct: 952  GLKLVFIGEYTTMKMFKTFTLLLFTIMTCTSLINQ---IPDVTRGQRAASRIFRILDESD 1008

Query: 453  YVPEIRPTLGKTY-LPGKGEIE----FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVG 507
               E     G+T  +P    I+      N+ F YP+   + +F  LN +I     V +V 
Sbjct: 1009 RFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAVVA 1068

Query: 508  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
             SG GKST+  LL   Y      I IDG DI +    SLR  + IV+Q+P L  GSIR N
Sbjct: 1069 ESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIRKN 1128

Query: 568  ITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALI 627
            + YG        +I  V KQ    +F+T  P+  DT +  S  LLSGGQ QRI IARAL+
Sbjct: 1129 LIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDTS--LLSGGQAQRICIARALL 1186

Query: 628  KKPNILILDEATSALDVESEGAINYTFGQLMKTK--SMTIVSIAHRLSTIRRSENVIVLG 685
            +K  ILILDE TSALD ES     +    L+K+    +  ++I H    +R   NVIVL 
Sbjct: 1187 RKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIVL- 1241

Query: 686  NDGSVIEMGKFKELF 700
             DG   + G F EL+
Sbjct: 1242 QDGETAQQGTFDELY 1256

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 115/421 (27%), Positives = 212/421 (50%), Gaps = 45/421 (10%)

Query: 307 VVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI 366
           +++ A+ F + I   ++   D TG   +     +N  + V+ +  +  EIK+F E +   
Sbjct: 183 LIVLAAFFSRMIENFTKLENDETGIAAQSLTWSMNAAQLVKLYCTQDFEIKKFKEIV--- 239

Query: 367 FHVGKRSAFINAKFFTS--TSLVGDLS---FLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 421
             +     FINA F+ S  TS++  LS   F+    +GS ++    +++  +      T 
Sbjct: 240 --IRCNDYFINAWFYVSANTSILRFLSLAMFVQGFWFGSTMIKKNKMSVDQVI-----TC 292

Query: 422 YTGNSIFG--LSTFYSEIMQGAGAASRLFELTDYVPEI---------RPTLGKTYLPGKG 470
           ++   + G  L+T   +I+    A   L  + D++ +          + ++    +P   
Sbjct: 293 FSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDFLEDKSEMATDRDRQTSINLDNVPIS- 351

Query: 471 EIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQ 530
            I F  +SF YP+RP + + KN++   +P     IVG SG GKST++ LLL +YN  +G 
Sbjct: 352 -ISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVGKSGSGKSTMSNLLLKFYNGYNGC 410

Query: 531 ILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEI----RKVAK 586
           I ++G ++  ++   + + + +V+Q+  L + ++R+N+  GL++    E++    ++  +
Sbjct: 411 IKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNNLLIGLSHISAAEDVDSRLQEACR 470

Query: 587 QCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
                N I K P   DT++G  G  LSGGQ+QR+A+ARA ++   ++ILDEA SALD  +
Sbjct: 471 FALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALARAYLRDTPVVILDEAISALDARN 530

Query: 647 EGAINYTFGQLMK-----TKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
                    QLM+     T+S T + + H L+ I  S+ + ++ N G + E G   EL  
Sbjct: 531 R-------RQLMENIRIWTRSKTAIILTHELNQILPSDFLYLMEN-GQIKEEGYQNELIE 582

Query: 702 D 702
           +
Sbjct: 583 N 583

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  173 bits (439), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 122/385 (31%), Positives = 193/385 (50%), Gaps = 15/385 (3%)

Query: 323 RELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI----FHVGKRSAFINA 378
           RE   A  +   V+ + L   + V++F  E+   +++  ++         V +  AF+N 
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLN- 338

Query: 379 KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
              +  +L+   +   ++  G   ++ GSLT+GDL             +  L + Y E+ 
Sbjct: 339 ---SGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 395

Query: 439 QGAGAASRLFELTDYVPEIRPTLGKTYLP---GKGEIEFKNVSFSYPTRPQNQIFKNLNF 495
           Q       LF L +    I        LP   G  +I F+NV+F Y   P+ +I +N +F
Sbjct: 396 QSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASF 453

Query: 496 KIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQ 555
            I  G    +VGPSG GKST+  L+  +Y+P  G+IL++G DI + +  SLRR +G+V Q
Sbjct: 454 VIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQ 513

Query: 556 EPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGG 615
           +  L + +I +N+ +G      +E  R + K       + + P   +T +G  G ++SGG
Sbjct: 514 DTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGLMISGG 572

Query: 616 QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI 675
           +KQR+AIAR L+K  +I+  DEATSALD  +E A+  T        S T V IAHRL TI
Sbjct: 573 EKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTI 632

Query: 676 RRSENVIVLGNDGSVIEMGKFKELF 700
             ++ +IVL  +G   E G   EL 
Sbjct: 633 ADADKIIVL-EEGRPREEGTHHELL 656

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  175 bits (443), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 237/492 (48%), Gaps = 23/492 (4%)

Query: 222  SERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAYIVSRSITQKISDGFKSL 279
            SE  +  LR   I++   QD  ++  D++K+ ++ + +  D   +   +++ +S     +
Sbjct: 818  SEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVSEFLSSISTLI 877

Query: 280  ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQ 339
            I   VG+         LS V   L    ++ +  +G  ++    + +    +L     E 
Sbjct: 878  IVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHEI 937

Query: 340  LNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVY- 398
              G+ T++    E + ++++    + +    K+ A I   F  + S    L+   +L Y 
Sbjct: 938  FRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRA-ITIGFGVAASNTLTLAVQAILFYY 996

Query: 399  GSYLVLHGSLT---IGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD--- 452
            G  LV  GS +   + +    +L+T  T  S+ G      +I +G  AA+ +F + D   
Sbjct: 997  GIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQS 1053

Query: 453  -YVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGK 511
                + +  +          I  KN+SFSYP+ P   I+K L   +  G  + +VG SG 
Sbjct: 1054 PAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVGESGS 1113

Query: 512  GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
            GKST+ LL+   Y   +G I IDG DI + ++  LR  + +V+Q+P    G++ +N+ YG
Sbjct: 1114 GKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGENLLYG 1173

Query: 572  LTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPN 631
            ++   T+ ++++        +F+   P   DT+I  S  L+SGGQ QR++IARA+++KP 
Sbjct: 1174 ISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDTS--LISGGQAQRLSIARAMLRKPK 1231

Query: 632  ILILDEATSALDVESEGAINYTFGQLMKTK--SMTIVSIAHRLSTIRRSENVIVLGNDGS 689
            IL LDE TSALD  +  AI      L+K     +T + I H    +R  E + VL N G 
Sbjct: 1232 ILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVLQN-GK 1286

Query: 690  VIEMGKFKELFS 701
            V E G F +L++
Sbjct: 1287 VAEDGSFDDLYA 1298

 Score =  139 bits (350), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 123/424 (29%), Positives = 192/424 (45%), Gaps = 31/424 (7%)

Query: 291 SLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFV 350
           S SL L  + GV II  ++ + I  K I   +R     + +  ++     +  + ++ F 
Sbjct: 177 SWSLTLVIMAGVPII--IVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFC 234

Query: 351 AEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVY------GSYLVL 404
            +Q EI++F  +++          FI    F+S S    L F T+ ++      G+ ++ 
Sbjct: 235 TQQFEIEKFELSVKKC-----TKYFIRISLFSSAS-YAMLRFFTLCMFIQGFWFGNKMIR 288

Query: 405 HGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT-------DYVPEI 457
            G LT GD+          GN++         + +G  A  ++   T       D+  EI
Sbjct: 289 QGVLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEI 348

Query: 458 RPT------LGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGK 511
                    +        GEI FKNVSFSYPTRP   + KN++          IVG SG 
Sbjct: 349 ISDAFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGS 408

Query: 512 GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
           GKSTI  LLL  Y   +G I +DG DI  + +  L   + +V+Q   L + +I++NI  G
Sbjct: 409 GKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLG 468

Query: 572 LTYTPTKEE-IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKP 630
                  +  +R+  +       I   P+  DT +G  G  LSGGQKQR+A+ARA ++  
Sbjct: 469 CKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDS 528

Query: 631 NILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
            ILILDEA S +D+     +     +    K MT V + H L+ I   E+ +    +G +
Sbjct: 529 PILILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQI 585

Query: 691 IEMG 694
            E G
Sbjct: 586 RESG 589

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 247/528 (46%), Gaps = 43/528 (8%)

Query: 202 IALLAGCM-ANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGAD 260
           +AL A C+   +          ER    +R  ++   + +  ++YD H       +L  D
Sbjct: 80  MALAAACLPVMWISISSWMSLGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGD 133

Query: 261 AYIVSRSITQ-KISDGFKSLICGGVGVGMMCSL--SLDLSAVLGVLII---PVVISASIF 314
              V+R + + + S    S I     V M+  +  S   S  L ++I+   P++I  +I 
Sbjct: 134 FTQVNRCVEELRSSSAEASAITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAIL 193

Query: 315 GKQIRINSRELQDA-TGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGK-R 372
              +     EL+++ TG+  ++    +N  + V+ +  +  EI  F E       VG+  
Sbjct: 194 FSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQAYEIHSFKEL------VGQCN 247

Query: 373 SAFINAKFFTS--TSLVGDLS---FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSI 427
             FI + F+ S  TS++  LS   F+    +G+ +V  G L+I D+          G+++
Sbjct: 248 DLFIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTL 307

Query: 428 FGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPG----KGEIEFKNVSFSYPT 483
                    + +G  A  ++ +   +  +  P+L   Y P      GEI F+N+SF+YPT
Sbjct: 308 NNTLQQIVVLQKGDVALKKILDFISF-SQRSPSLEPPYEPSVPISNGEISFQNISFAYPT 366

Query: 484 RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNS 543
           RP   + K+++   +PG +  I+G SG GKST+A LLL +YN   G I I   ++ K+N 
Sbjct: 367 RPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINK 426

Query: 544 KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEE---------IRKVAKQCFCHNFI 594
             L   + +V+Q   L + ++R+N+  G++ +  K E         ++   +       I
Sbjct: 427 NWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELI 486

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 654
            + P   DT IG  G  LSGGQ+QR+AIARA IK  ++LILDEA SALD+     I    
Sbjct: 487 RELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAI 546

Query: 655 GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
                 K+  I++  H LS +   + + V   DG V E G  + L  D
Sbjct: 547 KNWRSGKTTIILT--HDLSQLDYDDFLYVF-EDGEVKESGYQQALLQD 591

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/430 (28%), Positives = 202/430 (46%), Gaps = 18/430 (4%)

Query: 286  VGMMCSL--SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
            VG++ +L     LS V   +   +++ + I+G  ++      + A  +L     E +  +
Sbjct: 857  VGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKI 916

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
            KT++   A +  IK +     N+  +  + +       + T+ +       +  YG  LV
Sbjct: 917  KTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIAVCIQSILYYYGLRLV 976

Query: 404  LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTL-- 461
              G  +   +        +T  S   L +   +I +G  AAS L+ + D   + + ++  
Sbjct: 977  FKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDS 1036

Query: 462  ----GKTYLPGKGE----IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSN-VCIVGPSGKG 512
                    + G       I  KN+ FSYP+    +I+KN+   +      + IVG SG G
Sbjct: 1037 GSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSG 1096

Query: 513  KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL 572
            KST+  LL   Y   +  I IDG D+ + ++  LR+++ +V+Q P L  G++RDN+ YG 
Sbjct: 1097 KSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGT 1156

Query: 573  TYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNI 632
                ++ EI  V K    + FI   P   D++I     L+SGGQ QR+ IARAL++KP I
Sbjct: 1157 LNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTI 1214

Query: 633  LILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
            LILDE TSALD  S   IN      + T  +TIV I H    +    ++ V+  DG + E
Sbjct: 1215 LILDECTSALDAASAHLINNLVKNGLPT-VLTIV-ITHSKQMMEACNSLAVI-KDGRLAE 1271

Query: 693  MGKFKELFSD 702
             G F EL  +
Sbjct: 1272 QGNFAELMKN 1281

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  174 bits (440), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 204/405 (50%), Gaps = 20/405 (4%)

Query: 307  VVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI 366
            +VI + I+G  ++    E ++   +L  V  E + G+KT++    E     +FN   +  
Sbjct: 863  LVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTA 922

Query: 367  FHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSY-LVLHGSLTIGDLT---AFMLYTEY 422
              +G+R A +   F  + S    +S   +L Y +  LV+HG  T   +      +L+T  
Sbjct: 923  KLMGQRRAIVTG-FGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFTIM 981

Query: 423  TGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIR--PTLGKTYLPGKGE-----IEFK 475
            T N+   L     +I +G  AAS+++ + + + E     T G   +P         I F 
Sbjct: 982  TCNN---LVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFN 1038

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            ++SF+YPT P  +I K+L+ +I  G  + IVG SG GKST+  ++   Y   S  + +D 
Sbjct: 1039 DLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDN 1098

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             D+       LR ++ +V+Q+P L  G+IR+N+ YG        ++  + K    ++F  
Sbjct: 1099 TDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFA 1158

Query: 596  KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 655
              P   +T+I  SG LLSGGQ QR+ IARAL+++P ILILDE TSALD  S   IN    
Sbjct: 1159 TLPEGLETKI-DSG-LLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINEIIR 1216

Query: 656  QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
            +     +M  +SI H    +R    V VL + G ++EMG  ++L 
Sbjct: 1217 E--GPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL 1258

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 148/526 (28%), Positives = 243/526 (46%), Gaps = 44/526 (8%)

Query: 197 LGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKT--GDLI 254
           LG  SI ++  C++++          ER   R+R+ +I   + +  ++YD + T  GDL 
Sbjct: 71  LGAGSIVIIWICISSW------MLLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDLT 124

Query: 255 SRLGADAYIVSRSITQKISDGFKSL--ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISAS 312
                   + S S  +  +  +K+L  I          S SL L  + G  +I  V+ A 
Sbjct: 125 QTNRCVEELRSSS-AEASALTWKNLVTILALTVTSFYYSWSLTLVTMCGAPVI--VLCAI 181

Query: 313 IFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKR 372
            F + I I S +    T   +++    +   + V+    +  E++ F  A++        
Sbjct: 182 FFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKC-----S 236

Query: 373 SAFINAKFFTSTSLVGDLSFLTVLVY------GSYLVLHGSLTIGDLTAFMLYTEYTGNS 426
             F+    + S +    L FLT+ ++      GS ++    L I D+          G +
Sbjct: 237 KNFMKMCLYASAN-TAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGAT 295

Query: 427 IFGLSTFYSEIMQGAGAA-----SRLFELTDYVPEIRPTLGKTYLPG--KGEIEFKNVSF 479
           I G  T +  ++   G       +   +  +Y+ E      + YL G    +IE +NV F
Sbjct: 296 ING--TLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIELRNVQF 353

Query: 480 SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
           +YP+RP     KN++  +  G    +VG SG GKS++  LLL  Y+  +G I IDG DI 
Sbjct: 354 NYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIK 413

Query: 540 KMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH-----NFI 594
            ++ KS+ + + +V+Q   L + ++R+NI +G     T E +R  + +  C      NFI
Sbjct: 414 GIDQKSILKNITLVEQRCTLFNDTLRNNILFG--SKETDELVRDESLKAACRISLLDNFI 471

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF 654
              P   DT IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +    
Sbjct: 472 YDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLLMNAI 531

Query: 655 GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
                 K+  I++  H LS I   +++I L  DG V+E G+ + L 
Sbjct: 532 RNWRSEKTTIILT--HDLSEI-GPDDMIYLLEDGEVVEQGQQRNLL 574

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  173 bits (438), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 142/513 (27%), Positives = 245/513 (47%), Gaps = 35/513 (6%)

Query: 211  NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAYIVSRSI 268
            NF         SE  +  LR+ ++ +   ++  ++  + +K  ++ + +  D   + RS+
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDL-RSL 836

Query: 269  TQKISDGFKSLICGGVGVGMMCSL--SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ 326
              +      S +     +G++ +L     LS V   +   +VI ++I+G  ++    + +
Sbjct: 837  VSEFLSAMTSFVTVST-IGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYK 895

Query: 327  DATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL 386
             +  QL     + +  +KT++   AE      +++  + +  +  + A       + T++
Sbjct: 896  TSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNM 955

Query: 387  VGDLSFLTVLVYGSYLVL---HGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGA 443
            +       +  YG  LVL   + S  + +    +L+T  +  S+ G      +I +G  A
Sbjct: 956  IAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQRA 1012

Query: 444  ASRLFELTDYVPEIRPTL-------------GKTYLPGKGE--IEFKNVSFSYPTRPQNQ 488
            AS ++ + D   E   TL             G  Y   +    I  +N+SF+YP+ P   
Sbjct: 1013 ASWIYRILD---EEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNLSFAYPSAPNVP 1069

Query: 489  IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548
            IFK+++  +     + IVG SG GKST+ALLL   YN  +  I+IDG D+   N  SLR+
Sbjct: 1070 IFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRK 1129

Query: 549  KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608
            ++ +V+Q+P    GSIRDN+TYG      + EI  V K    ++F+   P   DT++  +
Sbjct: 1130 QISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN 1189

Query: 609  GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668
              LLSGGQ QR+ IARAL++K  ILILDE TSALD  S   IN    +      +  + I
Sbjct: 1190 --LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLTLVI 1245

Query: 669  AHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             H    +R   ++ VL + G V+E G F  L++
Sbjct: 1246 THSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYN 1277

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 125/444 (28%), Positives = 207/444 (46%), Gaps = 33/444 (7%)

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLIIPVV-ISASIFGKQIRINSRELQDATGQLTRVSEE 338
           IC  +G     S SL L  +      PV+ I A IF + I   +++    T    ++   
Sbjct: 163 ICALIGTSFYYSWSLTLIILCSS---PVITIFAVIFSRLIHTYTQKENTETSNAAQLFTW 219

Query: 339 QLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV--- 395
            +N  + V+ +  +  E ++F E I     +   + FI +  + + +  G L FLT+   
Sbjct: 220 SMNAAQLVRLYCTQPLERQKFQEII-----LSCNTFFIKSCLYVAAN-AGILRFLTLTMF 273

Query: 396 ---LVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD 452
                +GS ++  G L I D+          G+++         + +G  A  ++  L +
Sbjct: 274 VQGFWFGSTMIRKGKLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLE 333

Query: 453 YVPEIRPTLGKTYLP-----GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVG 507
              +   +  + +L         ++ F+NVSF+YP+RP   + +N+N K   G    IVG
Sbjct: 334 SGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVG 393

Query: 508 PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
            SG GKSTI+ LLL++Y+   G ILI+G++   +  K L   + +V+Q   L + +++ N
Sbjct: 394 KSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKN 453

Query: 568 ITYGLTYTPTKEE---------IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQ 618
           I  G T +    +         I+   +       I   P   +T IG  G  LSGGQ+Q
Sbjct: 454 ILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQ 513

Query: 619 RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRS 678
           R+AIARA I+   IL LDEA SALD+     +        K K+  I++  H LS I   
Sbjct: 514 RVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--HELSQIESD 571

Query: 679 ENVIVLGNDGSVIEMGKFKELFSD 702
           +++ V+  +G V+E G   EL +D
Sbjct: 572 DHLYVM-QEGRVVESGIQSELLAD 594

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 147/541 (27%), Positives = 256/541 (47%), Gaps = 37/541 (6%)

Query: 176  QSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIK 235
            +++G  +PP +M + L +        +++  GC   F         SE  +  LR   + 
Sbjct: 779  KNDGTGSPPYLMKWSLVV------ICVSVTDGCFT-FLKKFILSVCSELWIMSLRIKAMD 831

Query: 236  RTIHQDAQFY--DIHKTGDLISRLGADA----YIVSRSITQKISDGFKSLICGGVGVGMM 289
            R  +QD  ++  DI+K  ++ + +  D     Y+VS  ++   +  F S I  G+    +
Sbjct: 832  RISNQDVHWFSLDINKPSEISALILNDLRDLRYLVSGFLSAVTTLIFVSAI--GLAWAFV 889

Query: 290  CSLSLDLSAVLGVLIIPVVISAS-IFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQS 348
                L L   + +  IP+ I  + I+G  ++    + + A  +L     E + G+KTV+ 
Sbjct: 890  SGWKLSL---VCISTIPLFIGVTGIYGGVLQKYETDYKTAVAELENNMFEFVKGIKTVRC 946

Query: 349  FVAEQREIKRFNEAIRNIFHVGKRSAFINA-KFFTSTSLVGDLSFLTVLVYGSYLVLHGS 407
               E     ++      + H  +R A +       S +LV  +  + +  YG  LV+ G 
Sbjct: 947  LQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNALVIGVQAI-LYYYGIKLVVDGE 1005

Query: 408  LTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL----TDYVP-----EIR 458
             T  +L        +T  +   L        +G  AA+ +F +    +D++         
Sbjct: 1006 YTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGRRAATYVFRILNTRSDFLSIDDDFRTE 1065

Query: 459  PTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIAL 518
            P    +++     I  ++++F+YP+    +++K L+  I  G N+ IVG SG GKST+ L
Sbjct: 1066 PIEKPSHM--NPLIRIQDLTFAYPSALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGL 1123

Query: 519  LLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK 578
            +L   Y      + ID  DI K N  SLR+ + +V+Q+     GSIRDN+ YGL    T 
Sbjct: 1124 ILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTD 1183

Query: 579  EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
             +I +V       +F+ + P   +T+I  +  L+SGGQ QRI+I RAL+++P +LILDE 
Sbjct: 1184 SQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQRISIGRALLRQPKLLILDEC 1241

Query: 639  TSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
            TS+LD ++  AI    G  +    +T + I H  + + +S N I+   +G + E G F+E
Sbjct: 1242 TSSLDAKNAQAIASLVGSSL--YGITTIVITHN-TQMMKSCNRILFFKNGRISEEGTFQE 1298

Query: 699  L 699
            L
Sbjct: 1299 L 1299

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 124/504 (24%), Positives = 221/504 (43%), Gaps = 37/504 (7%)

Query: 223 ERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKS---L 279
           ER   R+R  ++   + +   +YD ++       L  D   + R + +  S   +S    
Sbjct: 104 ERQGFRVRRRLLGAYLSKTMAWYDTNEN------LEGDFTQIHRGVEELRSSAAESSAVT 157

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLII---PVVISASIFGKQIRINSRELQDA-TGQLTRV 335
               V V  + + SL  S  L ++I+   P++I+ +I   ++     EL++  T     +
Sbjct: 158 FLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEKYTELENTETSHAASI 217

Query: 336 SEEQLNGVKTVQSFVAEQREIKRFNEAIRNI--FHVG-KRSAFINAKFFTSTSLVGDLSF 392
               +   + ++ F  EQ E+++F+ +++    F +   + A  N       SL+    F
Sbjct: 218 LTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQASLRGLSLI---MF 274

Query: 393 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD 452
           +    +G+ ++  G L  G +          G ++         + +G  A  ++  + +
Sbjct: 275 VQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVE 334

Query: 453 YVPE-IRPTLGKTY----LPGKG---------EIEFKNVSFSYPTRPQNQIFKNLNFKIE 498
              + +R   G+T+     P  G         +I F+NVSFSYP+RP      N++    
Sbjct: 335 SESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFY 394

Query: 499 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
           P     IVG SG GKST++ LLL  Y+   G I +   DI       L   + +V+Q   
Sbjct: 395 PEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCT 454

Query: 559 LMSGSIRDNITYGLTYTPTKE-EIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQK 617
           L + S+ +N+          E  I++  +       +   P    T IG +G  LSGGQ+
Sbjct: 455 LFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQ 514

Query: 618 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
           QR+A+ARA+++   +LILDE+ SALD+     +          K+  I++  H LS I  
Sbjct: 515 QRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRNWRAGKTTIILT--HELSHI-L 571

Query: 678 SENVIVLGNDGSVIEMGKFKELFS 701
            ++ + L  DG V E G  ++L S
Sbjct: 572 DDDYLYLMEDGKVGEHGYKRDLLS 595

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  166 bits (421), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 127/489 (25%), Positives = 234/489 (47%), Gaps = 16/489 (3%)

Query: 222  SERLVARLRSTVIKRTIHQDAQFYDI--HKTGDLISRLGADAYIVSRSITQKISDGFKSL 279
            SE  +  LR  V++   +   +++ +  +K  ++ +    D   +   +T+ ++     L
Sbjct: 778  SEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTEFLATASTFL 837

Query: 280  ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQ 339
            +    G+         LS V   +   +++ + ++G  ++    + + A  QL     E 
Sbjct: 838  VVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVAQLENCLYEV 897

Query: 340  LNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG 399
            +  +KT++    +     R++   + +  +G+R + I       T  +       +  YG
Sbjct: 898  VVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLCIQAILYYYG 957

Query: 400  SYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRP 459
              LV+ G  T   +        +T  +   L     E+ +G  AA+ ++ +       R 
Sbjct: 958  IKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRILKEAAATRE 1017

Query: 460  --TLGKTYLPGKGEIE------FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGK 511
               +    LP     E       K+++F+YP  P   ++++LN  ++  ++V +VG SG 
Sbjct: 1018 HQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLKSDTSVALVGESGS 1077

Query: 512  GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
            GKSTI  LL   Y+     I +DG D+++ ++ SLR ++ +V+Q   L++G+IR+N+TYG
Sbjct: 1078 GKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSANLLNGTIRENLTYG 1137

Query: 572  LTYTPTKE-EIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKP 630
            L    T E ++  + K    ++F+++ P+  DT +     LLSGGQ QR+ IARAL+K  
Sbjct: 1138 LPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQAQRLCIARALVKPH 1195

Query: 631  NILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
             ILILDE TSALD  S   I     +     +  I++I H    +R  E+V++L N G++
Sbjct: 1196 RILILDECTSALDALSTNIIIDIVRK--GIPNTLIIAITHDEHMMRSCESVLLLKN-GAI 1252

Query: 691  IEMGKFKEL 699
            +E G F EL
Sbjct: 1253 VEQGSFVEL 1261

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 108/388 (27%), Positives = 180/388 (46%), Gaps = 57/388 (14%)

Query: 346 VQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTS--TSLVGDLS---FLTVLVYGS 400
           V+ + A+  EI +F+ ++         S FI A  +++  +S++  L+   F+    +G+
Sbjct: 215 VKFYTAQNEEISKFDTSVTRC-----NSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGA 269

Query: 401 YLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT--------- 451
            ++    L I D+                ++ F+S +M GA  +  + ++T         
Sbjct: 270 TMIRRNKLDINDV----------------ITCFHSCLMLGATVSEAMSQVTVIQKGHVAN 313

Query: 452 DYVPEIRPTLGKTYL------PGKGE---IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSN 502
             +       GKT +      P KG    I F N+SF YP R  N   +N++ ++E G  
Sbjct: 314 KKLEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKM 373

Query: 503 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG 562
             I+G SG GKST+A LLL +Y   SG I +D   I  +N + L   + +V+Q   L + 
Sbjct: 374 TFIIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFND 433

Query: 563 SIRDNITYG-------LTYTPTKEEIRKVAKQC---FCHNFITKFPHTYDTQIGPSGTLL 612
           ++R+NI  G             +E  RK+ K C     +  +       DT IG  G  L
Sbjct: 434 TLRNNILLGSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVEL 493

Query: 613 SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRL 672
           SGGQ+QR+A+ARA ++   I+I DE+ SALDV     +        + K  T + + H L
Sbjct: 494 SGGQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAIRSWRQGK--TTIVLTHEL 551

Query: 673 STIRRSENVIVLGNDGSVIEMGKFKELF 700
           S I  ++ + ++ + G V E G  ++L 
Sbjct: 552 SQINPTDFIYIMEH-GRVCEYGYQEDLL 578

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 138/502 (27%), Positives = 241/502 (48%), Gaps = 22/502 (4%)

Query: 211  NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQ 270
            NF         SE+ V +LR  +++  + +D  +   +K+ + I+ L  +     R++T 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSE-ITALTMNDLRDLRNVTS 836

Query: 271  KISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL-IIPVVISA-SIFGKQIRINSRELQDA 328
             +     + +C    VG++ ++ +     L  L ++P+ I   +++G  ++ +  + + A
Sbjct: 837  ILLSS-LTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTA 895

Query: 329  TGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVG 388
              QL  +  E + GVKT++    E     R+    + +    +R + +       TS + 
Sbjct: 896  VSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLV 955

Query: 389  DLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 448
             L    +  YG  LV+ G      L        +T  S  GL +      +G  A + +F
Sbjct: 956  ILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVF 1015

Query: 449  --------ELTDYVPEIR--PTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIE 498
                    E  +Y   +R  PT    +   +  +  + ++F+YP     QI+KN N +I 
Sbjct: 1016 GMLEEPLPEPDNYSAVLRKAPT---NHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRIN 1072

Query: 499  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
             G+ V IVG SG GKST+  L+   Y      + IDG DI      +LR+ + +V+Q+P 
Sbjct: 1073 QGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPR 1132

Query: 559  LMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQ 618
              +G+IR+N+ YGL  T T  EI +V  +    NF+   P   +T++  +  L+SGGQ Q
Sbjct: 1133 FFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQ 1190

Query: 619  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRS 678
            R++I RAL+++P +LILDE TSALD  +  AI       +    +T++ I H    ++  
Sbjct: 1191 RLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMC 1248

Query: 679  ENVIVLGNDGSVIEMGKFKELF 700
            + ++VL N G+V E G F +LF
Sbjct: 1249 DRIVVLKN-GAVAEDGSFDDLF 1269

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 101/376 (26%), Positives = 173/376 (46%), Gaps = 17/376 (4%)

Query: 340 LNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG 399
           LN    V+ F  +  E+++FN+A+        R+   ++    +   +  + F+    YG
Sbjct: 218 LNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMFVQAFWYG 277

Query: 400 SYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRP 459
           S L+    +    +      +    +SI  + +    + +G  A  ++ E  +  PE RP
Sbjct: 278 SILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEPEGRP 337

Query: 460 T-LGKTYLPGK--------GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSG 510
                 Y  G          EI F  VSF+YP RP  +    ++    P     IVG SG
Sbjct: 338 NQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIVGKSG 397

Query: 511 KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570
            GKST+  LLL +Y+   G I ++  ++  ++   L + + +V+Q   L +G++ +NIT 
Sbjct: 398 SGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFENIT- 456

Query: 571 GLTYTPTKEEIRKVAKQC---FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALI 627
            L+  P  +    V + C        +   P    T++G  G  +SGGQ+QR+A+ARA++
Sbjct: 457 -LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARAIL 515

Query: 628 KKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
           +   +LILDEA SALD+     +          K+  I++  H LS +   ++ + +   
Sbjct: 516 RDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHV-LDDDYLYMMEH 572

Query: 688 GSVIEMGKFKELFSDP 703
           G VIE G   EL S+P
Sbjct: 573 GQVIEQGYKSELLSNP 588

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 132/501 (26%), Positives = 237/501 (47%), Gaps = 15/501 (2%)

Query: 209  MANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAYIVSR 266
            ++NF         SE  +  LR   +K  + +  Q++  + ++T ++ + +  D   +  
Sbjct: 784  ISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDLRS 843

Query: 267  SITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ 326
             +++ +S     ++    G+         L+ V   +   ++I ++I+G  ++ +  + +
Sbjct: 844  LVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYK 903

Query: 327  DATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL 386
             +   L  +  + ++ +KT++S   E      +  A   + +V  + +       + T+ 
Sbjct: 904  SSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNT 963

Query: 387  VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
            +       +  YG  L++ G  T+  +        +T  +   L     ++ +G  AAS 
Sbjct: 964  ITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASW 1023

Query: 447  LFEL---TDYVPEIRP-----TLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIE 498
            ++ +   +D   E+           T       ++ KN++F+Y + P  ++   L  K+ 
Sbjct: 1024 VYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLF 1083

Query: 499  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
            PG  + I G SG GK+T+  LL+ +Y+    QI  +G+DI     +SLR  + IV+Q+P 
Sbjct: 1084 PGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPS 1143

Query: 559  LMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQ 618
            ++SGSIRDN+        +  E+  V K     +FI   P   DT I    TLLSGGQ Q
Sbjct: 1144 VLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQ 1201

Query: 619  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRS 678
            RI IARAL++KP ILILDE TSALD  S   IN    +  +   +TI+SI H  S +   
Sbjct: 1202 RICIARALLRKPKILILDECTSALDAMSADIINNLVSK--ELNGVTIISITHSESMMTSC 1259

Query: 679  ENVIVLGNDGSVIEMGKFKEL 699
            +NV VL N G ++E+G +  L
Sbjct: 1260 QNVAVLKN-GKIVEVGTYDSL 1279

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/330 (33%), Positives = 172/330 (52%), Gaps = 26/330 (7%)

Query: 390 LSFLTVLVYGSYLVLHGSLTIGD-LTAF---MLYTEYTGNSIFGLSTFYSEIMQGAGAAS 445
           L F+    +GS ++  G L I + +T F   +L      N++  +      ++Q    A 
Sbjct: 276 LMFVQGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIV-----VLQKGEVA- 329

Query: 446 RLFELTDYVPEIRPTLGKTYLPG---KGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSN 502
            L ++ D++ E    L     P       I F+N+SF+YP+RP   I   +N   +  + 
Sbjct: 330 -LQKIVDFLDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSAT 388

Query: 503 VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG 562
             IVG SG GKST++ LLL +Y    G ILID  +I  +N K+L   + IV+Q+  L + 
Sbjct: 389 TFIVGKSGSGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFND 448

Query: 563 SIRDNITYGLT-----YTPTK----EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLS 613
           +IR+NI +G++     Y   +    E ++         +F+   P+  DT IG  G  LS
Sbjct: 449 TIRNNILFGVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLS 508

Query: 614 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLS 673
           GGQ+QR+A+ARA ++ P ILILDEA SALDV     +     +L ++   TI+ + H L+
Sbjct: 509 GGQQQRVALARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLT 566

Query: 674 TIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            I   + + V+ + G +IE GK KEL +DP
Sbjct: 567 QIDNDDFLYVIKH-GRIIEHGKRKELITDP 595

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 132/431 (30%), Positives = 211/431 (48%), Gaps = 22/431 (5%)

Query: 284  VGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
            +G+    ++   LS V   +I  VV+   ++G  +       + +   L  +  E + G+
Sbjct: 797  IGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGM 856

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
            KT+QS   +Q   K+FN  I+ +   G   A         T+++  L    +  YG  LV
Sbjct: 857  KTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLV 916

Query: 404  LHGSLTIGDL---TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT--DYVPEIR 458
            L G  T   L    A +L+T  T   +  L T   +I +G  + S + ++   D    I 
Sbjct: 917  LTGEYTHSKLFETIALLLFTIVT---VASLVTQLPDITRGQRSISWIDQILKGDNQQTIE 973

Query: 459  P-----TLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
            P     T    + P +  IE  N+SF+Y      +   N+N ++       IVG SG GK
Sbjct: 974  PPSNLSTTKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGK 1033

Query: 514  STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
            ST+  L+   Y+ + G I I   DI K ++K L + + ++QQ PVL   +IR+N+ YGLT
Sbjct: 1034 STLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLT 1093

Query: 574  YTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNIL 633
             T   E +  V +     +FI    +  D+++  S  LLSGGQ QR+ +AR +++ P +L
Sbjct: 1094 ETVGDEHLLNVLEYVGLKSFIISLNNGLDSKLDDS--LLSGGQSQRLCMAREMLRNPKVL 1151

Query: 634  ILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI--AHRLSTIRRSENVIVLGNDGSVI 691
            ILDE TSALDV S   IN   G    ++S+  V+I  +H+  TI+  + +  L  DG+V 
Sbjct: 1152 ILDECTSALDVTSAKKINDIIG----SRSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVA 1206

Query: 692  EMGKFKELFSD 702
             MG ++EL  +
Sbjct: 1207 MMGTYEELMEN 1217

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 189/389 (48%), Gaps = 25/389 (6%)

Query: 307 VVISASIFGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIR- 364
           ++I A IF K I +   +E  ++     R++   L  ++ V+    +  EI  +   I  
Sbjct: 186 IIICAVIFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHYIAQ 244

Query: 365 -NIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD-LTAF--MLYT 420
            N +++ K S FI+A       L   + F+    +GS ++  G L I   +T+F   L  
Sbjct: 245 ANEYYI-KASLFISANISILRLLSLLM-FVQGFWFGSSMIKQGKLNIDSVITSFHCCLML 302

Query: 421 EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE-----IRPTLGKTYLPGKGEIEFK 475
               NS  G +     + +G  A  RL ++ D  P      I    G   LP    I F 
Sbjct: 303 GSIINSALGQAVV---LQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFN 355

Query: 476 NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
           NVSF YP R  +++F  +NF I+P     ++GPSG GKST+  L+L +Y+   G I++  
Sbjct: 356 NVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGD 415

Query: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYT--PTKEEIRKVAKQCFCHNF 593
            DI  +N   +   + +V Q P L + +IR+NI     +T  P+K E+  + K     N 
Sbjct: 416 LDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENL 475

Query: 594 ITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 653
           I + P   DT+IG  G  LSGGQ Q++A+ARA  +  +IL+LDE  SA+D+     +   
Sbjct: 476 IAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMEN 535

Query: 654 FGQLMKTKSMTIVSIAHRLSTIRRSENVI 682
             +    K  T V I H L  IR ++N++
Sbjct: 536 IKRWRNGK--TTVIITHDLEFIRNTDNIL 562

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  164 bits (414), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 146/493 (29%), Positives = 229/493 (46%), Gaps = 37/493 (7%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            +L S++          F++    G +++R   D Y +   + +  S  F++ I     + 
Sbjct: 1018 QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIV 1077

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGV 343
            ++CS +         LIIP+      + +     SREL+  D+T +  L    +E L GV
Sbjct: 1078 VICSTTWQFI----FLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGV 1133

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
             T++ F  + R I      + +       S   N         +G L  L       + +
Sbjct: 1134 STIRGFAQQDRFIHINQSRVDSNMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRL 1193

Query: 404  LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK 463
             +GSLT G +   M Y      S+  +     ++     +  R+ E + ++P   P + +
Sbjct: 1194 KNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPSEAPLIIE 1252

Query: 464  T-----YLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA 517
                    P KG IEFKN S  Y  RP+ + + KN+N KI P   V IVG +G GKS++ 
Sbjct: 1253 NNRPSEEWPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLT 1310

Query: 518  LLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT 577
            L L      +SG I IDG +I ++    LR KL I+ Q+  +  GSIR+NI    T   +
Sbjct: 1311 LALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFS 1368

Query: 578  KEEIRKVAKQCFCHNFITKF----PHT-----------YDTQIGPSGTLLSGGQKQRIAI 622
            ++EI    +       I K     P +            D +I   G+ LS GQ+Q I +
Sbjct: 1369 EQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICL 1428

Query: 623  ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVI 682
            ARAL+   N+LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ +I
Sbjct: 1429 ARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKII 1486

Query: 683  VLGNDGSVIEMGK 695
            VL N G V E  K
Sbjct: 1487 VLDN-GEVAEFDK 1498

 Score =  110 bits (274), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 161/714 (22%), Positives = 302/714 (42%), Gaps = 76/714 (10%)

Query: 82  SSLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXX 141
           S   S++  TR N     + K   +PS+ G  L+ +  PK          LL+    K  
Sbjct: 247 SEFNSEVLSTRFNGAWQDEVKHKAKPSIVG-ALAKTFGPK----------LLLAASLKF- 294

Query: 142 XXXXXXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFS 201
                   +  ++  + P+++ I++  +   + +++EG  + P I  F + I      FS
Sbjct: 295 --------VHDILAFVQPQLLRILIQFVNAYSDSENEGSYSLPIIKGFMIAI----AMFS 342

Query: 202 IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADA 261
           ++L+     +             + + L S + ++ +    +  ++  TGD+++ +  D 
Sbjct: 343 VSLIQTSFLH-QYFLNSFNSGMNIRSALTSVIYQKALLLSNEATEVSTTGDIVNLMSVD- 400

Query: 262 YIVSRSITQKISDGFKSLICGGVGVGMMCSLSL----DLSAVLGVLIIPVVI--SASIFG 315
             V R   Q +S     L  G   +  +C +SL      S  +GV I+ ++I  ++ I  
Sbjct: 401 --VQR--LQDLSQWINILWSGPFQL-TLCLISLYNLLGHSMWIGVFILGIMIPINSYIMR 455

Query: 316 KQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ-----REIKRFNEAIRNIFHVG 370
            Q ++   +++    + T +  E LN +K+++ +  E+      E  R  + ++N+  +G
Sbjct: 456 IQKKLQKDQMK-YKDERTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIG 514

Query: 371 KRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGL 430
             +A I  +F     LV   +F  + V+     L   L    LT F L        +  +
Sbjct: 515 VFNAMIAFQFNIVPFLVSCCTF-AIFVWVEDKPLTTDLVFPALTLFNL----LNFPLVAV 569

Query: 431 STFYSEIMQGAGAASRLFE-LTDYVPEIRPTLGKTYLPGKGEIEFK---NVSFSYPTRPQ 486
               S  ++ + + SRL+  LT+   +        ++   GE   K   N +F +  +P+
Sbjct: 570 PITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPE 629

Query: 487 NQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKS 545
            ++  KN+NF+   G   CIVG  G GKS     +L       G   I G          
Sbjct: 630 YKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKGFASIHGN--------- 680

Query: 546 LRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQI 605
               +  V Q   +M+G+++DNI +G  Y P  E   K  K C     ++  P    T +
Sbjct: 681 ----VAYVSQLAWIMNGTVKDNIIFGHRYDP--EFYEKTIKACALTIDLSILPDGDQTLV 734

Query: 606 GPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMT 664
           G  G  LSGGQK R+++ARA+  + +I +LD+  +A+D   S+  I    G     KS T
Sbjct: 735 GEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKT 794

Query: 665 IVSIAHRLSTIRRSENVIVLGNDGSVIEMGK-FKELFSDPXXXXXXXXXXXXXXXXTKSD 723
            +   +++  +  ++++ +L N G + E G  F  + ++                 ++S+
Sbjct: 795 RILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSKLITEYGKKKDSSESE 853

Query: 724 PISSAPEVDADATGEPVEPIDPAIEDALHSV--LNDVT--SESKPIKMSTTDTL 773
                   ++D +    E   P IED L  +  LND+    E K ++ ++ DTL
Sbjct: 854 AAKDNVNSESDESSVNRELTVP-IEDELRELDKLNDLKFIDEGKSLRRASFDTL 906

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 144/506 (28%), Positives = 239/506 (47%), Gaps = 49/506 (9%)

Query: 228 RLRSTVIKRTIHQD-AQFYDIHKT--GDL--ISRLGADAYIVSRSITQKISDGFKSL--I 280
           R+RS +++  + +   ++YD++ T  GD   I+R   +   +  S  +  +  F++L  I
Sbjct: 132 RIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEE---LRSSSAEASAITFQNLVAI 188

Query: 281 CGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQL 340
           C  +G     S SL L  +    II     A  F + + + S++  + T +  ++    +
Sbjct: 189 CALLGTSFYYSWSLTLIILCSSPIITFFAVA--FSRMVHMYSQKENEETSKAAQLFAWSM 246

Query: 341 NGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV----- 395
           N  + V+ +  +  E K+F   I     +   + FI +  F + +  G L FLT+     
Sbjct: 247 NAAQLVRLYCTQPLERKKFQRII-----LSCNTFFIKSCLFVAAN-AGILRFLTLTMFVQ 300

Query: 396 -LVYGSYLVLHGSLTIGD-LTAF---MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
              +GS ++  G L I D +T F   +L      N++  +      + +G  A  ++  L
Sbjct: 301 GFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVV----LQKGEVALQKIMNL 356

Query: 451 TDYVPEIRP----TLGKTYLP-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCI 505
            +  P+  P     L +  L     ++ F NVSFSYP+RP   + +N + K   G    I
Sbjct: 357 LENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFI 416

Query: 506 VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
           VG SG GKST++ LLL +Y+   G I I+G++I  +  K L + + +V+Q   L + ++R
Sbjct: 417 VGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLR 476

Query: 566 DNITYGLT-------YTPTKEE--IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQ 616
            NI  G T       Y+  K    I+   +       I   P   +T IG  G  LSGGQ
Sbjct: 477 KNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQ 536

Query: 617 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIR 676
           +QR+A+ARA I+   IL LDEA SALD+     +        K K+  I++  H L  + 
Sbjct: 537 QQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQV- 593

Query: 677 RSENVIVLGNDGSVIEMGKFKELFSD 702
            S++ + L  +G VIE G   EL +D
Sbjct: 594 ESDDHLYLMQEGKVIESGTQSELLAD 619

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 141/510 (27%), Positives = 246/510 (48%), Gaps = 27/510 (5%)

Query: 211  NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAYIVSRSI 268
            NF         SE  +  LR+ V+++   +   ++  + +K  + +S L  +     RS+
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASE-VSALVLNDLRDLRSL 861

Query: 269  TQKISDGFKSLICGGVGVGMMCSLS--LDLSAVLGVLIIPVVISASIFGKQIRINSRELQ 326
              +      S I     +G++ +L+    LS V   +   ++I ++I+G  ++ +  + +
Sbjct: 862  VSEFLSAITSFITVSF-IGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETDYK 920

Query: 327  DATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL 386
             +  QL     + +  +KT++   AE      +++    +  +  + A       + T++
Sbjct: 921  TSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMTNM 980

Query: 387  VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
            +       +  YG  LV+    T   +        +T  S   L +   +I +G  AAS 
Sbjct: 981  IAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1040

Query: 447  LFELTD---YVPEIRPT-------LGKTYLPGKGE--IEFKNVSFSYPTRPQNQIFKNLN 494
            ++ + D      EI          +G+TY   +    +  +N++F+YP+ P   I+KN+N
Sbjct: 1041 IYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPSAPSVLIYKNMN 1100

Query: 495  FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
              +  G  + IVG SG GKST+ LLL   Y+   G I +DG D+   N   LRR++ +V+
Sbjct: 1101 LNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREISVVE 1160

Query: 555  QEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSG 614
            Q+P+L +G+IRDN+TYG      + EI    K    ++F+   P    T+I  +  LLSG
Sbjct: 1161 QKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--LLSG 1218

Query: 615  GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK--SMTIVSIAHRL 672
            GQ QR+ IARAL++KP ILILDE TSALD  S   I     +++K    ++  + I H  
Sbjct: 1219 GQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKGPPALLTLVITHDE 1274

Query: 673  STIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              +R  +++ V   DG VIE G F  L+++
Sbjct: 1275 QMMRCCDSIAVF-KDGKVIEEGSFDTLYNN 1303

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  162 bits (411), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 187/369 (50%), Gaps = 18/369 (4%)

Query: 343  VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLT---VLVYG 399
            +KT++    E+R IK + E +     +  R   +   F    +L   L+ +T   +L YG
Sbjct: 924  IKTIRCLQVEERVIKEY-EVLEGKAKLAGRKRALGTGF--GVALSNALTLITQSILLYYG 980

Query: 400  SYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRP 459
              LV+ G  +   +   +    +T  +   L     EI +G  AA+ LF + D   +   
Sbjct: 981  MKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFAD 1040

Query: 460  T--LGKTYLPGKG-----EIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKG 512
                G++ L  +G      I  K++ FSY       +++ LN  ++ G  V +VG SG G
Sbjct: 1041 ANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSG 1100

Query: 513  KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL 572
            KST+  L+   Y   SG I  DG D+ +    +LR+++ +V+Q P L  GSI DN+TYGL
Sbjct: 1101 KSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGL 1160

Query: 573  TYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNI 632
            + +  + EIR++ +     +F+   P    + I     +LSGGQ QR+AI RAL++KP +
Sbjct: 1161 STSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQL 1218

Query: 633  LILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
            L+LDE TSALD +  G I   F +   ++S T + + H    +R    ++   N G++IE
Sbjct: 1219 LVLDECTSALDAQ-HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIE 1275

Query: 693  MGKFKELFS 701
             G F+ L+S
Sbjct: 1276 DGSFERLYS 1284

 Score =  145 bits (367), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 228/510 (44%), Gaps = 51/510 (10%)

Query: 223 ERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKS---L 279
           ER   RLR  +++  + +   +YD ++      ++  D   ++R + +  S   +S   +
Sbjct: 101 ERQAFRLRRKMLQSYLDKSMAWYDANE------QISGDFTQLNRCVEELRSSSAESSAIV 154

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLII---PVVIS-ASIFGKQIRINSRELQDATGQLTRV 335
               V V  +   +L  S  L ++I+   P+VI  A  F +++   ++     T      
Sbjct: 155 FQNVVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADA 214

Query: 336 SEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
               L+  K V+    + RE+ RF   ++       R  F     F+S +    L FLT+
Sbjct: 215 MAWSLDAAKMVRLLGTQDRELARFEACVQKC-----RQHFNKMSLFSSLN-YSVLRFLTL 268

Query: 396 LV------YGSYLVLHGSLTIGD-LTAFMLYTEYTGNSIFGLSTFYSEIMQ------GAG 442
            +      YG+  +  G L  GD +T F        + +   ST  S + Q      GA 
Sbjct: 269 CMFVQGFWYGNSRINIGKLKPGDVVTCF-------SSCVLLASTLNSTLHQIIILQKGAV 321

Query: 443 AASRLFELTDYVPEIRPTLGKT-----YLP---GKGEIEFKNVSFSYPTRPQNQIFKNLN 494
              ++    +          K       LP    +  I F+NV F+YPTRP + + K ++
Sbjct: 322 GLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVS 381

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
                G    ++G SG GKSTI  LLL +Y   SG I ++GQD+ ++N   L R + +V+
Sbjct: 382 LDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVE 441

Query: 555 QEPVLMSGSIRDNITYGLTYTPTKE-EIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLS 613
           Q   L + ++ +N+T G       E  +++  +     N I       +T IG SG  LS
Sbjct: 442 QTTSLFTETLANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLS 501

Query: 614 GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLS 673
           GG++QR+A+ARA  +   ILILDEA SA D   +  +     +    K+  I++  H LS
Sbjct: 502 GGEQQRVALARAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILT--HELS 559

Query: 674 TIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            I  ++ V V+ +DG + E G    L S+P
Sbjct: 560 DILDTDYVYVM-SDGQIREHGYKSGLLSNP 588

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 140/518 (27%), Positives = 242/518 (46%), Gaps = 26/518 (5%)

Query: 200  FSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGA 259
             +IAL  G   NF         SE  +  LR+ +++    +  ++Y   ++ +  S + A
Sbjct: 729  LAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYG--RSSNKSSEISA 785

Query: 260  DAYIVSRSITQKISDGFKSLICGGVGVGMM-----CSLSLDLSAVLGVLIIPVVISASIF 314
             A    R +   +++ F S +   V V MM      +    LS V   +   ++I + I+
Sbjct: 786  LALNDLRDLRTLVTE-FLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 315  GKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSA 374
            G  ++      + A   L  +  E +  +KT++        +  ++E  + +  + K+  
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 375  FINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG---SLTIGDLTAFMLYTEYTGNSIFGLS 431
             +     +  + +       +  YG  LVL G   S T+      +L+T  T NS+    
Sbjct: 905  IVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQI 964

Query: 432  TFYSEIMQGAGAASRLFELTDYVPEI-----RPTLGKTYLPGKGEIEFKNVSFSYPTRPQ 486
               S   + A    R+ +  +Y  E+     R    +        IE +N++F YP  P 
Sbjct: 965  PDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPG 1024

Query: 487  NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSL 546
              ++++LN KI  G  + +VG SG GKST+  LL   Y+    +ILI+G DI   +   L
Sbjct: 1025 VNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDIL 1084

Query: 547  RRKLGIVQQEPVLMSGSIRDNITYGLT-YTPTKE-EIRKVAKQCFCHNFITKFPHTYDTQ 604
            R ++ +V+Q+P L  G+IR+NITYG++   P  E E++++ +    H F+   P   DT 
Sbjct: 1085 RAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTV 1144

Query: 605  IGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL---MKTK 661
            +     LLSGGQ QR+ I R L++KP +LILDE TS+LD ++   +      L   +   
Sbjct: 1145 VDIG--LLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWD 1202

Query: 662  SMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
             +TIV I H    ++    ++VL + G V+E G+F +L
Sbjct: 1203 ILTIV-ITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDL 1238

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 129/502 (25%), Positives = 242/502 (48%), Gaps = 41/502 (8%)

Query: 223 ERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-- 280
           ER   R+RS +++  + +  ++YD+ +       L  D   ++R + +  S   ++    
Sbjct: 95  ERQGFRVRSKLLEEYLEKPMEWYDLKE------NLAGDFTQLNRCMEELRSGSAEASAVT 148

Query: 281 ---CGGVGVGMMCSLSLDLSAVLGVLIIP----VVISASIFGKQIRINSRELQDATGQLT 333
              C  + + ++C +S   S  L ++I+     +++ A+ F + I+  +      T    
Sbjct: 149 YQNCVAI-IALIC-VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 334 RVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL 393
            +    ++  +TV+    + +EIK+F   +           FI    FT+ + +G L FL
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKC-----NDYFIRTSLFTAAN-IGILRFL 260

Query: 394 TV------LVYGSYLVLHGSLTIGD-LTAFMLYTEYTGNSIFGLSTFYSEIMQ-GAGAAS 445
           T+        +GS ++  G L I D +T F  Y+     SI   +  +   +Q G  A +
Sbjct: 261 TLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQVALA 318

Query: 446 RLFELTDYVPEI-RPTLGKTYLP-GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNV 503
           ++ +  +  PE+   TL  + L     +I   N++F+YP+RP   + KN++ KI+     
Sbjct: 319 KIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTT 378

Query: 504 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
            IVG SG GKSTI  L++ +Y    G I++  +DI  +    L + + +V+Q   L + +
Sbjct: 379 FIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDT 438

Query: 564 IRDNITYGLTYTPTKEE---IRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRI 620
           +++NI  G  YT        +  +       + I+  P   +T++G  G  LSGGQ+QR+
Sbjct: 439 LKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRV 498

Query: 621 AIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSEN 680
           A+ARA ++  +ILILDEA SALD+     +     ++ + K+  I++  H L+ I  ++ 
Sbjct: 499 ALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQINDNDY 556

Query: 681 VIVLGNDGSVIEMGKFKELFSD 702
           + +  N+  + E G  K L +D
Sbjct: 557 IYLFENN-EIKENGFKKTLMND 577

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  161 bits (407), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 148/578 (25%), Positives = 269/578 (46%), Gaps = 39/578 (6%)

Query: 150 ISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEF-LGGFSIALLAGC 208
           +S V   ++P VI I+    +V    QS G +       F   ++E  +  FSIA +A C
Sbjct: 22  VSTVANGLVPVVISILTG--RVFNLLQSLGTDTYKTKSEF---VHELTVRSFSIAAVAAC 76

Query: 209 MA--NFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKT--GDLISRLGADAYIV 264
           +   ++          ER   R+R+++I     +D ++YD ++   GD I ++      V
Sbjct: 77  VIPISWVSLSTWMTLGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEV 135

Query: 265 SRSITQKISDGFKSLIC--GGVGVGMMCSLSLDLSAVLGVLIIPVVISASIF-GKQIRIN 321
             S  +  +  F+++I     +   M  S SL L  +     +P++ + ++F   ++   
Sbjct: 136 RASSAEASAIFFQNVISIIALIATSMYYSWSLTLIILCS---LPLLATLAVFLSMKVEKF 192

Query: 322 SRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFF 381
           S+     + + + V    L+  + ++ F     E K+F   +        +S   +A   
Sbjct: 193 SKLENLESSKASSVLAWSLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNA 252

Query: 382 TSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGA 441
           +S   +    F+    +G+  +  G +  GD+          G+S+         I +G 
Sbjct: 253 SSLRFLTLCMFVQGFWFGNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGK 312

Query: 442 GAASRLFELTDYVPEIRPTLGKTY----------------LPGKGEIEFKNVSFSYPTRP 485
            A  R+ +    VP  +  +G+                  +   G+IEF++VSF+YPTRP
Sbjct: 313 AAIQRINQF--LVPNSKSAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRP 370

Query: 486 QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKS 545
            + + KN++ KI+ G+   IVG SG GKST+A LLL  Y   +G+I     +I  ++   
Sbjct: 371 DDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSW 430

Query: 546 LRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQI 605
           L   + +V+Q   L +G+++DN+T    Y     E+++  +    +  +   P+  DT +
Sbjct: 431 LVENITLVEQRCTLFNGTLKDNLTIVNKYASCT-EVKQACQFALLNTVLLNLPNGIDTLL 489

Query: 606 GPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTI 665
           G  G  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S   I        K K+  I
Sbjct: 490 GRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGKTTII 549

Query: 666 VSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           ++  H  + I+  E V ++ ++G+V+E G   +L  +P
Sbjct: 550 LT--HEYTQIKDDEYVYLM-SEGTVVESGFKYDLLENP 584

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 121/427 (28%), Positives = 216/427 (50%), Gaps = 19/427 (4%)

Query: 286  VGMMCSL--SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
            +G++ +L     LS V   L    ++ + I+G  +++     +    +L     E +  +
Sbjct: 837  IGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEIAELETRVHELVISM 896

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
            KT++    +Q     F   +  +  V K+ +         T+ +  +    +  +G  LV
Sbjct: 897  KTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLV 956

Query: 404  LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIR----- 458
            + G  ++  +        ++  +   L     EI +G  AA+ +F++ +    +      
Sbjct: 957  IQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPD 1016

Query: 459  PTLGKTYLPGKGE---IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKST 515
            P+  +++    G    I+  N+SF++ + P N+IF +L+ +I     V IVG SG GKST
Sbjct: 1017 PSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKST 1076

Query: 516  IALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYT 575
            ++LLL   Y   SG++ I G DI K +  +LRR + IV+Q+P    G++R+N+ YGL   
Sbjct: 1077 LSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRN 1136

Query: 576  PTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILIL 635
             +  E+R V K     +F+   P+  +T++     L+SGGQ QR++IAR L+++P I+IL
Sbjct: 1137 VSNSELRSVLKSVDLLSFVQTLPNDLNTRVHDG--LMSGGQAQRLSIARTLLRQPKIIIL 1194

Query: 636  DEATSALDVESEGAINYTFGQLMKT--KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            DE TSALD  +  AI     +L++T  K++T++ I H    ++  + V+VL   G V E 
Sbjct: 1195 DECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLMQICDRVLVL-KKGKVKEE 1249

Query: 694  GKFKELF 700
            G + ELF
Sbjct: 1250 GSYAELF 1256

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  160 bits (405), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 136/515 (26%), Positives = 245/515 (47%), Gaps = 31/515 (6%)

Query: 205  LAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY--DIHKTGDLISRLGADAY 262
            +A  ++NF         SE  +  LR+  ++  +++D  ++  D +K+ +L + L  D  
Sbjct: 769  VADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLR 828

Query: 263  IVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS-ASIFGKQIRIN 321
             +   +++ +S     ++   +G+         LS V  + + P++I+ ++++G  ++  
Sbjct: 829  DLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVC-LSMFPLIIAFSAVYGTMLQKY 887

Query: 322  SRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFF 381
                + +   L     E + G+KT++S  AE   IK ++    N+  +  + +       
Sbjct: 888  ETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGI 947

Query: 382  TSTSLVGDLSFLTVLVYGSYLVLHG---SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
            + T+++       +  YG  LV  G   S  + +    +L+T  T  S   L     +I 
Sbjct: 948  SVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTS---LVNQIPDIS 1004

Query: 439  QGAGAASRLFELTDY-----VPEIRPTLGKTYLPGKGE------IEFKNVSFSYPTRPQN 487
            +G  +A+ L+ + D        E         +  K E      I+ +N++F+YP+    
Sbjct: 1005 RGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAYPSETNV 1064

Query: 488  QIFKNLNFKIEPGSN-VCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSL 546
             ++++LN ++      + +VG SG GKST+  LL   Y      I +DG D+      +L
Sbjct: 1065 NVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNL 1124

Query: 547  RRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIG 606
            R ++ +V+Q+P L  G++R+N++YG++      E+  + K    + F+   P   DT+I 
Sbjct: 1125 RTQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRID 1184

Query: 607  PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK--SMT 664
                LLSGGQ QRI IARAL++KP ILILDE TSALD  S   I      ++K    ++ 
Sbjct: 1185 TK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALL 1238

Query: 665  IVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
             + I H    +R    + VL N G +IE G FKEL
Sbjct: 1239 TIVITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 114/417 (27%), Positives = 197/417 (47%), Gaps = 39/417 (9%)

Query: 306 PVVISASIFGKQIRINSRELQDA-TGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIR 364
           P++I+ ++F   +     EL++  TG+  +++   ++ ++ V+ +  + RE++ F E   
Sbjct: 187 PIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQFREVRNFRELTS 246

Query: 365 NIFHVGKRSAFINAKFFTS--TSLVGDLS---FLTVLVYGSYLVLHGSLTIGDLTAFMLY 419
           N         FI    + S  T+L+  LS   F+    +G+ +V  G L I ++      
Sbjct: 247 NC-----NDLFIKCCLYVSANTALLRFLSLSMFIQGFWFGATMVRKGKLQISNVVTCFQS 301

Query: 420 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD-----------YVPEIRPTLGKTYLPG 468
               G+++         + +G  A  ++                Y PE    L       
Sbjct: 302 CLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGADEPIYEPETPAELCT----- 356

Query: 469 KGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTS 528
              I F N++FSYP+RP + + KN++   EP     I+G SG GKST++ LLL +Y+  +
Sbjct: 357 ---IAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDDYN 413

Query: 529 GQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT------YTPTKEEIR 582
           G I + G D+ ++N   L   + +V+Q   L + ++R+NI  G++      +   +++++
Sbjct: 414 GTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQKLK 473

Query: 583 KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 642
                      +   PH  +T IG  G  LSGGQ+QR+AIARA ++   ILILDEA SAL
Sbjct: 474 DACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAVSAL 533

Query: 643 DVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           D+     +     Q    K  T + + H LS I   +   V+  +G V E G  K+L
Sbjct: 534 DIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKENGYQKDL 587

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 155/552 (28%), Positives = 255/552 (46%), Gaps = 49/552 (8%)

Query: 223 ERLVARLRSTVIKRTIHQDAQFYDIHK--TGDLISRLGADAYIVSRSITQKISDGFKSLI 280
           ER   RLR  +++    +   +YDI++  +G+  ++L      +  S  +  +  F++L+
Sbjct: 105 ERQGFRLRRKLLRSYFEKSMAWYDINEQISGEY-TQLNRCVEELRSSSAEASAIIFQNLV 163

Query: 281 C--GGVGVGMMCSLSLDLSAVLGVLIIPVVISASIF-GKQIRINSRELQDATGQLTRVSE 337
                +G  +  S SL L  +      P+VI  +I+  + +    +     T     +  
Sbjct: 164 TVIALLGTALYYSWSLTLVIMANS---PLVIGFAIYCSRNVEKYGKIENSETSVAADIMA 220

Query: 338 EQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLV 397
             LN  K V+    +  EI +F  ++     +  R  F     F+S +    L FLT+ +
Sbjct: 221 WSLNAAKMVRLLGTQDYEIAKFRASV-----LKCRMNFNKMSLFSSLN-YSILRFLTLCM 274

Query: 398 ------YGSYLVLHGSLTIGD-LTAFMLYTEYTGNSIFGLSTFYSEIMQ------GAGAA 444
                 YG+  +  G+L  GD +T F        + I   ST  S + Q      GA   
Sbjct: 275 FVQGFWYGNVRIKSGNLKPGDVMTCF-------SSCILLASTLNSTLHQVVTLQKGAVGL 327

Query: 445 SRLFEL--TDYVPEIRPTLGKTYLP---GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEP 499
            ++ E   +D V      +   +LP    + +I F+NVSF+YP+R ++ + KNLN K+  
Sbjct: 328 KKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPG 387

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559
           G    IVG SG GKSTI+ LLL  Y P SG I ++  DI ++N + L R + +V+Q   L
Sbjct: 388 GRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPL 447

Query: 560 MSGSIRDNITYGLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQK 617
              SI++NI   LT    +++ R  +  +       I       DT IG SG  LSGG++
Sbjct: 448 FEDSIKNNIQ--LTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQ 505

Query: 618 QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
           QR+A+ARA ++   ILILDEA SA D   +  +        K ++  I++  H L+ I  
Sbjct: 506 QRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIRFWRKGRTTIILT--HELNDILE 563

Query: 678 SENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISSAPEVDADATG 737
            ++ ++L  DG+VIE G+  +L SD                    D  S+  + +  + G
Sbjct: 564 -DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLLHAFQLCDEI--EDEASTITDSNRLSLG 620

Query: 738 EPVEPIDPAIED 749
             +EPI   +E+
Sbjct: 621 AKLEPIRVDVEE 632

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 124/429 (28%), Positives = 206/429 (48%), Gaps = 24/429 (5%)

Query: 287  GMMCSL--SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVK 344
            G++ +L     LS V   LI   V+ + I+G  ++      +    +L     + +  +K
Sbjct: 865  GLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARYKTCIAELENELYKAIRCMK 924

Query: 345  TVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLT---VLVYGSY 401
            T++    E + + R  E +        R   +   F  ++S    L+F+T   +L +G  
Sbjct: 925  TIKCLQMENK-VARSYEMLEVTSKGAARKRAMGTGFGVASS--NALTFITQSILLYFGMK 981

Query: 402  LVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL-TDYVPEIRPT 460
            LV+ G  T G +   +    +T  +   L +   EI +G  AA+ LF+L  +   E    
Sbjct: 982  LVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGASV 1041

Query: 461  LGKTYLP------GKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
            L + + P       +  I  K++ FSY       ++KNL+ K++ G  V ++G SG GKS
Sbjct: 1042 LKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKS 1101

Query: 515  TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
            T+  LL   Y   +G I IDG DI + + K+LR  + +V+Q+P+  SGSI +N+TYGL  
Sbjct: 1102 TLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMR 1161

Query: 575  TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
              + EE+ ++        F+   P    + I     LLSGGQ QR+AI RAL++KP +L+
Sbjct: 1162 KVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQVQRLAIVRALLRKPQLLV 1219

Query: 635  LDEATSALDVESEGAINYTFGQLMKTK--SMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
            LDE TSALD       ++   + +K      T + + H    +R    ++   N G ++E
Sbjct: 1220 LDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMRSCHRILTF-NKGEIVE 1274

Query: 693  MGKFKELFS 701
             G    LF+
Sbjct: 1275 EGSIDNLFN 1283

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 140/534 (26%), Positives = 248/534 (46%), Gaps = 35/534 (6%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            +++F+G ++ I + +    N          + R  A+L  T+ K  +     F++    G
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  ++    +  F+S++   V V ++ S ++    ++  +++ + I  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTV-ILISYNMPWFLIVNAVLLIIYIYY 1111

Query: 312  SIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQR-EIKRFNEAIRNI 366
              F   +   SREL+     +T  +  +  E L G   + +F    R +   FN    NI
Sbjct: 1112 QAFYITL---SRELKRLTSVSTSPIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQFNI 1168

Query: 367  ---FHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 423
               F+    + +++ +  T  + +      T L+  S +     L+ G +   M Y    
Sbjct: 1169 NCSFNFRSTNRWLSVRLQTIGAFI---VLATALLALSTINSERRLSPGMVGLLMSYALQV 1225

Query: 424  GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE----IRPTLGKTYLPGKGEIEFKNVSF 479
             +S+  +     +I     +  R++E  +  PE    I     K   P +GEI FKN S 
Sbjct: 1226 TSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYST 1285

Query: 480  SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
             Y T+  +   K +N  I+P   + +VG +G GKST++L L      T G I IDG DI+
Sbjct: 1286 KYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDIS 1344

Query: 540  KMNSKSLRRKLGIVQQEPVLMSGSIRDNI-------TYGLTYTPTKEEIRKVAKQCFCHN 592
            KM  K LR  LGI+ Q+     G++R N+       T  L  +     ++    + F   
Sbjct: 1345 KMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHIVEMFRKE 1404

Query: 593  FITKFPHT----YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 648
              ++ P +     D +I  +G  LS GQ+Q + ++RAL+    +L+LDEAT+A+D+E++ 
Sbjct: 1405 DNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDK 1464

Query: 649  AINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
             I  T    +K K  TI++IAHR+ T+  S+ +IVL + G V E    + L S+
Sbjct: 1465 IIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLSN 1515

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 127/259 (49%), Gaps = 16/259 (6%)

Query: 451 TDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQI-FKNLN-FKIEPGSNVCIVGP 508
           +D V  +   +  T+L    +I F   S        +Q+  +N+N F+ + G   CIVG 
Sbjct: 598 SDKVSPVVEIINATFLWKSPKILFSEGSDEESRIESSQVALENINGFQAKKGELTCIVGR 657

Query: 509 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK--LGIVQQEPVLMSGSIRD 566
            G GKST+   +L       GQ+      +  +  K L R   +    QEP +M+ SI+D
Sbjct: 658 VGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAYCPQEPWIMNASIKD 710

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           NIT+G  Y  T        K C     +   P   +T +G  G  LSGGQK RI++ARA+
Sbjct: 711 NITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISLSGGQKARISLARAV 768

Query: 627 IKKPNILILDEATSALDVE-SEGAINYTFGQLMK-TKSMTIVSIAHRLSTIRRSENVIVL 684
             + ++ +LD+  SA+D E S+  +     + M   ++ T+V   + +S + RS+ + +L
Sbjct: 769 YSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTVVLTTNAISVLNRSQKIYML 828

Query: 685 GNDGSVIEMGKFKELFSDP 703
              GS++E G F E+ S P
Sbjct: 829 -EGGSIVEEGSFTEVTSSP 846

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  155 bits (391), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 163/586 (27%), Positives = 278/586 (47%), Gaps = 86/586 (14%)

Query: 163  GIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAG--CMANFGXXXXXXX 220
            G  +D+L ++  T S   +       + LT+Y FL G   A+L G   M  F        
Sbjct: 1017 GFAMDTLPLKGMTDSSKNKHNA---FYYLTVY-FLIGIIQAMLGGFKTMMTF-------L 1065

Query: 221  XSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI 280
               R   ++ + ++   +H   +F+D+   G +++R   D   V + +   +      LI
Sbjct: 1066 SGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLI 1125

Query: 281  CGGVGVGMMCSLSLDLSAVLG--VLIIPVVISASIF--GKQIRINSRELQ--DATGQ--L 332
                     C+  + L  V+    L + V++    F  GK     SREL+  D+  +  +
Sbjct: 1126 --------QCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPI 1177

Query: 333  TRVSEEQLNGVKTVQSFVAEQREI----KRFNEAIRNIFHVGKRSAFINAKFFT-STSLV 387
             +   E L GV T+++F  E+R I     + ++  R  F++      +  K+F+    ++
Sbjct: 1178 FQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLS-----VTVKWFSFRVDMI 1232

Query: 388  GDLSFLTVLVYGSYLVLH-----GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAG 442
            G  +F+ VL  GS+++L+       L    LT  +L+T+        L   YS       
Sbjct: 1233 G--AFI-VLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMN 1285

Query: 443  AASRLFELTDYVPE--IRPTLGKTYL------PGKGEIEFKNVSFSY-PTRPQNQIFKNL 493
            +  RL E +    E  +    G+  L      P  GEIE +N+S  Y P  P   + +N+
Sbjct: 1286 SVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNV 1343

Query: 494  NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIV 553
            +FK++P S + IVG +G GKSTI   L     P +G I IDGQDI+K++  +LRR + I+
Sbjct: 1344 SFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITII 1403

Query: 554  QQEPVLMSGSIRDNITYGLTYTPTK-----EEIRKVAKQCF--CHNFITKFPHTYD---- 602
             Q+P+L +G+I+ N+     Y   K      ++  ++   F    N   +F  T++    
Sbjct: 1404 PQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLN 1463

Query: 603  --TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE----GAINYTFGQ 656
              T+I   G  LS G++Q + IAR+L+++P I++LDEATS++D +S+    G I   F +
Sbjct: 1464 LHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNK 1523

Query: 657  LMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
                   TI++IAHRL ++   + +IV+ + G V E  +  EL  D
Sbjct: 1524 ------STILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 132/479 (27%), Positives = 218/479 (45%), Gaps = 52/479 (10%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV-- 308
           G +I+ +  D++ VS  +   +    +++I   V VG++ +  L +SA  G+ II V+  
Sbjct: 446 GTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNF-LGVSAFAGISIILVMFP 503

Query: 309 ---ISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRN 365
              + A++ GK      ++    T Q      E L  ++ V+ F  E+  I   NE I++
Sbjct: 504 LNFLLANLLGKF----QKQTLKCTDQRISKLNECLQNIRIVKYFAWERNII---NE-IKS 555

Query: 366 IFHVGKRSAFINAKFFTSTSLVGDLSFLT-VLVYGSYLVLHGSLTIGDLTAFMLYTEYTG 424
           I     RS    +  ++ TS    L F+T  LV G    +   +   DL A + +T  + 
Sbjct: 556 IRQKELRSLLKKSLVWSVTSF---LWFVTPTLVTGVTFAICTFVQHEDLNAPLAFTTLSL 612

Query: 425 NSIFG-----LSTFYSEIMQGAGAASRLFELTDYV--PEIRPTLGKTYLPGKGEIEFKNV 477
            ++       LS   S I Q   +  R+   +D++   +       T  P K +IEFKN 
Sbjct: 613 FTLLKTPLDQLSNMLSFINQSKVSLKRI---SDFLRMDDTEKYNQLTISPDKNKIEFKNA 669

Query: 478 SFSYPTRPQN-QIFK--NLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 534
           + ++     +   FK   LN K + G    I+G +G GKS + L LL   N  SG I++ 
Sbjct: 670 TLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVP 729

Query: 535 G----QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
                 D+   + + L        Q   L++ ++++NI +   Y   ++   KV   C  
Sbjct: 730 SLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYN--EDRYNKVIDACGL 786

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              +   P    T+IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I
Sbjct: 787 KRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWI 846

Query: 651 --NYTFGQLMKTKSMTIVSIAHRLS-TIRRSENVIVL-----GNDGSVIEM---GKFKE 698
             N   G LMK +  T + + H +S T+R +   IVL      N G++ E+   G FKE
Sbjct: 847 YENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLFKE 903

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 234/478 (48%), Gaps = 39/478 (8%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     +G++C  +     V    
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQFIFV---- 1098

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            I+P+ +    + +     SREL+     +TR       +E L G+ T++ +  +Q+   +
Sbjct: 1099 IVPLGVFYIYYQQYYLRTSRELR-RLDSITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQ 1156

Query: 359  FNEAIRNIFHVGKRSAF---INAKFFTS--TSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 413
             N+   +       SAF   +NA  + +    L+G +  L         +  G+LT G +
Sbjct: 1157 INQCRVD----NNMSAFYPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMV 1212

Query: 414  TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY---VPEI----RPTLGKTYL 466
               + Y      S+  +     E+     +  R+ E  D     PEI    RP   +   
Sbjct: 1213 GLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIEDHRP---QETW 1269

Query: 467  PGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYN 525
            P +G+I+F++ S  Y  RP+ + + K++NF I+P   + IVG +G GKS++ L L     
Sbjct: 1270 PEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIE 1327

Query: 526  PTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVA 585
             + G I+ID  DI+ +    LR KL I+ Q+  +  G+IR+NI     Y  T E+I +V 
Sbjct: 1328 ASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNQY--TDEQIWRVL 1385

Query: 586  KQCFCHNFI-TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
            +     + I T      DT++   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DV
Sbjct: 1386 ELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDV 1445

Query: 645  ESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            E++  +  T     K +  TI++IAHR++TI  ++ ++VL N GS+ E  + K+L  +
Sbjct: 1446 ETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDEPKKLLEN 1500

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 116/481 (24%), Positives = 218/481 (45%), Gaps = 61/481 (12%)

Query: 247 IHKTGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVL 300
           I  TGD+++ +  D         QK+ D   F +L+       ++C +SL      S  +
Sbjct: 398 ISSTGDIVNLMSVDV--------QKLQDISQFINLLWSAPFQIVLCLISLYKLLGHSMWV 449

Query: 301 GVLIIPVVISASIF----GKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE---- 352
           GV+I+ +++  + F     K+++ +  + +D   + TRV  E LN +K+++ +  E    
Sbjct: 450 GVIILVIMMPLNSFLMKTQKKLQKSQMQFKD---ERTRVISEILNNIKSLKLYAWETPYK 506

Query: 353 -QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 411
            + E  R N+ ++N+  +G   A ++ +F     LV   +F  V VY     L   L   
Sbjct: 507 AKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCSTF-AVFVYTEDRPLTTDLVFP 565

Query: 412 DLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGE 471
            LT F L        +  +    + +++ + +  RLF         + ++ +  LP   E
Sbjct: 566 ALTLFNL----LHFPLMVIPNVLTALIECSVSVGRLFSFLTNEELQKDSVQR--LPKVTE 619

Query: 472 IEF------KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
           I         + +F +  +P+ ++  KN+NF+ + G   CIVG  G GKS +   +L   
Sbjct: 620 IGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALIQSILGDL 679

Query: 525 NPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKV 584
               G   I G              +  V Q   +M+G+++DNI +G  Y    E   K 
Sbjct: 680 FRVKGFATIHGN-------------VAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKT 724

Query: 585 AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
            K C     ++       T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D 
Sbjct: 725 IKACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDE 784

Query: 645 E-SEGAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             +   I +  G   L+ TK+  + +  +++S +  +++V +L N G +++ G + E+  
Sbjct: 785 HVARHLIEHVLGPNGLLHTKTKVLAT--NKVSVLSVADSVSLLEN-GEIVQQGSYDEIMK 841

Query: 702 D 702
           D
Sbjct: 842 D 842

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 230/509 (45%), Gaps = 60/509 (11%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L    +KR +H    F D    G +++R   D   +   +T+ +   F        GV +
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVR-LFVYQTANIAGVII 986

Query: 289  MCSLSLDLSAV----LGVLIIPVVISASIFGKQI-RINSRELQDATGQLTRVSEEQLNGV 343
            MC + L   A+    LG++ I V       G++I R+ + +          V    L+G+
Sbjct: 987  MCIIYLPWFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEV----LSGM 1042

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVG--------------- 388
             T++++ +E R + + +  I  +   G     +      S  ++                
Sbjct: 1043 DTIKAYKSENRFLMKSDFLINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQ 1102

Query: 389  -DLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL 447
             D+S  +V V  +Y++    L  G L A M   E   NS+  +  + +E+ Q A      
Sbjct: 1103 FDISAASVGVLLTYVLQLPGLLNGLLRA-MTQAENDMNSVERIVNYATELPQEAAYRK-- 1159

Query: 448  FELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIV 506
                   PE+ P   +   P  GE+ F NVS SY P  P   + K ++  I+ G  + I 
Sbjct: 1160 -------PEMTP---QEPWPSNGEVVFDNVSLSYRPGLPL--VLKGVSLNIKGGEKIGIC 1207

Query: 507  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
            G +G GKSTI   L        G++LIDG D +K+    LRRKL I+ Q+PVL  GSIR 
Sbjct: 1208 GRTGAGKSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRK 1267

Query: 567  NIT-YG------------LTYTPTKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGTL 611
            N+  +G             + T   EE+ KV  Q    +  +   H +  D ++   GT 
Sbjct: 1268 NLDPFGEREDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKFHLDQEVEDDGTN 1327

Query: 612  LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
             S G++Q +A+ RAL+++  ILILDEATS++D E++  I     Q  +    TI+ IAHR
Sbjct: 1328 FSLGERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHR 1385

Query: 672  LSTIRRSENVIVLGNDGSVIEMGKFKELF 700
            L TI   + ++VL N G+V E    + LF
Sbjct: 1386 LKTILNYDRLVVLDN-GTVKEFDTPRSLF 1413

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 107/211 (50%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FKNLNF+I+ G  V I G  G GKS++   L  +   T G I  +G         SL   
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL--- 618

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G ++   +   ++V + C     +   P    T+IG  G
Sbjct: 619 --LLCGYPWIQNTTVRDNILFGSSFDDVR--YKEVIRVCALQADLDILPAGDFTEIGERG 674

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++     ++  K+  + + 
Sbjct: 675 ITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGKTRILAT- 733

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I R+  VI LG  GS  ++G  +EL
Sbjct: 734 -HQLSLIERASRVIFLGAGGS-FDIGTVEEL 762

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 139/545 (25%), Positives = 250/545 (45%), Gaps = 59/545 (10%)

Query: 190  GLTIYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIH 248
             + +++F+G ++ I + +    N          + R   +L   +    ++   QF++  
Sbjct: 1000 NIDVWKFVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETT 1059

Query: 249  KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV 308
              G +++R  AD   V  ++       FKS+    + V ++ ++S+ L  V  + ++ + 
Sbjct: 1060 PIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITV-ILITISMPLFLVFCLFLMVIY 1118

Query: 309  ISASIFGKQIRINSRELQDATG----QLTRVSEEQLNGVKTVQS------FVAEQREIKR 358
            I    + K   + SREL+  T      +  +  E L G+  +++      F     E  +
Sbjct: 1119 IY---YQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQ 1175

Query: 359  FNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 418
            FN  I  +F     + +++ +  T  +L   +  +T ++  S +     LT G +   M 
Sbjct: 1176 FN--INCVFDYRSTNRWLSIRLQTIGAL---MVLITGMLSLSTISSSKPLTAGMVGLLMS 1230

Query: 419  YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTLGKTYLPGKGE 471
            Y      S+  +      I  G  +  R+ E  +        V + RP    +  P KG 
Sbjct: 1231 YVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDDYRPA---SNWPSKGA 1287

Query: 472  IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
            I+FKN S  Y     + + KN++  I PG  V IVG +G GKST+ L L     P  G I
Sbjct: 1288 IQFKNYSTRYRAN-LDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTI 1346

Query: 532  LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN-----------ITYGLTYTPTKEE 580
            +IDG DI+K+    LR  L I+ Q+     G++R N           +   +T +  K  
Sbjct: 1347 IIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPH 1406

Query: 581  IRKVAKQCFCHNFITKFPHTYDTQIG--PSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
            ++K+ ++       ++ P     ++G   SG+ LS GQ+Q + +ARAL+ +  IL+LDEA
Sbjct: 1407 LKKLMEESG-----SELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEA 1461

Query: 639  TSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
            T+++DVE++  I  T  +    +  TI++IAHR+ T+  S+ ++VL       E G+ KE
Sbjct: 1462 TASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-------EQGEVKE 1512

Query: 699  LFSDP 703
             F+ P
Sbjct: 1513 -FNSP 1516

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 101/219 (46%), Gaps = 28/219 (12%)

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-------QILIDGQDITKMNSKSLR 547
           F+ +     C+VG  G GK+T+   +L     TSG       +++I G+ +         
Sbjct: 654 FRAKKNVLTCVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESV--------- 704

Query: 548 RKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGP 607
                  QE  +M+ SI++NI +G  Y  T   +    K C         P   +T +G 
Sbjct: 705 ---AYCPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGE 759

Query: 608 SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ----LMKTKSM 663
            G  LSGGQK R+++ARA+  + +I +LD+  SA+D     +I +        L+K K+ 
Sbjct: 760 KGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA- 818

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            I+   + +S +  S+ + VL  DG +IE   + E   D
Sbjct: 819 -IILTTNDISVLEHSDRIYVL-QDGRIIEESTYAEAIED 855

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 146/552 (26%), Positives = 254/552 (46%), Gaps = 76/552 (13%)

Query: 181  EAPPPIMMFGLTIYEFLGGFSIALLAGC--MANFGXXXXXXXXSERLVARLRSTVIKRTI 238
            E  P    + L+IY FL G + +LLA    + NF           R   ++  +++ RT+
Sbjct: 1099 ERKPHSTFYYLSIY-FLIGLTQSLLAASKSVLNF-------VLGIRASRKIFESLLYRTL 1150

Query: 239  HQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLS---LD 295
            H    F+D    G +++R   D   V + +T  +   F  L+     + ++  ++   L 
Sbjct: 1151 HAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAAFFCLVQCIATMALITFITPQFLS 1210

Query: 296  LSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVA 351
            ++ ++G L   V       G      SREL+     +   + +   E L GV T++++  
Sbjct: 1211 VAILVGCLYYLV-------GYFYMAASRELKRFESISKSPIYQHFSETLVGVATIRAYGD 1263

Query: 352  EQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIG 411
            E R +      + N+  + +     N  FF        LSF   ++ G++++    + I 
Sbjct: 1264 ESRFM------LENLHKIDEN----NKPFFYLWVFNRWLSFRIDMI-GAFVIFGAGVFIL 1312

Query: 412  -------------DLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY----V 454
                          LT  + +TE        L  FY+++     +  RL E  +      
Sbjct: 1313 TNIKNIDSGMAGISLTYAISFTE----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPY 1368

Query: 455  PEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
             E + TL     P  G+IE K++S  Y P  P+  + KN++F +EP + + IVG +G GK
Sbjct: 1369 DEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLPK--VIKNVSFVVEPKTKIGIVGRTGAGK 1426

Query: 514  STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
            STI   +  + NP SG I ID  +I  +N   LRR + I+ Q+P L +G+I+ N+     
Sbjct: 1427 STIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNE 1486

Query: 574  YTP-------------TKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRI 620
            +T              T+EE++    Q        KF +  + +I   G+ LS GQ+Q +
Sbjct: 1487 FTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNL-ENEITEGGSNLSHGQRQLV 1545

Query: 621  AIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSEN 680
             +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI++IAHRL ++   + 
Sbjct: 1546 CLARSLLRNPKIILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDK 1603

Query: 681  VIVLGNDGSVIE 692
            +IV+ + G V E
Sbjct: 1604 IIVM-DAGEVKE 1614

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 120/465 (25%), Positives = 215/465 (46%), Gaps = 44/465 (9%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLII----P 306
           G +I+ +  DA+ VS  I   +    +++I   V + ++  L L  +A +G  +I    P
Sbjct: 493 GAIINLMAVDAFKVSE-ICGYLHFFVEAVIMVFVAITLLYKL-LGYAAFVGAALIIACLP 550

Query: 307 VVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ---REIKRFNEAI 363
           + +  + F  +++  S    D   Q      E L  ++ ++ F  E    R+IK   E  
Sbjct: 551 LNLKLATFLGKLQKESLGFTDKRIQKLN---ETLQAIRIIKFFSWEDNFSRDIKEVRE-- 605

Query: 364 RNIFHVGKRS---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTAFML 418
           + +  + KRS   AF +  +F + S+V   SF        Y+ + G +  T    TA  L
Sbjct: 606 KELHLLLKRSLIWAFSSFVWFVTPSIVTSASF------AFYIYVQGEVLTTPVAFTALSL 659

Query: 419 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGK--GEIEFKN 476
           +T      +  LS   S ++Q   +  R+    D++ E            K    I FKN
Sbjct: 660 FT-LLKTPLDQLSNMISFVIQSKVSLDRI---QDFLGEQDTDKYNQLTIDKLGNRIAFKN 715

Query: 477 VSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG- 535
           V+ ++    ++   ++LN + +PG+   ++GP+G GK+++ L LL       G+I++   
Sbjct: 716 VTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEIIVPAL 775

Query: 536 ---QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHN 592
              QD+  ++   L   +    Q   L++ ++R+NI +   Y   +E    V   C    
Sbjct: 776 NPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYN--EERYNAVIDACGLRR 832

Query: 593 FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-- 650
            +     +  T+IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  
Sbjct: 833 DLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTALWIYD 892

Query: 651 NYTFGQLMKTKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVIEMG 694
           N   G LM  ++  +VS  H ++ T++ +E V++L N G V + G
Sbjct: 893 NCITGPLMSGRTCILVS--HNIALTLKNAELVVILEN-GRVKDQG 934

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 141/482 (29%), Positives = 228/482 (47%), Gaps = 45/482 (9%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y +   + +  S  F + +     + ++C+ +     V    
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAVICATTWQFIFV---- 1094

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            IIP+ +    + +     SREL+     +TR       +E L G+ T++ +  E    KR
Sbjct: 1095 IIPLGVFYIYYQQYYLRTSRELR-RLDSITRSPVYSHFQETLGGITTIRGYNQE----KR 1149

Query: 359  FNEAIRNIFHVGKRSAF---INAKFFTS--TSLVGDLSFLTVLVYGSYLVLHGSLT---I 410
            F   I         SAF   INA  + +    L+G +  L       + +  G+LT   +
Sbjct: 1150 FGH-INQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMV 1208

Query: 411  GDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTLGK 463
            G   ++ L    T N I  ++    E+     +  R+ E           V E RP    
Sbjct: 1209 GLSLSYALQITQTLNWIVRMTV---EVETNIVSVERVKEYAQLESEAPRIVEEKRP---D 1262

Query: 464  TYLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
               P +G+I+F+N S  Y  RP+ + + KN+N  I P   V IVG +G GKS++ L L  
Sbjct: 1263 EMWPTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFR 1320

Query: 523  YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR 582
                T+G I+IDG  I ++    LR KL I+ Q+  +  G++R+NI    T   T EEI 
Sbjct: 1321 IIEATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIW 1378

Query: 583  KVAKQCFCHNFITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            +V +       +        D Q+   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A
Sbjct: 1379 RVLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAA 1438

Query: 642  LDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            +DVE++  +  T     K +  TI++IAHRL+TI  S+ +IVL + G ++E     EL +
Sbjct: 1439 VDVETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLA 1495

Query: 702  DP 703
             P
Sbjct: 1496 KP 1497

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 115/476 (24%), Positives = 214/476 (44%), Gaps = 57/476 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   F +++  G     +C  SL      S  +G +
Sbjct: 399 TGDIVNLMSVDV--------QKLQDLMQFLNILWSGPFQIFICLFSLYKLLGHSMWVGFI 450

Query: 304 IIPVVISASIFGKQIRINSRELQDATGQL----TRVSEEQLNGVKTVQSFVAE---QREI 356
           I+  +I  + +  +I+   R+LQ    Q     T V  E LN +K+++ +  E   Q ++
Sbjct: 451 ILVFMIFLNSYLVRIQ---RKLQKQQMQFKDERTGVISEILNNIKSLKLYAWEVPYQTKL 507

Query: 357 K--RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
              R ++ + N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 508 NHVRNDKELHNLTKLGCYMAVTSFQFNIVPFLVSCATF-AVFVYTENKPLTTDLVFPALT 566

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLP---GKGE 471
            F L +      +  +    +  ++ + + +RLF         + ++ +  LP    KG+
Sbjct: 567 LFNLLS----FPLMVVPNVITSFVEASVSVNRLFSFLTNEELQKDSIQR--LPKVENKGD 620

Query: 472 IEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPT 527
           +      N +F +  +P+ ++  KN+NF+ + G   CIVG  G GKS +   +L      
Sbjct: 621 VAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRV 680

Query: 528 SGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G   + G              +  V Q P +M+G++++NI +G  Y   +E   K  K 
Sbjct: 681 KGFATVHGN-------------VAYVSQVPWIMNGTVKENILFGHKYD--QEFYEKTIKA 725

Query: 588 CFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-S 646
           C     +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   S
Sbjct: 726 CALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVS 785

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           +  + +  G      S T V   +++S +  ++++ +L N G +++ G ++E+ SD
Sbjct: 786 KHLVEHVLGPTGLLHSKTKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEVNSD 840

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 170/653 (26%), Positives = 282/653 (43%), Gaps = 74/653 (11%)

Query: 86   SQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKXXXXXX 145
             +LT  +  +T  +Q+ D  QP + G+  ST EE   N   V     + K   K      
Sbjct: 838  EELTELKKKTTQMSQTTDTAQPVVNGHT-STKEERAVNSIGVN----VYKEYIKVAVGRW 892

Query: 146  XXXXISCVIGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMM-----FGLTIYEFLGG- 199
                +     +++      +  S+ +   T+++ +  PP   M     F    + F+ G 
Sbjct: 893  GFVTLPLYFVLVVGTTFCSLFSSVWLSYWTENKFKNRPPSFYMGLYSFFVFAAFIFMNGQ 952

Query: 200  FSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGA 259
            ++I  + G MA+                 L    +KR +H    + D    G +++R   
Sbjct: 953  YTILCVMGIMAS---------------KWLNLKAVKRILHTPMSYIDTTPLGRILNRFTK 997

Query: 260  DAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAV-LGVLIIPVVISASIF---G 315
            D   +   +T+ +     S     VGV +MC + L   A+ +  L++  V+ A  +   G
Sbjct: 998  DTDSLDNELTESLR-LLTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSG 1056

Query: 316  KQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSA 374
            ++I R+ + +       L  V    L G+ T++++ +++R + + +  I  +   G    
Sbjct: 1057 REIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVV 1112

Query: 375  FIN---AKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLS 431
             +      F    ++V  L    + V  ++ +   + ++G L  ++L      N+I    
Sbjct: 1113 VLQRWVGVFLDMVAIVFALIVTLLCVTRAFPI--SAASVGVLLTYVLQLPGLLNTILRAM 1170

Query: 432  TFYSEIMQGA----GAASRLFELTDY-VPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRP 485
            T     M  A      A+ L    DY  PE+ P       P KGEI  +NV FSY P  P
Sbjct: 1171 TQTENDMNSAERLVSYATELPLEADYRKPEMTPP---ESWPSKGEIVLENVCFSYRPGLP 1227

Query: 486  QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKS 545
               + KNLN  IE G  + I G +G GKSTI   L      ++G+ILID  DI+K+    
Sbjct: 1228 V--VLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLFD 1285

Query: 546  LRRKLGIVQQEPVLMSGSIRDNIT-----------------YGLTYTPTKEEIRKVAKQC 588
            LRRKL I+ Q+PVL  G+IR N+                    +      E   +   + 
Sbjct: 1286 LRRKLAIIPQDPVLFRGTIRKNLDPFDERTDDELWDALVRGGAIAKNDLSEAKLQKPDKN 1345

Query: 589  FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 648
              H  + KF    D  +   G+  S G++Q +A+ RAL+++  ILILDEATS++D E++G
Sbjct: 1346 GTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDG 1403

Query: 649  AINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             I     +  +    TI+ IAHRL TI   + ++VL   G V E      LF+
Sbjct: 1404 KIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAEFDTPWTLFT 1453

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FK+LNF+I+ G  + I GP G GKS++   +      T G+I ++G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + +  +RDNI +G  +   KE+  +V + C     +   P    T+IG  G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     ++  K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I R+  VIVLG DG V ++G   EL
Sbjct: 767 -HQLSLIERASRVIVLGTDGQV-DIGTVDEL 795

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 140/493 (28%), Positives = 230/493 (46%), Gaps = 35/493 (7%)

Query: 227  ARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV 286
            ARL   + K  +     F++    G +++R   D Y V   + +  S  F  +      +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTM 1074

Query: 287  GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS--------EE 338
             ++CS++          I+P+ +    + +     SREL+    +L  V+        +E
Sbjct: 1075 IVICSITWQFI----FFILPLSVLYLFYQQYYLRTSRELR----RLASVTKSPVYAHFQE 1126

Query: 339  QLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL--VGDLSFLTVL 396
             L GV TV+SF  + R I   N++  N +      + INA  + +  L  +G +  L   
Sbjct: 1127 TLTGVTTVRSFKKQDRFI-HINQSRINTYMCAYYLS-INANRWLAFRLEFMGSIVILAAA 1184

Query: 397  VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE 456
            V   + +  G LT G L   + Y      S+  +     E+     +  R+ E TD  PE
Sbjct: 1185 VLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPE 1244

Query: 457  ---IRPTLG--KTYLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSG 510
               I PT    K + P  G+I+F++ S  Y  RP+ + I +++N  I P   V IVG +G
Sbjct: 1245 APMIIPTSRPPKNW-PANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTG 1301

Query: 511  KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570
             GKS++ + L       +G+ILID   I  +    LR  L I+ Q+  +  G+ R+NI  
Sbjct: 1302 AGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDP 1361

Query: 571  GLTYTPTKEEIRKVAKQCFC-HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629
               +  T +EI    +      + +T      +T +   G+ LS GQ+Q + +ARAL+  
Sbjct: 1362 CNKF--TDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVP 1419

Query: 630  PNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGS 689
              IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G 
Sbjct: 1420 SKILVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGR 1476

Query: 690  VIEMGKFKELFSD 702
            + E      L  D
Sbjct: 1477 IAEFDTPCNLLKD 1489

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 112/476 (23%), Positives = 214/476 (44%), Gaps = 56/476 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSLD------LSAVLG 301
           TGD+++ +  D         Q++ D   +  LI  G    ++C  SL       + A + 
Sbjct: 389 TGDIVNLMSVDV--------QRLQDLSQWGHLIWSGPFQIILCLFSLYKLLGPCMWAGVF 440

Query: 302 VLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ-----REI 356
           +++I + +++ I G Q ++   ++++   + TR+  E LN +K+++ +  EQ      + 
Sbjct: 441 IMVITIPLNSLIMGIQKKLQGVQMKNKDKR-TRIISEILNNIKSLKLYAWEQPYKAKLDY 499

Query: 357 KRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416
            R  + ++N+  +G  +     +F     +V   +F T ++      L   L    L  F
Sbjct: 500 VRNEKELKNLVKIGITNTISVFQFSVVPFMVSCATFGTFVLTQKDKALSTDLIFPALALF 559

Query: 417 MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKN 476
            L +   G      ++F    ++ + +  RL          R  +   +LP   EI   +
Sbjct: 560 NLLSFPLGFIPMAATSF----IEASVSIKRLHSFLTSGEIQRDAI--QHLPKVEEIGDIS 613

Query: 477 VSFS------YPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           V+ S      +  +P+ ++  KN+NF+   G   CIVG  G GKS +   +L        
Sbjct: 614 VNISGDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML-------- 665

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
                G       S +L   +  V Q   +M+G+I+DNI +G  Y    E   K  K C 
Sbjct: 666 -----GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKTIKACA 718

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEG 648
               +   P    T +G  G  LSGGQK R+A+ARA+  K ++  LD+  +A+D   S+ 
Sbjct: 719 LSLDLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKH 778

Query: 649 AINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            + Y  G   L+KTK+  + +  +++  +  ++++ +L N G +++ G + ++ S+
Sbjct: 779 LVKYVIGPTGLLKTKTRILTT--NKIHVLSVADSITLLDN-GVIVQQGSYDQVNSN 831

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 141/555 (25%), Positives = 263/555 (47%), Gaps = 63/555 (11%)

Query: 172  QTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRS 231
            + A  +  E   P  M + L IY FL GF+ ++L+                     ++ +
Sbjct: 1127 RVAVATGAEPVGPHSMFYYLAIY-FLIGFAQSVLSAFKTILSFVAGLNASK-----KIFN 1180

Query: 232  TVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCS 291
             ++++ +H   +F+D    G +++R   D   V + +T      F SL+     V ++  
Sbjct: 1181 LLLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITF 1240

Query: 292  LSLDLSAVLGVLIIPVVISASIF--GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKT 345
            ++         LI+ V+++   +  G      SREL+  D+  +  + +   E L GV T
Sbjct: 1241 ITPQF------LIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTT 1294

Query: 346  VQSFVAEQREIK----RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSY 401
            +++F  E R I+    + +E  R  F++   + ++  +      L+G L    V   G +
Sbjct: 1295 IRAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMR----IDLIGSL---VVFGAGVF 1347

Query: 402  LVLH-----GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE--LTDYV 454
            ++L+       +    LT  + +TE        L   YS +     +  RL E  + +  
Sbjct: 1348 ILLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQE 1403

Query: 455  PEIRPTLGK-TYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKG 512
            P  +P +   +  P  G +E  +VS  Y P  P+  + KN++F +EP S V +VG +G G
Sbjct: 1404 PYNQPIMTPPSDWPQHGRVEMSDVSLRYAPGLPR--VIKNVSFTVEPKSKVGVVGRTGAG 1461

Query: 513  KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL 572
            KSTI   L  + +P +G I ID  DI+ ++ + LRR + I+ Q+P L +G+I+ N+    
Sbjct: 1462 KSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYD 1521

Query: 573  TYTP-------------TKEEIRK--VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQK 617
             Y+              ++EE+ +  +         + KF    +++I   G  LS GQ+
Sbjct: 1522 EYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQR 1580

Query: 618  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
            Q + +AR+L++ P I++LDEAT+++D +S+  I  T  +  + +  TI++IAHRL ++  
Sbjct: 1581 QLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRK--EFQGNTILTIAHRLRSVID 1638

Query: 678  SENVIVLGNDGSVIE 692
             + ++V+ + G V E
Sbjct: 1639 YDKILVM-DQGEVKE 1652

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 116/479 (24%), Positives = 208/479 (43%), Gaps = 72/479 (15%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  DA+ VS  I   +    +++    V + ++  L L LSA++G L+I V++ 
Sbjct: 528 GAIINLMAVDAFKVSE-ICAYLHAFVEAVAMSCVAIVLLYKL-LGLSAIIGALLIVVLMP 585

Query: 311 ASIFGKQIRINSRELQDATGQLTRVS-----------EEQLNGVKTVQSFVAEQREIKRF 359
                    +N R L    GQL + S            E    ++ ++ F  E    ++ 
Sbjct: 586 ---------VNFR-LVTWLGQLQKKSLSYTDKRIQNLNEAFQAIRIIKFFSWED-NFEKG 634

Query: 360 NEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLY 419
            +AIR++            K     SL+  L            V + + TI   +AF  Y
Sbjct: 635 IQAIRDV----------ELKLLLQRSLIWALC---------SFVWYATPTIVTTSAFAFY 675

Query: 420 -----------TEYTGNSIFGL--------STFYSEIMQGAGAASRLFELTDYVPEIRPT 460
                        +T  S+F L        S   S ++Q   +  R+ E  +  P+    
Sbjct: 676 IYVQKQTLTTPVAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLEE-PDTDKY 734

Query: 461 LGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLL 520
              +  PG  ++ F+N + S+ +  Q+   +NLN   + G    ++GP+G GK++I + L
Sbjct: 735 NQLSVAPGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMAL 794

Query: 521 LHYYNPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT 577
           L      +G I++   D + +  +++  +   +    Q   L++ ++R+NI +   Y+  
Sbjct: 795 LGEMKLLNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEA 854

Query: 578 KEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDE 637
           +     V + C              T+IG  G  LSGGQKQRI++AR+L      L+LD+
Sbjct: 855 R--YNDVIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDD 912

Query: 638 ATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
             SA+D  +   I  N   G LM+ +  T + I+H ++   R+  ++VL  +G V E G
Sbjct: 913 CLSAVDSHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 154/553 (27%), Positives = 259/553 (46%), Gaps = 100/553 (18%)

Query: 187  MMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYD 246
            M++ L +Y F  GF  ALL G + N          S ++   +   V+    H   +F+D
Sbjct: 1044 MLYYLGMY-FAIGFIQALLGG-IKNIATFFSGIQASRKIFDNMLDLVL----HAKIRFFD 1097

Query: 247  IHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIP 306
            +   G +++R   D   V + +T  +             V M C +       L  +I P
Sbjct: 1098 VTPIGRIMNRFAKDIEGVDQELTPYLE------------VTMFCLIQCTSIIFLITIITP 1145

Query: 307  --VVISASIF------GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQSFVAEQR 354
              ++++  +F      G      SREL+  D+  +  + +   E L GV T+++F  E+R
Sbjct: 1146 HFLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAFGDEKR 1205

Query: 355  ----EIKRFNEAIRNIFHVGKRSAFINAKFFT-STSLVGDLSFLTVLVYGSYLVLH-GSL 408
                 + + ++  R  F++      +  K+F     ++G  +F+ VL  GS+++++ G++
Sbjct: 1206 FILENLDKIDQNNRAFFYLS-----VAVKWFAFRVDIIG--AFI-VLASGSFILINIGNI 1257

Query: 409  TIG----DLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT--------DYVPE 456
              G     LT  +L+T+        L   YS       +  RL E +        DY  +
Sbjct: 1258 DSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYNKD 1313

Query: 457  IRPTLGKTYLPGKGEIEFKNVSFSYPTR--PQNQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
                L ++  P  G+IE  N+S  Y +   P   + KN++F IEP S V IVG +G GKS
Sbjct: 1314 HIQELQQSSWPEHGQIEVDNLSLRYASNLPP---VIKNVSFTIEPQSKVGIVGRTGAGKS 1370

Query: 515  TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
            TI   L     P +G I IDG DI++++  +LRR + I+ Q+P+L +G+I+ N+     Y
Sbjct: 1371 TIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDEY 1430

Query: 575  TPTKEEIRKVAKQCFCHNFIT-------------------KFPHTYDTQIGPSGTLLSGG 615
               K  I KV  Q    N I+                   KF +   T+I   G  +S G
Sbjct: 1431 DNKK--IFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFVNL-QTEITEGGQNISQG 1484

Query: 616  QKQRIAIARALIKKPNILILDEATSALDVESE----GAINYTFGQLMKTKSMTIVSIAHR 671
            ++Q + IAR+L+++P I++LDEATS++D ES+    G I   F +       TI++IAHR
Sbjct: 1485 ERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNK------STILTIAHR 1538

Query: 672  LSTIRRSENVIVL 684
            L ++   + V+V+
Sbjct: 1539 LRSVIDYDRVLVM 1551

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 120/469 (25%), Positives = 215/469 (45%), Gaps = 39/469 (8%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  D++ VS  I+       +++I   + VG++    L +SA+ G+ II ++  
Sbjct: 448 GTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKF-LGISALAGISIILMMFP 505

Query: 311 -----ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ---REIK--RFN 360
                A + GK        LQ    ++ +++E  L  ++ V+ F  E    ++IK  R N
Sbjct: 506 LNFRLAELLGK---FQKSALQCTDKRIAKLNE-CLQNIRIVKYFAWENNISKDIKSIRQN 561

Query: 361 EAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT 420
           E +R +F      A  +  +F + +LV  ++F  + ++  +  L+  L    L+ F L  
Sbjct: 562 E-LRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTLSLFTLLK 619

Query: 421 EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFS 480
                 +  LS   S + Q   +  R+ +  +   +       T  P + +IEFKN + +
Sbjct: 620 ----TPLDQLSNMLSFMNQSIVSLDRIVKFINE-DDTEKYNQLTVSPDENKIEFKNATLT 674

Query: 481 YPTRPQNQ-IFK--NLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG-- 535
           +    ++  IFK   LN   + G    I+G +G GKS + + LL   +  SG I + G  
Sbjct: 675 WNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHLISGSITVPGLE 734

Query: 536 --QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNF 593
              D+   +   L        Q   L++ ++++NI +   Y   +   ++V   C     
Sbjct: 735 PRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--YKEVIDACGLKRD 791

Query: 594 ITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--N 651
           +   P    T+IG  G  LSGGQKQRI++ARA+      ++LD+  SA+D  +   I  N
Sbjct: 792 LEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYEN 851

Query: 652 YTFGQLMKTKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVIEMGKFKEL 699
              G +M+ +  T + + H +S TIR +   ++L N G V   G  K+L
Sbjct: 852 CITGPIMENR--TCILVTHNVSLTIREAYFAVILEN-GKVKNQGTIKQL 897

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 133/476 (27%), Positives = 225/476 (47%), Gaps = 35/476 (7%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++C+ +     +    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVIFTITVICATTWQFIFI---- 1096

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            IIP+ +    + +     SREL+     +TR       +E L G+ TV+ + ++Q+    
Sbjct: 1097 IIPLGVCYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1154

Query: 359  FNEA-IRNIFHVGKRSAF---INAKFFTS--TSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
             N+  I N       SAF   INA  + +    L+G +  L       + +  G+LT G 
Sbjct: 1155 INQCRIDN-----NMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGM 1209

Query: 413  LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE----IRPTLGKTYLPG 468
                + Y      ++  +     E+     +  R+ E  D   E    I   +     P 
Sbjct: 1210 AGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPS 1269

Query: 469  KGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPT 527
            +G+I+F N S  Y  RP+ + + K++N  I+P   + IVG +G GKS++ L L      +
Sbjct: 1270 QGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEAS 1327

Query: 528  SGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            +G I+IDG  I ++    LR +L I+ Q+  +  GS+R+NI     Y  T E I +  + 
Sbjct: 1328 AGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQY--TDEAIWRALEL 1385

Query: 588  CFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
                  +    +   D Q+   G  LS GQ+Q + +ARA++    ILILDEAT+A+DVE+
Sbjct: 1386 SHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVET 1445

Query: 647  EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            +  +  T     K +  TI++IAHRL+TI  S+ +IVL N G+V E     +L S+
Sbjct: 1446 DKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSN 1498

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 117/476 (24%), Positives = 214/476 (44%), Gaps = 57/476 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QKI D   + +LI  G    ++C  SL      S  +GV+
Sbjct: 403 TGDIVNLMSVD--------VQKIQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVI 454

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQ-----R 354
           I+ +++  + F  +I+   ++LQ +      + TRV  E LN +K+++ +  E+      
Sbjct: 455 ILVIMMPLNSFLMRIQ---KKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKL 511

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R N+ ++N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 512 EDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALT 570

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TDYVPEIRPTLGKTYLPGKGE 471
            F L +      +  +    +  ++ + +  RLF      +  P+    L K    G   
Sbjct: 571 LFNLLSF----PLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVENFGDVA 626

Query: 472 IEF-KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           I    + +F +  +P+ ++  KN+NF+ + G   C+VG  G GK+ +   +L       G
Sbjct: 627 INVGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKG 686

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
              + G              +  V Q P +M+G++ +NI +G  Y    E   K  K C 
Sbjct: 687 FATVHGS-------------VAYVSQVPWIMNGTVMENILFGHKYDV--EFYEKTIKACA 731

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEG 648
               +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   +  
Sbjct: 732 LTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARH 791

Query: 649 AINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            I +  G   L+ TK+  + +  +++S +  +++V +L N G +I+ G + E+  D
Sbjct: 792 LIEHVLGPNGLLHTKTRLLAT--NKVSALSIADSVALLDN-GEIIQKGTYDEITKD 844

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  146 bits (368), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 134/478 (28%), Positives = 232/478 (48%), Gaps = 37/478 (7%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++C  +     +    
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIVICFTTWQFIFI---- 1093

Query: 304  IIPVVISASIFGKQIRINSRELQ--DATGQLTRVS--EEQLNGVKTVQSFVAEQREIKRF 359
            IIP+ +    + +     SREL+  D+  +    S  +E L G+ T++ +  +Q      
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGY-QQQHRFTHI 1152

Query: 360  NEAIRNIFHVGKRSAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
            N+   +       SAF   +NA  + +  L  +G L  L       + +  G+LT G + 
Sbjct: 1153 NQCRVD----NNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVG 1208

Query: 415  AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTLGKTYLP 467
              + Y      S+  +     E+     +  R+ E +D        + + RP   +T+ P
Sbjct: 1209 LSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRP--AETW-P 1265

Query: 468  GKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
             +G+I+F++ S  Y  RP+ + I K++N  I+P   V IVG +G GKS++ L L      
Sbjct: 1266 DEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEA 1323

Query: 527  TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKV-A 585
            +SG+I+ID   I ++    LR KL I+ Q+  +  G++R+NI     Y  T E+I  V A
Sbjct: 1324 SSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEY--TDEQIWNVLA 1381

Query: 586  KQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 645
                  + I+      + Q+   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE
Sbjct: 1382 LSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVE 1441

Query: 646  SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            ++  I  T     K +  TI++IAHR++TI  S+ +IVL N G++ E    ++L  +P
Sbjct: 1442 TDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENP 1496

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 112/476 (23%), Positives = 214/476 (44%), Gaps = 57/476 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   F  L+       ++C +SL      S  +GVL
Sbjct: 399 TGDIVNLMSVDV--------QKLQDMCQFIQLLWSAPFQVILCLVSLYKLLGKSMWVGVL 450

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAE-----QR 354
           I+ ++I  + +  +++   ++LQ +      + TRV  E LN +K+++ +  E     + 
Sbjct: 451 ILVIMIPINSYLVRVQ---KKLQKSQMTYKDERTRVISEMLNNIKSLKLYAWEVPYRQKL 507

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R N+ ++N+  +G   A ++ +F     LV   +F    +Y     L   L    LT
Sbjct: 508 ENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCCTF-AAFIYTENRPLTTDLVFPALT 566

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TDYVPEIRPTLGKTYLPGKGE 471
            F L        +  +    + I++ + +  RLF      +   +    L K    G   
Sbjct: 567 LFNL----LHFPLMVIPNVLTMIIETSVSIGRLFSFLTNEELQKDAVQRLPKVTNIGDVA 622

Query: 472 IEF-KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           I    + +F +  +P+ ++  KN+NF+ + G   CIVG  G GKS +   +L       G
Sbjct: 623 INVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSAMIQSILGDLFRVKG 682

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
              I G              +  V Q   +M+G++++NI +G  Y   ++  +K  K C 
Sbjct: 683 FATIHGN-------------VAYVSQVAWIMNGTVKENILFGHKYD--EDFYQKTIKACA 727

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEG 648
               +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   +  
Sbjct: 728 LTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARH 787

Query: 649 AINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            + +  G   L+ TK+  + +  +++S +  +++V +L N G +++ G + E+  D
Sbjct: 788 LVEHVLGPNGLLHTKTKVLAT--NKVSVLSIADSVSLLEN-GEIVQQGTYDEIMKD 840

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 256/541 (47%), Gaps = 48/541 (8%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G +S I + +    N          S R   +L  ++ K  I     F++    G
Sbjct: 1017 VWMFVGVYSLIGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVG 1076

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  S+    S  FKS++   V V ++   ++    V  + ++ + I  
Sbjct: 1077 RIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTV-ILVGYNMPWFLVFNMFLLGIYIYY 1135

Query: 312  SIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQREI----KRFNEAI 363
              F     + SREL+     +   +  +  E LNG   + ++   +R I    ++    I
Sbjct: 1136 QTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNI 1192

Query: 364  RNIFHVGKRSAFINAKFFT-STSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 422
              +F+    + +++ +  T   ++V   + LT+    +   L   + +G L ++ L  E 
Sbjct: 1193 DFVFNFRSTNRWLSVRLQTIGATIVLATAMLTLATMNTKKQLSSGM-VGLLMSYSL--EV 1249

Query: 423  TGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTLGKTYLPGKGEIEFK 475
            TG+  + + T    I     +  R+ E  +         PE RP   K + P +G IEFK
Sbjct: 1250 TGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEAQSINPEKRP--DKNW-PSRGSIEFK 1305

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            + S  Y     + + K++N KIEP   V IVG +G GKST++L L     PT G+I+IDG
Sbjct: 1306 DYSTKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDG 1364

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             +I+ +    LR  L I+ Q+     G+++ N+     Y  +++E++K  +       + 
Sbjct: 1365 INISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKKAVELAHLKPHLE 1422

Query: 596  KF--------------PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            K                   D +I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEAT++
Sbjct: 1423 KMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATAS 1482

Query: 642  LDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL ++GSV E     +L S
Sbjct: 1483 IDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLS 1539

Query: 702  D 702
            +
Sbjct: 1540 N 1540

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 118/489 (24%), Positives = 230/489 (47%), Gaps = 65/489 (13%)

Query: 250 TGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV-GMMCSLSLDL-SAVLGVLI--- 304
           TGD+++ +  D   +     Q+  +  +++I   + V  ++ SL   L  AV+G LI   
Sbjct: 390 TGDILNLMSVDVLRI-----QRFFENAQTIIGAPIQVIVVLTSLYWLLGKAVIGGLITMA 444

Query: 305 IPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEA-- 362
           I + I+A +  K  +++  +++    ++  ++E  LN +K+++ +  E+  +KR N    
Sbjct: 445 IMMPINAFLSRKVKKLSKTQMRYKDMRIKTITE-LLNAIKSIKLYAWEEPMMKRLNHVRN 503

Query: 363 ---IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLY 419
              ++N   +G  S  I   +     +V   +F    ++     L  ++    L+ F + 
Sbjct: 504 DMELKNFRKIGIVSNLIYFAWNCVPLMVACSTFGLFSLFNDS-PLSPAIVFPSLSLFNI- 561

Query: 420 TEYTGNSIFGLSTFYSEIMQGAGAASRL--FELTD-----YVPEIRPTLGKTYLPGKGEI 472
                ++I+ + +  + I++ + +  RL  F L+D     ++  I P++ +  LP    I
Sbjct: 562 ---LNSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTLPV---I 615

Query: 473 EFKNVSFSYPTRP--------------------QNQI-FKNLN-FKIEPGSNVCIVGPSG 510
           E  N++F + ++                      +QI  KN++ F+ + G+ VCIVG  G
Sbjct: 616 EMNNITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVCIVGRVG 675

Query: 511 KGKSTIALLLLHYYNPTSG-QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT 569
            GKST    +L      SG +  I  + I + +S      L    QE  +M+ S+++NI 
Sbjct: 676 AGKSTFLKAILGQLPCMSGSKESIPPKLIIRSSS------LAYCSQESWIMNASVKENIL 729

Query: 570 YGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629
           +G  +     ++    K C     +   P   +T +G  G  LSGGQK R+++ARA+  +
Sbjct: 730 FGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSLARAVYSR 787

Query: 630 PNILILDEATSALDVE-SEGAINYTF-GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
            +I +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ +  L N 
Sbjct: 788 ADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQMIYALEN- 846

Query: 688 GSVIEMGKF 696
           G ++E G +
Sbjct: 847 GEIVEQGNY 855

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  145 bits (365), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 237/510 (46%), Gaps = 73/510 (14%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + ++ + IH   +F+D    G +++R   D   V + +T  ++  F S +     + 
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGV 343
            ++  ++        V+ I + I   + G      SREL+  D+  +  + +   E L GV
Sbjct: 1253 LISWIT----PQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGV 1308

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
             T+++F  E R +K       N+F + +     N  FF        LSF   ++ GS++V
Sbjct: 1309 TTIRAFGDEMRFLKE------NLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSFVV 1357

Query: 404  L-HGSLTIGD------------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL--- 447
               G   + D            LT  + +TE        L  FYSE+     +  R+   
Sbjct: 1358 FGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIKEY 1413

Query: 448  -------FELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPG 500
                   +++ D +    PT+     P +G+IE  ++S  Y      ++ KN++F +EP 
Sbjct: 1414 MSVEQEPYDIKDEIVRTPPTV----WPDEGKIEVNDLSLRYAANLP-RVIKNVSFTVEPN 1468

Query: 501  SNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLM 560
            S V +VG +G GKSTI   L  + +P SG I ID  DIT +    LRR + I+ Q+P L 
Sbjct: 1469 SKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLF 1528

Query: 561  SGSIRDNITYGLTYTP-------------TKEEIR----KVAKQCFCHNFITKFPHTYDT 603
            +G+++ N+     Y               + EE+      V+ Q   H+           
Sbjct: 1529 AGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSN 1588

Query: 604  QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-GQLMKTKS 662
            +I   G  LS GQ+Q I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   +  
Sbjct: 1589 EITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS-- 1646

Query: 663  MTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
             TI++IAHRL ++   + ++V+ + G VIE
Sbjct: 1647 -TILTIAHRLRSVIDYDKILVM-DAGEVIE 1674

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 116/484 (23%), Positives = 215/484 (44%), Gaps = 38/484 (7%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           + +I+ D +     K G +I+ +  DAY +S  I   +    ++++   + + ++  L +
Sbjct: 525 EESINADEESGSNAKLGTIINLMAIDAYKISE-ICAYLHFFAEAIVMTVIALVLLYRL-I 582

Query: 295 DLSAVLGVLIIPVVIS-----ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSF 349
             +A+LG +II V++      A++ G   ++   E      +L     E L  ++ ++ F
Sbjct: 583 GNAAILGTVIILVLLPVNFKLATLLGDYQKLTLGETDKRIHKLN----EALQSIRIIKFF 638

Query: 350 VAE---QREIKRFNEAIRNIFHVGKRS-AFINAKF--FTSTSLVGDLSFLTVLVYGSYLV 403
             E   +R+I    E  R +  + KR+ A++   F  F + S+V   SF        Y+ 
Sbjct: 639 SWENNFERDIMEIRE--RELQMLIKRTLAWVMGGFVWFVTPSIVTTASF------AWYIY 690

Query: 404 LHGSL--TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTL 461
           + G +  T    TA  L+T    + +  +S   S  +Q   +  R+          +   
Sbjct: 691 VQGEVLTTPVAFTALSLFT-LLRDPLDRVSDMLSFAIQSKVSLERVGAFLSEAETEKYEQ 749

Query: 462 GKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL 521
                 GK ++ F N + S+ T       +NLN   + G    ++G +G GK+++ + LL
Sbjct: 750 LTVDNEGK-KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALL 808

Query: 522 HYYNPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK 578
              +   G+I++   + +     NS      +    Q   L++ ++R+NI +  ++   +
Sbjct: 809 GEMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSFDENR 868

Query: 579 EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
               KV + C              T+IG  G  LSGGQKQRI++ARAL      L+LD+ 
Sbjct: 869 --YHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDC 926

Query: 639 TSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKF 696
            SA+D  +   I  N   G LM  ++  +VS  H ++   R+  ++V+  DG V + G  
Sbjct: 927 LSAVDSHTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDP 984

Query: 697 KELF 700
             LF
Sbjct: 985 LNLF 988

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 149/543 (27%), Positives = 255/543 (46%), Gaps = 71/543 (13%)

Query: 188  MFGLTIYEFLGGFSIALLAGC--MANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY 245
            ++ L+IY F  G + AL AG   + NF         S R+  +L S V+    H   +F 
Sbjct: 1107 LYYLSIY-FAIGITQALFAGTKTVINF---VAGINASRRIFKKLLSKVL----HSRLRFI 1158

Query: 246  DIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-CGGVGVGMMCSLSLDLSAVLGVLI 304
            D    G +++R   D   V + +T  +   F  L+ C    +  +  ++      L V +
Sbjct: 1159 DSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQC----ISTIILITFITPQFLFVAV 1214

Query: 305  IPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQR----EI 356
            + V +   + G      SREL+         + +   E L GV T+++F  E R     +
Sbjct: 1215 L-VCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGVATIRAFGDEIRFIMHNL 1273

Query: 357  KRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD---- 412
            ++ +E  +  F++   + ++  +      ++G L     +++GS + +  +L   D    
Sbjct: 1274 EKIDENNKPFFYLWVANRWLAFR----IDMIGAL-----IIFGSGVFILLNLNRIDSGMA 1324

Query: 413  ---LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLG----KTY 465
               LT  + +TE        L  FYS +     +  RL E  D VP+     G     T 
Sbjct: 1325 GISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMD-VPQEPYNEGTITTSTN 1379

Query: 466  LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYN 525
             P +G+IE K++S  Y      ++ K ++F IEP + V IVG +G GKSTI   L  +  
Sbjct: 1380 WPTEGKIEVKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLE 1438

Query: 526  PTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVA 585
            P +G I IDG DIT ++ ++LRR + I+ Q+P L +G+IR N+     Y P +E  R + 
Sbjct: 1439 PETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKY-PDEEIFRVLH 1497

Query: 586  KQCFCHN----------------FITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKK 629
            +     +                 + KF +  + +I   G  LS GQKQ + +ARAL++ 
Sbjct: 1498 RVNLIDDDEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNLSQGQKQLMCLARALLRN 1556

Query: 630  PNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGS 689
            P +++LDEAT+++D  S+  I  T   +      T+++IAHRL ++   + ++V+ + G 
Sbjct: 1557 PKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-DAGE 1613

Query: 690  VIE 692
            VIE
Sbjct: 1614 VIE 1616

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 120/470 (25%), Positives = 213/470 (45%), Gaps = 38/470 (8%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLI----IP 306
           G +I+ +  DA+ VS  I   +    ++++   V   ++  L L  +A++G+LI    IP
Sbjct: 495 GAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKL-LGYAAIVGILIVIGMIP 552

Query: 307 VVIS-ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR---EIKRFNEA 362
           V     S+ GK      ++    T +  +   E L  ++ ++ F  E     EI    EA
Sbjct: 553 VNFKLVSLMGKY----QKKALGITDKRIQKLNEALQAIRIIKFFSWEDNFFSEIDEIREA 608

Query: 363 IRNIF----HVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 418
              ++    +    SAFI   +F + ++V   SF TV +Y    VL   +    L  F L
Sbjct: 609 EIQMYINKAYAWAFSAFI---WFLTPTIVTGASF-TVYIYVQKQVLTAPVAFTALALFQL 664

Query: 419 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVS 478
             +     +  LS   S ++Q   +  R+    D     +    K   P   ++ F+N +
Sbjct: 665 LKQ----PLDQLSNMLSYVIQSKVSLDRVQNFLDEEDTQKYNQLKV-APDGNKLAFENAT 719

Query: 479 FSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI---DG 535
            ++    Q+   K+L+   + G    ++GP+G GK+++ L LL      SG+I++   D 
Sbjct: 720 IAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDA 779

Query: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEE-IRKVAKQCFCHNFI 594
           +    ++S  +   +    Q   L++ ++R+NI   L Y+P  E+  ++V   C      
Sbjct: 780 RHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNI---LFYSPYNEDRYKEVIIACGLKRDF 836

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NY 652
             F     T+IG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I  N 
Sbjct: 837 ELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNC 896

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
             G LM+ ++  +VS  H ++   ++  ++V+  +G +   G    L  D
Sbjct: 897 ITGPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRGDPISLLKD 944

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 153/571 (26%), Positives = 251/571 (43%), Gaps = 63/571 (11%)

Query: 165  ILDSLKVQTATQSEGEEAPPPIMM-----FGLTIYEFLGG-FSIALLAGCMANFGXXXXX 218
            +  S+ +   T+++ +  PP   M     F    + F+ G F+I    G MA+       
Sbjct: 912  LFSSVWLSYWTENKFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMAS------- 964

Query: 219  XXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKS 278
                      L    +KR +H    + D    G +++R   D   +   +T+ +     S
Sbjct: 965  --------KWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTS 1015

Query: 279  LICGGVGVGMMCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLT 333
                 VGV +MC + L   A+ +  L++  V+ A  +   G++I R+ + +       L 
Sbjct: 1016 QFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLN 1075

Query: 334  RVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFIN--AKFFTSTSLVGDLS 391
             V    L G+ T++++ +++R + + +  I  +   G     +      F     +    
Sbjct: 1076 EV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFAL 1131

Query: 392  FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAG-----AASR 446
             +T+L       +  + ++G L  ++L      N+I    T     M  A      A   
Sbjct: 1132 IITLLCVTRAFPISAA-SVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATEL 1190

Query: 447  LFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
              E +   PE+ P       P  GEI F+NV F+Y P  P   + KNLN  I+ G  + I
Sbjct: 1191 PLEASYRKPEMTPP---ESWPSMGEIIFENVDFAYRPGLPI--VLKNLNLNIKSGEKIGI 1245

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
             G +G GKSTI   L      T+G+ILID  DI+++    LRRKL I+ Q+PVL  G+IR
Sbjct: 1246 CGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIR 1305

Query: 566  DNITYGLTYTP-------------TKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGT 610
             N+      T               K+++ +V  Q    N      H +  D  +   G+
Sbjct: 1306 KNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGS 1365

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
              S G++Q +A+ RAL+++  ILILDEATS++D E++G I     +  +    TI+ IAH
Sbjct: 1366 NFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAH 1423

Query: 671  RLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            RL TI   + ++VL   G V E      LFS
Sbjct: 1424 RLKTIVNYDRILVL-EKGEVAEFDTPWTLFS 1453

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 110/211 (52%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FK+LNF I+ G  + I GP G GKS++   +      T G++ ++G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + S+RDNI +G  +   KE+  +V + C     +   P    T+IG  G
Sbjct: 652 --LMCGYPWIQNASVRDNIIFGSPFN--KEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++     ++  K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I R+  VIVLG DG V ++G   EL
Sbjct: 767 -HQLSLIERASRVIVLGTDGQV-DIGTVDEL 795

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 133/477 (27%), Positives = 225/477 (47%), Gaps = 37/477 (7%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++C+ +     +    
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFI---- 1095

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            IIP+ +    + +     SREL+     +TR       +E L G+ TV+ + ++Q+    
Sbjct: 1096 IIPLSVFYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1153

Query: 359  FNEA-IRNIFHVGKRSAF---INAKFFTS--TSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
             N+  I N       SAF   INA  + +    L+G +  L       + +  G+LT G 
Sbjct: 1154 INQCRIDN-----NMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGM 1208

Query: 413  LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY-----LP 467
            +   + Y      ++  +     E+     +  R+ E  D   E  P + + +      P
Sbjct: 1209 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSE-APLIVEGHRPPKEWP 1267

Query: 468  GKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
             +G+I+F N S  Y  RP+ + + K++N  I+P   V IVG +G GKS++ L L      
Sbjct: 1268 SQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEA 1325

Query: 527  TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK 586
            + G I+ID   I ++    LR KL I+ Q+  +  G++R+NI     Y  T E I +  +
Sbjct: 1326 SEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--TDEAIWRALE 1383

Query: 587  QCFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 645
                   +    +   D Q+   G  LS GQ+Q + +ARA++    IL+LDEAT+A+DVE
Sbjct: 1384 LSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVE 1443

Query: 646  SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            ++  +  T     K +  TI++IAHRL+TI  S+ +IVL N G V E     +L SD
Sbjct: 1444 TDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSD 1497

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 115/476 (24%), Positives = 215/476 (45%), Gaps = 57/476 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   + +LI  G    ++C  SL      S  +GV+
Sbjct: 402 TGDIVNLMSVD--------VQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVI 453

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQ-----R 354
           I+ +++  + F  +I+   ++LQ +      + TRV  E LN +K+++ +  E+      
Sbjct: 454 ILVIMMPLNSFLMRIQ---KKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKL 510

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R N+ ++N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 511 EEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALT 569

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TDYVPEIRPTLGKTYLPGKGE 471
            F L +      +  +    +  ++ + +  RLF      +  P+    L K    G   
Sbjct: 570 LFNLLSF----PLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVA 625

Query: 472 IEF-KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           I    + +F +  +P+ ++  KN+NF+ + G+  CIVG  G GK+ +   +L       G
Sbjct: 626 INIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKG 685

Query: 530 QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
              + G              +  V Q P +M+G++++NI +G  Y    E   K  K C 
Sbjct: 686 FATVHGS-------------VAYVSQVPWIMNGTVKENILFGHRYDA--EFYEKTIKACA 730

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEG 648
               +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   +  
Sbjct: 731 LTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARH 790

Query: 649 AINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            I +  G   L+ TK+  + +  +++S +  ++++ +L N G + + G + E+  D
Sbjct: 791 LIEHVLGPNGLLHTKTKVLAT--NKVSALSIADSIALLDN-GEITQQGTYDEITKD 843

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 134/479 (27%), Positives = 225/479 (46%), Gaps = 41/479 (8%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++C+ +     +    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFI---- 1096

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            IIP+ +    + +     SREL+     +TR       +E L G+ TV+ + ++Q+    
Sbjct: 1097 IIPLGVFYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1154

Query: 359  FNEA-IRNIFHVGKRSAF---INAKFFTS--TSLVGDLSFLTVLVYGSYLVLHGSLTIGD 412
             N+  I N       SAF   INA  + +    L+G +  L       + +  G+LT G 
Sbjct: 1155 INQCRIDN-----NMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGM 1209

Query: 413  LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTY 465
            +   + Y      ++  +     E+     +  R+ E  D   E        RP   K +
Sbjct: 1210 VGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPP--KQW 1267

Query: 466  LPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
             P +G+I F N S  Y  RP+ + + K +N  I+P   V IVG +G GKS++ L L    
Sbjct: 1268 -PAQGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMI 1324

Query: 525  NPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKV 584
              + G I+IDG  I ++    LR KL I+ Q+  +  G++R+NI     Y  + E I + 
Sbjct: 1325 EASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQY--SDEAIWRA 1382

Query: 585  AKQCFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
             +       +    +   D Q+   G+ LS GQ+Q + +ARA++    IL+LDEAT+A+D
Sbjct: 1383 LELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVD 1442

Query: 644  VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            VE++  +  T     K +  TI++IAHRL+TI  S+ +IVL N G V E     +L S+
Sbjct: 1443 VETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDTPGQLLSN 1498

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 115/478 (24%), Positives = 217/478 (45%), Gaps = 61/478 (12%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   + +LI  G    ++C  SL      S  +GV+
Sbjct: 403 TGDIVNLMSVD--------VQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVI 454

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQ-----R 354
           I+ +++  + F  +I+   ++LQ +      + TRV  E LN +K+++ +  E+      
Sbjct: 455 ILVIMMPLNSFLMRIQ---KKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKL 511

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R N+ ++N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 512 EEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALT 570

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGK---GE 471
            F L +      +  +    +  ++ + +  RLF       E++P      LP     G+
Sbjct: 571 LFNLLS----FPLMIIPMVLNSFIEASVSIGRLFSFFTN-EELQPD-SVQRLPNVENIGD 624

Query: 472 IEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPT 527
           I      + +F +  +P+ ++  KN++F+   G+  CIVG  G GK+ +   +L      
Sbjct: 625 IAINIGDDATFLWQRKPEYKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRV 684

Query: 528 SGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G   + G              +  V Q P +M+G++++NI +G  Y    E   K  K 
Sbjct: 685 KGFATVHGC-------------IAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKA 729

Query: 588 CFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-S 646
           C     +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   +
Sbjct: 730 CALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVA 789

Query: 647 EGAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              I +  G   L+ TK+  + +  +++S +  ++++ +L N G +I+ G + ++  D
Sbjct: 790 RHLIEHVLGPNGLLHTKTRILAT--NKVSALSIADSIALLDN-GEIIQQGAYSDITKD 844

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 147/543 (27%), Positives = 240/543 (44%), Gaps = 60/543 (11%)

Query: 196  FLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLIS 255
            ++G +S  + AG +              R    L    + R +H    + D    G +++
Sbjct: 951  YMGLYSFFVFAGYLFTSSQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILN 1010

Query: 256  RLGADAYIVSRSITQKISDGFKSLI---CGGVGVGMMCSLSLDLSAVLGVLIIPVV-ISA 311
            R   D    + S+  ++++  + ++      VGV +MC + L   A+     IP + I  
Sbjct: 1011 RFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAI----AIPFLFIGF 1062

Query: 312  SIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVKTVQSFVAEQREIKRFNEAIRNIF 367
            ++     +   RE++     Q + V     E L G+ T++S+ +E+R + + +  I  + 
Sbjct: 1063 TLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLINKMN 1122

Query: 368  HVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH-GSLTIGDLTAFMLYTEYTGNS 426
              G  S  +         LV     L + +       H  ++++G L  ++L      N 
Sbjct: 1123 EAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLLNG 1182

Query: 427  IFGLSTFYSEIMQGA----GAASRL-FELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY 481
            +    T     M  A      A+ L  E     PE+ P       P +G+IEFK+V FSY
Sbjct: 1183 VLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPP---ENWPSEGKIEFKHVDFSY 1239

Query: 482  -PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITK 540
             P  P   + K+L+  I+ G  + I G +G GKSTI   L      + G+ILID  DI+K
Sbjct: 1240 RPGLPI--VLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISK 1297

Query: 541  MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEE--------------IRKVAK 586
            +    LRRKL I+ Q+PVL  G+IR N+       P  E               I + A 
Sbjct: 1298 LGLYDLRRKLAIIPQDPVLFRGTIRKNL------DPFNEHDDDLLWDSLVRGGAIERAAL 1351

Query: 587  QCFCHNFITK-------FPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEAT 639
                +  + K       F    D  +   G   S G++Q +A+ RAL+++  +LILDEAT
Sbjct: 1352 NKIKNQKVDKDGTHADMFKFHLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILDEAT 1411

Query: 640  SALDVESEGAINYTFGQLMKT-KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
            S++D E++G I     +++K     TI+ IAHRL+TI   + ++VL   G V E  K K 
Sbjct: 1412 SSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEKPKV 1467

Query: 699  LFS 701
            LF 
Sbjct: 1468 LFD 1470

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 107/206 (51%), Gaps = 20/206 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F ++   I+ G  + +VGP G GK++    L  + N T G+I ++G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  Y   K E  +V + C     +   P    T+IG  G
Sbjct: 675 --LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR + KK +I + D+  SA+D    +  ++  F  L+K ++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMG 694
            H+LS + R+  VIVLG DGS  E+G
Sbjct: 790 -HQLSLLERASRVIVLGTDGS-FEIG 813

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 140/526 (26%), Positives = 244/526 (46%), Gaps = 88/526 (16%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ ++++   +H   +F+D+   G +++R   D             +G    +   + V 
Sbjct: 1073 KIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDI------------EGIDQELIPYLEVT 1120

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIF--------GKQIRINSRELQ--DATGQ--LTRV 335
            + C +      +L V+I P   S ++         GK     SR+L+  D+  +  + + 
Sbjct: 1121 VFCLIQCSSILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQH 1180

Query: 336  SEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
              E L GV T+++F  E+R I      + N+  + +     N  FF  +  V   +F   
Sbjct: 1181 FSETLVGVCTIRAFGDEKRFI------LENMEKIDQN----NKAFFYLSVAVKWFAFRVD 1230

Query: 396  LVYGSYLVL-HGSLTIGD------------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAG 442
            ++ G+++VL  GS  + +            LT  +L+T+    S   L   YS       
Sbjct: 1231 MI-GAFIVLGSGSFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMN 1285

Query: 443  AASRLFELTDYVPEIR--------PTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLN 494
            +  RL E +  V E            L  +  P  G+IE +N+S  Y +     + KN+ 
Sbjct: 1286 SVERLKEYSSIVQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLP-LVLKNVC 1344

Query: 495  FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQ 554
            FK++P S V IVG +G GKSTI   L     P +G I ID QDI+K++  +LRR + I+ 
Sbjct: 1345 FKVDPQSKVGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIP 1404

Query: 555  QEPVLMSGSIRDNITYGLTYTPTKE-EIRKVAKQCFCHNFIT--KFPHTYD--------- 602
            Q+PVL +G+I+ NI       P  E + R++ K     N I+  +F   ++         
Sbjct: 1405 QDPVLFAGTIKSNI------DPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHN 1458

Query: 603  ------TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 656
                  ++I   G  LS G++Q + IAR+L+++  I++LDEATS++D +S+  I      
Sbjct: 1459 KFLNLQSEIVEGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSIIRS 1518

Query: 657  LMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              K    TI++IAHRL ++   + ++V+ + G + E G   EL  +
Sbjct: 1519 --KFNKSTILTIAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKN 1561

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 115/243 (47%), Gaps = 16/243 (6%)

Query: 467 PGKGEIEFKNVSFSYPTRPQNQIFK----NLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
           P + +IEFK  +  +     N I K    +LN     G    ++G +G GKS + + LL 
Sbjct: 659 PDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLG 717

Query: 523 YYNPTSGQILIDG----QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK 578
             +  SG I+I G     D+   +   L        Q   L+S +I++NI +  +Y   K
Sbjct: 718 ELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYD--K 774

Query: 579 EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
              +KV   C  +  +   P    T+IG  G  LSGGQKQRI++ARA+      ++LD+ 
Sbjct: 775 SRYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDC 834

Query: 639 TSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKF 696
            SA+D  +   I  N   GQLMK +  T + + H +    R+ +  ++  DG V   G  
Sbjct: 835 LSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTI 892

Query: 697 KEL 699
           KEL
Sbjct: 893 KEL 895

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 231/502 (46%), Gaps = 44/502 (8%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L    +KR +H    + D    G +++R   D   +   +T+ +     S     VGV +
Sbjct: 968  LNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTSQFANIVGVCV 1026

Query: 289  MCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGV 343
            MC + L   A+ +  L+I  V+ A  +   G++I R+ + +       L  V    L G+
Sbjct: 1027 MCIVYLPWFAIAIPFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGM 1082

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAK---FFTSTSLVGDLSFLTVLVYGS 400
             T++++ +++R + + +  I  +   G     +      F    ++V  L    + V  +
Sbjct: 1083 DTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRA 1142

Query: 401  YLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGA----GAASRLFELTDY-VP 455
            + +   + ++G +  ++L      N++    T     M  A      A+ L    DY  P
Sbjct: 1143 FPI--SAASVGVMLTYVLQLPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKP 1200

Query: 456  EIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
            E+ P       P KGEI FKNV FSY P  P   + KNLN  I+ G  + I G +G GKS
Sbjct: 1201 EMAPP---ESWPSKGEIAFKNVDFSYRPGLPV--VLKNLNLNIKSGEKIGICGRTGAGKS 1255

Query: 515  TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
            TI   L      + G+ILID  +I+++    LRRKL I+ Q+PVL  G+IR N+      
Sbjct: 1256 TIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNER 1315

Query: 575  TP-------------TKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGTLLSGGQKQR 619
            T               K ++ +V  Q    N      H +  D  +   G+  S G++Q 
Sbjct: 1316 TEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKFHLDQAVEEEGSNFSLGERQL 1375

Query: 620  IAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSE 679
            +A+ RAL+++  ILILDEATS++D E++G I     +  +    TI+ IAHRL TI   +
Sbjct: 1376 LALTRALVRQSKILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYD 1433

Query: 680  NVIVLGNDGSVIEMGKFKELFS 701
             ++VL   G V E      LFS
Sbjct: 1434 RILVL-EKGEVAEFDTPWALFS 1454

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 111/211 (52%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FK+L+F+I+ G  + I GP G GKS++   +      T G+I ++G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + +++DNI +G  +   KE+  +V   C     +   P    T+IG  G
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT- 766

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I ++  VIVLG DG V ++G   EL
Sbjct: 767 -HQLSLIEKASRVIVLGTDGDV-DIGTVDEL 795

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 141/545 (25%), Positives = 254/545 (46%), Gaps = 72/545 (13%)

Query: 188  MFGLTIYEFLGGFSIALLAGC--MANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY 245
            M+ L IY F+G F+ AL+A    + NF         + R +  L   ++K+ ++   +F+
Sbjct: 881  MYYLLIYFFIG-FTQALVASSKTIINF----MAGLNASRKIFNL---ILKKVLYAKLRFF 932

Query: 246  DIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVL--GVL 303
            D    G +++R   D   V + +T  +   F SL+         C  ++ L A +  G  
Sbjct: 933  DSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLV--------QCLSTVILIAYITPGFF 984

Query: 304  IIPVVISASIF--GKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQR--- 354
            ++ + I+   +  G      SREL+     +   + +   E L G+ T+++F  E+R   
Sbjct: 985  VVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDERRFMQ 1044

Query: 355  -EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH-GSLTIGD 412
              +++ +E  +  F++   + ++  +      ++G      +   G +++L+  SL  G 
Sbjct: 1045 ENLEKIDENNKPFFYLWVANRWLAFRI----DMIGAC---VIFAAGIFVLLNIKSLDSGL 1097

Query: 413  LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY-----LP 467
                + Y          L   YS +     +  RL E  +   E  P    T+      P
Sbjct: 1098 AGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEV--EQEPHYQSTHTPPPEWP 1155

Query: 468  GKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
             +G+IE  ++S  Y P+ P+  + KN++F ++P   V IVG +G GKSTI   L  + +P
Sbjct: 1156 SQGKIEVNDLSLRYAPSLPK--VIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRFLDP 1213

Query: 527  TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP---------- 576
             SG I ID  DIT +  K LR+ + I+ Q+P L +G+++ N+     Y+           
Sbjct: 1214 ESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFEALKRV 1273

Query: 577  ---TKEEIRKV-----AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
               T+EE+                 + KF    D +I   G  LS GQ+Q + +AR+L++
Sbjct: 1274 NLLTEEELNSAGSPAPGNSSIHSENVNKFLRL-DNEITEGGANLSQGQRQLVCLARSLLR 1332

Query: 629  KPNILILDEATSALDVESEGAINYTF-GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
             P +++LDEAT+++D  S+  I  T  G+   +   TI++IAHRL +I   + ++V+ + 
Sbjct: 1333 SPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKILVM-DA 1388

Query: 688  GSVIE 692
            G V E
Sbjct: 1389 GEVKE 1393

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 112/466 (24%), Positives = 214/466 (45%), Gaps = 36/466 (7%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  DA+ VS  I   +    ++L+   V + ++  L L  SA++GVL+I V++ 
Sbjct: 259 GAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKL-LGWSAIVGVLLIIVILP 316

Query: 311 ASIFGKQIRIN-SRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFH- 368
            +     +  N  +E    T +  +   E    ++ ++ F  E+     F + I+NI   
Sbjct: 317 LNFKLANLLGNLQKETLSFTDKRIQKLNETFQAIRIIKFFSWEEN----FEKDIQNIRDQ 372

Query: 369 ----VGKRS---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTAFMLY 419
               + KRS   A     +F + S+V  +SF T      Y+ + G +  T    TA  L+
Sbjct: 373 ELKMLVKRSIVWALTAFVWFVTPSIVTTVSFAT------YIYIQGEVLTTPVAFTALSLF 426

Query: 420 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSF 479
           T    N +  LS   S ++Q   +  R+     ++ E            +  I F+N +F
Sbjct: 427 T-LLRNPLDMLSDMLSYVIQSKVSLDRV---QVFLEEDETEKYDQITVSRKRIGFENATF 482

Query: 480 SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI---LIDGQ 536
           S+  +  +   KN++ +   G    ++GP+G GK+++ + LL   +   G++    +D +
Sbjct: 483 SWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPR 542

Query: 537 DITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITK 596
           +   + +  +   +    Q   L++ ++++NI +   +   + +   V + C        
Sbjct: 543 EDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEARYD--AVVEACGLKRDFEI 600

Query: 597 FPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTF 654
                 T+IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N   
Sbjct: 601 LSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCIT 660

Query: 655 GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
           G LM+ ++  +VS  H ++   ++ + +V   +G V + G+  ELF
Sbjct: 661 GPLMEGRTCILVS--HNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 133/480 (27%), Positives = 223/480 (46%), Gaps = 41/480 (8%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F +++     + ++C+ +     V    
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQFILV---- 1080

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            ++P+ +    + +     SREL+     +TR       +E L GV T++ +  +Q+    
Sbjct: 1081 VLPLSVLYIYYQQYYLRTSRELR-RLDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAH 1138

Query: 359  FNEA-IRNIFHVGKRSAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTIGD 412
             N+A I N       SAF   +NA  + +  L  +G +  L       + +  G+LT G 
Sbjct: 1139 INQARIDN-----NMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGM 1193

Query: 413  LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTY 465
            +   + Y      S+  +     E+     +  R+ E  +  PE        RP  G   
Sbjct: 1194 IGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKG--- 1250

Query: 466  LPGKGEIEFKNVSFSYPTRPQNQ-IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
             P +G+I F++ S  Y  RP+ Q I +++N  I+    V IVG +G GKS++ L L    
Sbjct: 1251 WPSQGDIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRII 1308

Query: 525  NPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKV 584
                G I IDG     +    LR KL I+ Q+  + +G++R+N+    T   T EEI   
Sbjct: 1309 EAAEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHA 1366

Query: 585  AKQCFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
             +       +    +    T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+D
Sbjct: 1367 LELSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVD 1426

Query: 644  VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            VE++  I  T     K +  TI++IAHR++TI  S+ +IVL N+G V E    + L   P
Sbjct: 1427 VETDRVIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRP 1483

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 115/495 (23%), Positives = 227/495 (45%), Gaps = 52/495 (10%)

Query: 229 LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGV 286
           L S + K+++    +   +  TGD+++ +  D         Q++ D   +  +I  G   
Sbjct: 372 LTSVIYKKSLVLSNEASGLSSTGDIVNLMSVDV--------QRLQDLTQWGQIIWSGPFQ 423

Query: 287 GMMCSLSL----DLSAVLGVLIIPVVISASIFGKQIRINSRELQ-DATGQLTRVSEEQLN 341
            ++C +SL         +GV+I+ V+I  +    + + N +++Q     + TRV  E LN
Sbjct: 424 IILCLISLYSLLGPCMWVGVIIMVVMIPINSIIMKYQKNLQKIQMKNKDERTRVISEILN 483

Query: 342 GVKTVQSFVAE-----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
            +K+++ +  E     + +  R  + ++N+  +G   A  + +F     LV   +F   +
Sbjct: 484 NIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVFV 543

Query: 397 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEI---MQGAGAASRLFE-LTD 452
           +      L   L    LT F L +       F L+   + I   ++ + + +RL   LT+
Sbjct: 544 MTQKGRALTTDLVFPALTLFNLLS-------FPLAVVPNAITSFIEASVSVNRLHSFLTN 596

Query: 453 YVPEIRPTLGKTYLPGKGEIEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGP 508
              +      +  +  KG+I  K   + +F +  +P+ ++  KN+NF+ + G   CIVG 
Sbjct: 597 EELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGR 656

Query: 509 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
            G GKS +   +L       G   I G              +  V Q P +M+G++++NI
Sbjct: 657 VGSGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENI 703

Query: 569 TYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
            +G  Y P+  E  K  K C  +  ++  P    T +G  G  LSGGQK R+++ARA+  
Sbjct: 704 LFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYS 761

Query: 629 KPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
           + +  +LD+  +A+D   ++  ++   G      S T V   ++++ +  ++++ +L N 
Sbjct: 762 RADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALLEN- 820

Query: 688 GSVIEMGKFKELFSD 702
           G +++ G + E+  D
Sbjct: 821 GEIVQQGSYDEVVRD 835

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 143/535 (26%), Positives = 252/535 (47%), Gaps = 54/535 (10%)

Query: 196  FLGGFSIALLAGCMAN-FGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLI 254
            FLG ++   L G   N           S R   +L + + K  +     F++   TG +I
Sbjct: 994  FLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTGRII 1053

Query: 255  SRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVL--GVLIIPVVISAS 312
            +R  +D   V  ++    S  F+S++   + V ++ + ++ L  +L  G+L+I +   + 
Sbjct: 1054 NRFSSDMDSVDTTLQNVFSLFFRSILDYIITV-ILVTFNMPLFFLLNAGLLVIYLYYQSF 1112

Query: 313  IFGKQIRINSRELQDATG----QLTRVSEEQLNGVKTVQSFVAEQREIKRFNE------- 361
                   + SREL+  T      +  +  E L+G  T+ ++     +I+RF+        
Sbjct: 1113 YI-----VLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQ 1163

Query: 362  -AIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL-TVLVYGSYLVLHGSLTIGDLTAFMLY 419
             +I   F+    + +++ +  +    +G L  L T L+  S L     L+ G +   M Y
Sbjct: 1164 FSINCFFNYRSSNRWLSVRLQS----IGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSY 1219

Query: 420  TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY-----LPGKGEIEF 474
                 +S+  +      I     +  R+ E  D  PE  P + + +      P +G+IEF
Sbjct: 1220 ALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEF 1278

Query: 475  KNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILID 534
            KN S SY     + + K++N  I PG  + +VG +G GKST+++ L     PT+G I ID
Sbjct: 1279 KNYSTSY-RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISID 1337

Query: 535  GQDITKMNSKSLRRKLGIVQQEPVLMSGSIR-----------DNITYGLTYTPTKEEIRK 583
              DIT +  + LR  + I+ Q+     G+IR           D++ + +  +  K  +  
Sbjct: 1338 NIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLET 1397

Query: 584  VAKQCFC---HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATS 640
            +AK+      ++  ++     D  +  +G+ LS GQKQ + +ARAL+ K  IL+LDEAT+
Sbjct: 1398 IAKEINDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATA 1457

Query: 641  ALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGK 695
            ++DVE++  I  T  +    +  TI++IAHRL T+  S+ +IVL + G V E  K
Sbjct: 1458 SVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDK 1509

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 104/213 (48%), Gaps = 14/213 (6%)

Query: 494 NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIV 553
           NF++   S +C+VG  G GKSTI   +L      SG       D      +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 554 QQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLS 613
            QE  +M+ S++DNI +G  Y   +   +   K C     I   P   +T +G  G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYD--EAFYKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 614 GGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSMTIVSIA 669
           GGQK R+++ARA+  + ++ +LD+  SA+D E  +  I     +   L+K KS  IV   
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS--IVLAT 809

Query: 670 HRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           + +S ++ S  + +L N  S+ + G + ++ ++
Sbjct: 810 NTISVLKHSTKIYLLENK-SIAQEGNYDDIMNN 841

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 144/507 (28%), Positives = 233/507 (45%), Gaps = 76/507 (14%)

Query: 232  TVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV-GMMC 290
            +++ R +H   +F+D    G +++R   D      SI Q+I    +S+    + V   + 
Sbjct: 1128 SLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLL 1183

Query: 291  SLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSE--------EQLNG 342
             +S    A   V II +V+  SI G      SREL+    +L  +S+        E L G
Sbjct: 1184 LISYITPAFFPVAII-IVLGYSIVGFFYLTTSRELK----RLDSISKSPIFQHFSETLVG 1238

Query: 343  VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSF-------LTV 395
            V T+++F  EQR IK       N+  + + S      FF    +   LSF       L +
Sbjct: 1239 VTTIRAFGDEQRFIKE------NLSMIDQNSM----PFFYLWVVNRWLSFRIDLIGALVI 1288

Query: 396  LVYGSYLVLH-----GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
               G +++L+       L    LT  + +TE    +   L   YSE+     +  R+ E 
Sbjct: 1289 FSSGVFILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEY 1344

Query: 451  TDYVPE---IRPTLGKT---YLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNV 503
             +   E     P    T     P  G++E  N+S  Y P  P   + K++ F IEP   V
Sbjct: 1345 MNIEQEPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLPY--VIKDVTFTIEPLEKV 1402

Query: 504  CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
             IVG +G GKSTI   L  +    +G I +DG +I  ++ K LRR + I+ Q+P L +GS
Sbjct: 1403 GIVGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGS 1462

Query: 564  IRDNITYGLTYTPTKEEIRKVAK-----------------QCFCHNFITKFPHTYDTQIG 606
            IR N+     Y  + EEI    K                 Q      + KF +  +++I 
Sbjct: 1463 IRSNLDPYDEY--SDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLNL-ESEIA 1519

Query: 607  PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIV 666
              G+  S GQ+Q + +AR+L++ P +++LDEAT+++D  S+  I  T  Q  +  + T++
Sbjct: 1520 EGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQ--EFNNSTVL 1577

Query: 667  SIAHRLSTIRRSENVIVLGNDGSVIEM 693
            +IAHRL +I   + ++V+ + G V E 
Sbjct: 1578 TIAHRLRSIVDYDKILVM-DAGEVKEF 1603

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 113/235 (48%), Gaps = 9/235 (3%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F+NV+  + +   + + +NL+ +   G    IVG +G GK++I + LL     + G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 532 LIDG---QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC 588
           ++     +   +  +  +   +    Q   L++ ++R+NI +   +   + +   V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPFDQARYD--AVVEAC 823

Query: 589 FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 648
                         T+IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 649 AI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            I      G LM+ +  T + + H ++   ++ + +V+  DG V E G   EL +
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 144/519 (27%), Positives = 231/519 (44%), Gaps = 76/519 (14%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L    +KR +H    + D    G +++R   D   +   +T+ I     S     +GV +
Sbjct: 968  LNLKAVKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIR-LMMSQFANIIGVCV 1026

Query: 289  MCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGV 343
            +C + L   A+ +  L++  V+ A  +   G++I R+ + +       L  V    L G+
Sbjct: 1027 LCIVYLPWFAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEV----LGGM 1082

Query: 344  KTVQSFVAEQRE-------IKRFNEAIRNIFHVGKRSAF-----------------INAK 379
             T++++ ++ R        I + NE    +  V +  A                  +  +
Sbjct: 1083 DTIKAYKSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQ 1142

Query: 380  FFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQ 439
            F  S S VG      +L Y    VL     +  +   +  TE   NS   L T+ +E+ Q
Sbjct: 1143 FHISPSAVG-----VLLTY----VLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQ 1193

Query: 440  GAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIE 498
             A      +  +DY P           P  GE+ F++VSF+Y P  P   + KN+N  I 
Sbjct: 1194 EAA-----YRKSDYSP-------PDNWPTNGEVIFEDVSFAYRPGLPT--VLKNVNLSIA 1239

Query: 499  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
             G  + I G +G GKSTI   L      TSG+I IDG D  K+    LRRKL I+ Q+PV
Sbjct: 1240 GGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPV 1299

Query: 559  LMSGSIRDNITYGLTYTP-------------TKEEIRKVAKQCFCHNFITKFPHTY--DT 603
            L  G+IR N+     ++               K+++  +  Q    N      H +  D 
Sbjct: 1300 LFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKFHLDQ 1359

Query: 604  QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM 663
             +   G   S G++Q +A+ RAL+++  ILILDEATS++D E++G I        + +  
Sbjct: 1360 IVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDC 1417

Query: 664  TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            TI+ IAHRL TI   + ++VL   G V E  K + LF++
Sbjct: 1418 TILCIAHRLKTILNYDRILVL-EKGEVAEFDKPEILFNN 1455

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 115/211 (54%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F NLNF+I+ G  + I GP G GKS++   +  +   T+G++ I+G              
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH------------- 663

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  Y   +E+ ++V + C     I   P    T+IG  G
Sbjct: 664 -MLLCGYPWIQNATVRDNIIFGSPYD--REKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ K  +I + D+  SA+D    +  ++  F Q +++K+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I +++ VIVL  +GSV ++G  +EL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGSV-DIGTVEEL 808

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 152/571 (26%), Positives = 252/571 (44%), Gaps = 63/571 (11%)

Query: 165  ILDSLKVQTATQSEGEEAPPPIMM-----FGLTIYEFLGG-FSIALLAGCMANFGXXXXX 218
            +  S+ +   T+++ +  PP   M     F    + F+ G F+I    G MA+       
Sbjct: 912  LFSSVWLSYWTENKFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMAS------- 964

Query: 219  XXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKS 278
                      L    ++R +H    + D    G +++R   D   +   +T+ +     S
Sbjct: 965  --------KCLNLRAVRRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LMTS 1015

Query: 279  LICGGVGVGMMCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLT 333
                 VGV +MC + L   A+ +  L++  V+ A  +   G++I R+ + +       L 
Sbjct: 1016 QFANIVGVCVMCIVYLPWFAIAIPFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLN 1075

Query: 334  RVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFIN--AKFFTSTSLVGDLS 391
             V    L G+ T++++ +++R + + +  I  +   G     +      F     +    
Sbjct: 1076 EV----LGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFAL 1131

Query: 392  FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGA----GAASRL 447
             +T+L       +  + ++G L  ++L      N+I    T     M  A      A++L
Sbjct: 1132 IITLLCVTRAFPISAA-SVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKL 1190

Query: 448  FELTDY-VPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
                DY  PE+ P       P KG+I F+NV F+Y P  P   + KN N  I+ G  + I
Sbjct: 1191 PLEADYRKPEMTPP---ESWPSKGKIVFENVDFAYRPGLPI--VLKNFNLDIKSGEKIGI 1245

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
             G +G GKSTI   L      T+GQI ID  DI+++    LR+KL I+ Q+PVL  G+IR
Sbjct: 1246 CGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIR 1305

Query: 566  DNITYGLTYTP-------------TKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGT 610
             N+      T               K ++ +V  Q    N      H +  D  +   G+
Sbjct: 1306 KNLDPFDERTDDELWDALVRGGAIAKNDLPEVRLQKPDENGTHGRMHKFHLDQAVEEEGS 1365

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
              S G++Q +A+ RAL+++  ILILDEATS++D E++G I     +  +    TI+ IAH
Sbjct: 1366 NFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAH 1423

Query: 671  RLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            RL TI   + ++VL   G V E      LFS
Sbjct: 1424 RLKTIVNYDRILVL-EKGEVAEYDTPWALFS 1453

 Score = 97.1 bits (240), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FK+LNF I+ G  + I GP G GKS++   +        G+I ++G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  +   KE+  +V   C     +   P    T+IG  G
Sbjct: 652 --LMCGYPWIQNATVRDNIIFGSPFN--KEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ KK +I + D+  SA+D    +  ++     ++  K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILAT- 766

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I R+  VIVLG DG V ++G  +EL
Sbjct: 767 -HQLSLIERASRVIVLGTDGKV-DIGTVEEL 795

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 142/529 (26%), Positives = 241/529 (45%), Gaps = 42/529 (7%)

Query: 187  MMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYD 246
            ++F + IY F     I+L A  ++N          S +   +L  T+    I     F++
Sbjct: 1004 VLFYVGIYVF-----ISLSAALLSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFE 1058

Query: 247  IHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV---GMMCSLSLDLSAVLGVL 303
                G +I+R  +D   +  S+   +S    S++   V V   G    L L ++AVL V+
Sbjct: 1059 TTPVGRIINRFSSDMNSLDDSVQYVMSFFLVSILDYLVVVIIIGYQVPLFLIVNAVLLVI 1118

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEA- 362
                 +      ++++   R +  +   +  +  E L G   + +F    R   RF+   
Sbjct: 1119 YFYYQVYYVTLSRELK---RLMSTSFSPIMSMLSETLAGHMIIDAF----RHSDRFDYLN 1171

Query: 363  IRNI-FHVGKRSAFINAKFFTSTSL--VGDLSFLTVLVYGSYLVLHG--SLTIGDLTAFM 417
            + N+ F++     F +   + S  L  +G L  LT  +  S    +G  +L+ G +   M
Sbjct: 1172 VENVQFNINCLFNFRSTNRWLSIRLESIGALMILTTALL-SLATKNGGHALSTGMVGLLM 1230

Query: 418  LYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY----LPGKGEIE 473
             Y     N +  +     ++     +  R+ E  D  PE  P +  +      P +G I 
Sbjct: 1231 SYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIR 1290

Query: 474  FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
            FKN S  Y     + + ++L+ +I+P   + IVG +G GKST++L L     P+ G I I
Sbjct: 1291 FKNYSTRYRAN-LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDI 1349

Query: 534  DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNF 593
            DG DI+K+  K LR  L I+ Q+     G++R N+     Y  + EEI K  +       
Sbjct: 1350 DGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIWKALELSHLKPH 1407

Query: 594  ITKFPHT----------YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
            I K                T+I  +G+ LS GQ+Q + ++RAL+ +  IL+LDEAT+A+D
Sbjct: 1408 ILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVD 1467

Query: 644  VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
             E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V E
Sbjct: 1468 SETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKE 1513

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 108/446 (24%), Positives = 189/446 (42%), Gaps = 70/446 (15%)

Query: 338 EQLNGVKTVQSFVAEQREIKRFNEAIRNIFHV---GKRSAFINAKFFTSTSLVGDLSFLT 394
           E LN VKTV+ +  E+  +KR +  +RN   +    K S   N   F    +   ++  T
Sbjct: 472 ELLNSVKTVKLYAWEEPMLKRLDH-VRNDLELQNFKKISIITNLILFAWNCVPILVASST 530

Query: 395 VLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYV 454
            L+Y   L +   LT   +   +   +   + I+ +    +  ++   +  RL    D++
Sbjct: 531 FLIYA--LTMDVPLTPQIVFPSLSLFDILNDCIYTIPRTITNFIETGVSLGRL---KDFL 585

Query: 455 PEIRPTLGKTY-----LPGKGE---IEFKNVSF------------SYPTRP---QNQI-F 490
             +   + K++     LP  G+   IE  N +F            SY        +Q+  
Sbjct: 586 --LAKEIDKSFIEFESLPSDGKVPVIEVHNATFLRKIPNDSTDDESYDEEAAVESSQVAL 643

Query: 491 KNLN-FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKMNSKSLR- 547
           KN++ F++  G  VC+VG  G GKST    LL       GQ+  I         +   R 
Sbjct: 644 KNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRA 696

Query: 548 RKLGIVQQEPVLMSGSIRDNITYG-----LTYTPTKEEIRKVAKQCFCHNFITKFPHTYD 602
             + +  Q+  +M+ S++DN+ +G      TY  T E  + V         +       +
Sbjct: 697 NSVALCSQQSWIMNASVKDNVLFGHRFDEATYKATLEACQLVPD-------LEILADGDE 749

Query: 603 TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES-----EGAINYTFGQL 657
           T +G  G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E      E  ++   G L
Sbjct: 750 TLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLL 809

Query: 658 MKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF--SDPXXXXXXXXXXXX 715
              K+ T++   + +S ++ S+++  L  DG ++E G F ++    D             
Sbjct: 810 ---KNKTVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECES 865

Query: 716 XXXXTKSDPISSAPEVDADATGEPVE 741
                K +P+ S  E+ A    E VE
Sbjct: 866 ENTKAKIEPVDS--EIKAPVNLEDVE 889

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 127/473 (26%), Positives = 222/473 (46%), Gaps = 29/473 (6%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++C  +     +    
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICVTTWQFIFI---- 1096

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            I+P+ +    + +     SREL+     +TR       +E L G+ TV+ + ++Q+    
Sbjct: 1097 IVPLGVFYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSH 1154

Query: 359  FNEA-IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 417
             N+  I N       S   N        L+G +  L       + +  G+LT G +   +
Sbjct: 1155 INQCRIDNNMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSL 1214

Query: 418  LYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTYLPGKG 470
             Y      ++  +     E+     +  R+ E  D   E        RP   K + PG+G
Sbjct: 1215 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPP--KEW-PGQG 1271

Query: 471  EIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
            +I+F   S  Y  RP+ + + K ++  I+P   + IVG +G GKS++ L L      ++G
Sbjct: 1272 DIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAG 1329

Query: 530  QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
             I+IDG  I ++    LR KL I+ Q+  +  G++R+NI     YT  +   R +     
Sbjct: 1330 NIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTD-EAMWRALELSHL 1388

Query: 590  CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 649
              + ++      D+Q+   G+ LS GQ+Q + +ARA++ +  IL+LDEAT+A+DVE++  
Sbjct: 1389 KEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKV 1448

Query: 650  INYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            I  T     K +  TI++IAHRL+TI  S+ +IVL N G V E     +L ++
Sbjct: 1449 IQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTN 1498

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 117/477 (24%), Positives = 220/477 (46%), Gaps = 59/477 (12%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   + +LI  G    ++C  SL      S  +GV+
Sbjct: 403 TGDIVNLMSVD--------VQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVI 454

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQ-----R 354
           I+ +++  + F  +I+   ++LQ +      + TRV  E LN +K+++ +  E+      
Sbjct: 455 ILVIMMPLNSFLMRIQ---KKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKL 511

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R N+ + N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 512 EDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALT 570

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TDYVPEIRPTLGKTYLPGKGE 471
            F L +      +  +    +  ++ + +  RLF      +  P+    L K    G   
Sbjct: 571 LFNLLSF----PLMIIPMVLNSFIEASVSIGRLFSFFTNEELQPDSVQRLPKVENVGDIA 626

Query: 472 IEF-KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
           I    + +F +  +P+ ++  KN+NF+ + G   C+VG  G GK+  ALL     + T G
Sbjct: 627 INIGDDATFLWQRKPEYKVALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLG 679

Query: 530 QILIDGQDITKMNS-KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC 588
                  D+ ++    S+   +  V Q P +M+G++++NI +G  Y    E   K  K C
Sbjct: 680 -------DLFRVKGFASVHGSVAYVSQVPWIMNGTVKENILFGHKYDA--EFYEKTIKAC 730

Query: 589 FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SE 647
                +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   + 
Sbjct: 731 ALTIDLAILMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAR 790

Query: 648 GAINYTFGQ--LMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
             + +  G   L+ TK+  + +  +++S +  ++++ +L N G +I+ G + ++  D
Sbjct: 791 HLVEHVLGSNGLLHTKTKLLAT--NKVSALSVADSIALLDN-GEIIQQGTYDDITKD 844

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 147/513 (28%), Positives = 234/513 (45%), Gaps = 54/513 (10%)

Query: 224  RLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGG 283
            R    L    ++R +H    + D    G +++R   D   +   +T+ I     S +   
Sbjct: 928  RASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIRLML-SQVGNL 986

Query: 284  VGVGMMCSLSLDLSAVL--GVLIIPVVISASI--FGKQI-RINSRELQDATGQLTRVSEE 338
            +GV +MC + L   A+    +LII V+I       G++I R+ + +          V   
Sbjct: 987  IGVIVMCIVYLPWFAIAVPFLLIIFVLICDHYQSTGREIKRLEAVQRSFVYNNFNEV--- 1043

Query: 339  QLNGVKTVQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLS 391
             L G+ T++++ +++R        I + NEA   I  V +  A +      S ++V  L 
Sbjct: 1044 -LGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAIL----LDSVAVVFALI 1098

Query: 392  FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAG-----AASR 446
               + V  ++ +  GS  +G L  ++L      N+I    T     M  A      A   
Sbjct: 1099 ITLLCVTRAFPISAGS--VGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVTYATEL 1156

Query: 447  LFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
              E     PE+ P       P KG+I+F +V+F+Y P  P   + KN+N KI  G  + I
Sbjct: 1157 PLEAAYRKPEVSPP---ESWPEKGDIDFIDVNFAYRPGLPV--VLKNMNLKINNGEKIGI 1211

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
             G +G GKSTI   L      + G+I+IDG DI K+    LR+KL I+ Q+PVL  G+IR
Sbjct: 1212 CGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIPQDPVLFRGTIR 1271

Query: 566  DN----------------ITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             N                I  G+       +I K+ K    +++        D  +   G
Sbjct: 1272 KNLDPFKECSDDLLWDALIRTGVVERENLNDI-KLEKPDENNSYSNMHKFHLDELVEEEG 1330

Query: 610  TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIA 669
            +  S G++Q +A+ RAL++   ILILDEATS++D E++G I      + +    TI+ IA
Sbjct: 1331 SNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI--VSEFGDCTILCIA 1388

Query: 670  HRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            HRL TI   + ++VL   G + E  K  ELF+D
Sbjct: 1389 HRLKTILSYDKILVL-EKGVIAEYEKPWELFND 1420

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 110/213 (51%), Gaps = 24/213 (11%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F +LN +I  G  + + GP G GK+++   +  +   TSG++ ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR--KVAKQCFCHNFITKFPHTYDTQIGP 607
             ++   P +++ ++RDNI +G  Y    EE R  ++ + C     +   P    T+IG 
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPY----EEARYNEIVEVCSLDADLKILPAGDRTEIGE 682

Query: 608 SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIV 666
            G  LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++     ++K K+  + 
Sbjct: 683 RGITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILA 742

Query: 667 SIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           +  H+LS I R++ +IV+G +GS  + G   EL
Sbjct: 743 T--HQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 129/479 (26%), Positives = 213/479 (44%), Gaps = 29/479 (6%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L  +++   +     F++    G +++R   D Y V   + +  S  F +       + +
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 289  MCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS--------EEQL 340
            +C  +   +      +IP+ +    + +     SREL+    +L  V+        +E L
Sbjct: 1063 ICVTTWQFT----FFVIPLAMLYIYYQQYYLKTSRELR----RLDSVTKSPVYAHFQETL 1114

Query: 341  NGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGS 400
            NGV +++ +    R I      I N       S  +N         +G            
Sbjct: 1115 NGVSSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATLSV 1174

Query: 401  YLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE---- 456
            + +  GSLT G +   + Y      S+  +     E+     +  R+ E  +  PE    
Sbjct: 1175 FRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQF 1234

Query: 457  IRPTLGKTYLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKST 515
            I  ++     P  GEI+F+N S  Y  RP  + I + +N  I+P   V IVG +G GKS+
Sbjct: 1235 IANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSS 1292

Query: 516  IALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYT 575
            +AL L        G I IDG  I  +    LR+KL I+ Q+  +  G++RDNI     Y 
Sbjct: 1293 LALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNIDPTKQY- 1351

Query: 576  PTKEEIRKVAKQCFCHNFITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
             T E+I K  +     + +        DT +   G  LS GQ+Q + +ARAL+    IL+
Sbjct: 1352 -TDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILV 1410

Query: 635  LDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            LDEAT+A+DVE++  I  T       +  TI++IAHR++TI  S+ ++VL + G+V E 
Sbjct: 1411 LDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAEF 1466

 Score =  103 bits (257), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 114/497 (22%), Positives = 229/497 (46%), Gaps = 60/497 (12%)

Query: 231 STVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMC 290
           S + K+ +H   +      TGD+++ +  DA  + R +TQ     + ++I  G     +C
Sbjct: 364 SLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQ-----WGNVIWSGPFQLCLC 417

Query: 291 SLSLD--------LSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNG 342
             SL         +  VL +  +P+    S   + ++   +E      + TR+  E LN 
Sbjct: 418 LYSLHRLLGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNN 474

Query: 343 VKTVQSFVAE-----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLV 397
           +K+++ +  E     + +  R  + ++ +  +G  +AF N ++     LV   +F   ++
Sbjct: 475 IKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVL 534

Query: 398 YGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYV--P 455
                 L   L    LT F L +       F L+     I     A+  +  LT+++   
Sbjct: 535 TQKGRPLTTDLVFPALTLFNLLS-------FPLAVLPIAITSFIEASVAIGRLTNFLTAE 587

Query: 456 EI-RPTLGK---TYLPGKGEIEF-KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPS 509
           E+ R  + +      PG   +    N +F +  +P+ ++  KN+NF+ +     CI+G  
Sbjct: 588 ELQRDAITREPAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCIIGKV 647

Query: 510 GKGKSTIALLLLHYYNPTSGQILIDGQDITKMN-SKSLRRKLGIVQQEPVLMSGSIRDNI 568
           G GKS +   +L               D+ ++N S  +R  +  V Q   +M+G++RDNI
Sbjct: 648 GSGKSALIQAML--------------GDLFRVNGSAVVRGNVAYVSQVAWIMNGTVRDNI 693

Query: 569 TYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
            +G  Y    +  ++  K C     ++  P   +T +G  G  LSGGQK R+++ARA+  
Sbjct: 694 LFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYA 751

Query: 629 KPNILILDEATSALDVE-SEGAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLG 685
           + +  +LD+  +A+D   ++  +   FG   L+K+K+  + +  ++++ +  ++++++L 
Sbjct: 752 RADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVLLE 809

Query: 686 NDGSVIEMGKFKELFSD 702
           N G +++ G F E+ SD
Sbjct: 810 N-GEIVQQGTFSEVISD 825

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 130/500 (26%), Positives = 235/500 (47%), Gaps = 72/500 (14%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + V+K+ ++   +F+D    G +++R   D   V + +T  +   F SL+       
Sbjct: 1133 KIFNLVLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLV------- 1185

Query: 288  MMCSLSLDLSAVL--GVLIIPVVIS--ASIFGKQIRINSRELQD----ATGQLTRVSEEQ 339
              C  ++ L A +  G L++ + I     + G      SREL+     +   + +   E 
Sbjct: 1186 -QCLSTVILIAYITPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSET 1244

Query: 340  LNGVKTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
            L G+ T+++F  E+R     +++ +E  +  F++   + ++  +      ++G      V
Sbjct: 1245 LVGITTIRAFGDERRFMLENLQKIDENNKPFFYLWVANRWLAFRI----DMIGAC---VV 1297

Query: 396  LVYGSYLVLH-----GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
               G +++L+       L    LT  + +TE        L   YS +     +  RL E 
Sbjct: 1298 FAAGVFILLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEY 1353

Query: 451  TDYVPEIRPTLGKTY-----LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCI 505
               V E  P+    +      P +G+IE  ++S  Y T    ++ KN++F ++P   V I
Sbjct: 1354 M--VIEQEPSNDGAFNPPIEWPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGI 1410

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
            VG +G GKSTI   L  + +P +G I ID  DIT +  K LR+ + I+ Q+P L SG+++
Sbjct: 1411 VGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVK 1470

Query: 566  DNITYGLTYTPTKEEIRKVAKQCFCHNFIT--KFPHTYDT-------------------Q 604
             N+     Y  T E+I K  K+    N +T  +  H  D+                   +
Sbjct: 1471 SNLDPYDEY--TDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNE 1525

Query: 605  IGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMT 664
            I   G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    T
Sbjct: 1526 ITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDST 1583

Query: 665  IVSIAHRLSTIRRSENVIVL 684
            I++IAHRL +I   + ++V+
Sbjct: 1584 ILTIAHRLRSIIDYDKILVM 1603

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 113/462 (24%), Positives = 215/462 (46%), Gaps = 38/462 (8%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  DA+ VS  I   +    ++ I   V + ++  L L  +AV+G ++I  ++ 
Sbjct: 476 GGIINLMAVDAFKVSE-ICAYLHAFVEATIMTIVALTLLYKL-LGWAAVIGAILIVCMLP 533

Query: 311 -----ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ---REIKRFN-E 361
                A++ GK  + N       T +  +   E    ++ ++ F  E+   R+IK    E
Sbjct: 534 LNFKLANLIGKLQKDN----LGVTDKRIQKLNETFQSIRIIKFFSWEENFERDIKAIRTE 589

Query: 362 AIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTAFMLY 419
            ++ +       A ++  +F + S+V  +SF        Y+ + G +  T    TA  L+
Sbjct: 590 ELKILLKRSIVWALMSLVWFITPSIVTSVSF------AFYIYVQGEVLTTPIAFTALSLF 643

Query: 420 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSF 479
           T    N +  LS   S ++Q   +  R+ E  D   E            + +I F+N +F
Sbjct: 644 T-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLD---EEETEKYNQLTISRNKIAFENATF 699

Query: 480 SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI---DGQ 536
           ++  +  +   KNLN + + G    ++G +G GK+++ + LL   +   G++ +   D +
Sbjct: 700 AWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPSLDPR 759

Query: 537 DITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITK 596
           +   + S  +   +    Q   L++ ++R+NI +   Y  T+   + V + C        
Sbjct: 760 EELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YKAVVEACGLKRDFEI 817

Query: 597 FPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTF 654
                 T+IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I  N   
Sbjct: 818 LSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYENCIT 877

Query: 655 GQLMKTKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVIEMGK 695
           G LM+ ++  +VS  H ++ T++ +E V+VL N G + + G+
Sbjct: 878 GPLMQGRTCILVS--HNVALTLKNAEWVVVLDN-GRIKDQGE 916

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 128/494 (25%), Positives = 226/494 (45%), Gaps = 61/494 (12%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + ++K+ ++   +F+D   TG +++R   D   +   +       F SL+       
Sbjct: 1158 KIFTLLLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLV------- 1210

Query: 288  MMCSLSLDL----SAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQ 339
              C  ++ L    + V     I + +S  I G    + SRELQ         + +   E 
Sbjct: 1211 -QCITTILLIGYITPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSET 1269

Query: 340  LNGVKTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL-- 393
            L GV T+++F  E+R     + + +   R  F++          + T+  L   + F+  
Sbjct: 1270 LVGVTTIRAFGDERRFLADNLSKVDTHNRPFFYL----------WVTNRWLAFRIDFIGA 1319

Query: 394  -TVLVYGSYLVLH-GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 451
              +L  G +++L+  SL  G     ++Y          L   YS +     +  RL E  
Sbjct: 1320 FVILASGIFILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYM 1379

Query: 452  DYVPEIRPTLG----KTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVG 507
                E  P+ G        P +G+IE  N+S  Y +    ++ KN+ F +EP S V IVG
Sbjct: 1380 KIEQE--PSTGLYEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVG 1436

Query: 508  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
             +G GKSTI   L  + +P +G I +D  DIT +  K LR+ + I+ Q+PVL +G+I+ N
Sbjct: 1437 RTGAGKSTIITALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSN 1496

Query: 568  ITYGLTYTPTK--EEIRKV---------------AKQCFCHNFITKFPHTYDTQIGPSGT 610
            +     Y   +  E +++V               +        + KF     ++I   G+
Sbjct: 1497 LDPYSEYADDRIFEALKRVNLIVQEELTPTDIPSSSSSLSFENVNKFLD-LTSEITEGGS 1555

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
             LS GQ+Q + +AR+L++ P  ++LDEAT+++D  S+  I  T  +  +    TI++IAH
Sbjct: 1556 NLSQGQRQLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIRE--EFSGSTILTIAH 1613

Query: 671  RLSTIRRSENVIVL 684
            RL +I   + V+V+
Sbjct: 1614 RLRSIIDYDKVLVI 1627

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 110/469 (23%), Positives = 214/469 (45%), Gaps = 39/469 (8%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  D+  VS+ ++  I    +S++   V + ++  L L  SA++G   I  ++ 
Sbjct: 495 GAIINLMAVDSIKVSQ-VSAYIHMLLESVVMAIVAMVLLYRL-LGWSALVGATFIICILP 552

Query: 311 ASI-FGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR---EIKRFNEA---- 362
            ++ F  ++     +    T +  +   E L  ++ ++ F  E +   ++++  E     
Sbjct: 553 INLRFATKLGELQEDALACTDRRIQKLNETLQAIRIIKFFAWEDKFESDVQKIREMELSV 612

Query: 363 -IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 421
            +R +  V   S+F+   ++ + +LV   SF  V +Y    VL   +    L+ F+L   
Sbjct: 613 MLRRVV-VWSLSSFV---WYITPTLVASASF-CVYIYVQGEVLTTPVAFTALSLFVLLR- 666

Query: 422 YTGNSIFGLSTFYSEIMQGAGAASRL--FELTDYVPEIRPTLGKTYLPGKGEIEFKNVSF 479
              N +  L      ++Q + +  R+  F   D  P+ R    K     K  + F N + 
Sbjct: 667 ---NPLDQLCDIVFSLVQCSVSLRRIQNFLDQDETPKYRQLTVK-----KDRLGFSNATI 718

Query: 480 SYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG--- 535
            +          KNLN   + G    IVGP+G GK+++ + LL   N + G+I +     
Sbjct: 719 GWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNP 778

Query: 536 -QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFI 594
            +D+  +++  +   +G   Q   L++ ++R+NI +   Y   +     V   C     +
Sbjct: 779 REDLV-VDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPYEANR--YNAVIHACGLTRDL 835

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NY 652
                   T++G  G  LSGGQKQR+++ARA+  +   ++LD+  SA+D  +   I  + 
Sbjct: 836 EILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHC 895

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             G LM+ ++  +VS    L T++ ++ V++L N   V   G+  ELF+
Sbjct: 896 ITGPLMEGRTCVLVSHNTAL-TLKNADWVVILEN-AKVTAQGEPLELFN 942

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 150/515 (29%), Positives = 237/515 (46%), Gaps = 80/515 (15%)

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI---CGGVGVGMMC 290
            +KR +H    + D    G +++R   D    + S+  ++++  + L+      VGV +MC
Sbjct: 1004 VKRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVGVCIMC 1059

Query: 291  SLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGVKT 345
             + L   A+ +  L +  V+ A  +   G++I R+ + +          V    L G+ T
Sbjct: 1060 IIYLPWFAIAIPFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEV----LGGMDT 1115

Query: 346  VQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL-------- 390
            ++S+ +E R        I + NEA   +  V +  A          +L+  L        
Sbjct: 1116 IKSYRSENRFIAKSDFLIDKMNEAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRAFP 1175

Query: 391  -SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
             S  +V V  +Y++    L  G L + +  TE   NS   L T+ +E+   A        
Sbjct: 1176 ISAASVGVLLTYVLQLPGLLNGVLRS-LTQTENDMNSAERLVTYATELPLEA-------- 1226

Query: 450  LTDY-VPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVG 507
              DY  PE+ P       P KGEI F+NV FSY P  P   + KNL+  I+ G  + I G
Sbjct: 1227 --DYRKPEVSPP---EEWPTKGEIHFENVDFSYRPGLPT--VLKNLSLDIKSGEKIGICG 1279

Query: 508  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
             +G GKSTI   L      +SG+++ID  DI+ +    LRRKL I+ Q+PVL  G+IR N
Sbjct: 1280 RTGAGKSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKN 1339

Query: 568  ITYGLTYTPT-------------KEEIRKVAKQC----FCHNFITKFPHTYDTQIGPSGT 610
            +     +                ++E+ ++  Q       H+ + KF    D  +   G 
Sbjct: 1340 LDPFNEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGA 1397

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY----TFGQLMKTKSMTIV 666
              S G++Q +A+ RAL+++  ILILDEATS++D E++G I       FG        TI+
Sbjct: 1398 NFSLGERQLLALTRALVRQARILILDEATSSVDYETDGKIQARIVEEFGHC------TIL 1451

Query: 667  SIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             IAHRL TI   + ++VL   G V E    K LF+
Sbjct: 1452 CIAHRLKTILTYDRILVL-EKGEVAEFDTPKTLFA 1485

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 116/211 (54%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F +LNF+I+ G  + +VGP G GK+++      + N  SG+I I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + S++DNI +G  Y   K +  +V + C   + +   P    T+IG  G
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYD--EVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++  F  L+K K+  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS + R+  VIVLGNDGS  ++G  +EL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 145/512 (28%), Positives = 233/512 (45%), Gaps = 62/512 (12%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVG--- 285
            L    + R +H    + D    G +++R   D   +   +T+ +      L+   VG   
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVR-----LMLFQVGNIV 1001

Query: 286  -VGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQL 340
             V +MC + L   A+    +  + +   +     +  SRE++  DA  +  +     E L
Sbjct: 1002 AVIVMCIVYLPWFAIAVPFLFFMFV---LIADHYQSTSREIKRLDAIQRSFVYNNLNEVL 1058

Query: 341  NGVKTVQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL 393
             G+ T++S+  ++R        I + NEA   +  V +  +     F    +++  L   
Sbjct: 1059 GGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSI----FLDMVAIIFALIIA 1114

Query: 394  TVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGA----GAASRL-F 448
             + V G + +   S  +G L  ++L      NS+    T     M  A      A++L  
Sbjct: 1115 LLSVTGVFSLSASS--VGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPL 1172

Query: 449  ELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPT-RPQNQIFKNLNFKIEPGSNVCIVG 507
            E     PE+ P       P KGEI F +V F+Y +  P   + K LN  I+ G  + I G
Sbjct: 1173 EAAYKKPELSPP---ESWPSKGEIRFLDVDFAYRSGLPV--VLKGLNLDIKSGEKIGICG 1227

Query: 508  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
             +G GKSTI   L      TSG+ILID  DI+ +    LRRKL I+ Q+PVL  G+IR N
Sbjct: 1228 RTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKN 1287

Query: 568  ITYGLTYTPT-------------KEEIRKVAKQCF----CHNFITKFPHTYDTQIGPSGT 610
            +     Y  +             KE + KV  +       H  + KF    D  +   G+
Sbjct: 1288 LDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGS 1345

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
              S G++Q +A+ RAL+++  ILILDEATS++D E++G I     +  +  + TI+ IAH
Sbjct: 1346 NFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAH 1403

Query: 671  RLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            RL TI + + ++VL   G + E  +  +LFSD
Sbjct: 1404 RLKTILQYDRILVL-EKGVIAEFDQPFKLFSD 1434

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F NL+F+I  G  + I GP G GKS++      + N T G+I ++G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             +    P + + +++DNI +G  +   KE+   V + C     +   P    T+IG  G
Sbjct: 636 --LFCGYPWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +ARA+ K  +I + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS I +++ VIVLG DGS  ++G   EL
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS-FDIGTVDEL 779

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 136/481 (28%), Positives = 233/481 (48%), Gaps = 41/481 (8%)

Query: 243  QFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGV 302
            +F++    G +++R   D + V   + +  S    ++I     + ++C  +   +    +
Sbjct: 1046 RFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFT----L 1101

Query: 303  LIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQSFVAEQREIKR 358
             +IP+ I    + +     SREL+  D+T +  +    +E L G+ T++ +  +QR    
Sbjct: 1102 FVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGY-NQQRRFIH 1160

Query: 359  FNEAIRNIFHVGKRSAF---INAKFFTSTSLVGDLSFL-TVLVYG----SYLVLH-GSLT 409
             N++  +       SA+   +NA  +    L   L F+ T++++G    S L L  GSLT
Sbjct: 1161 INQSRMD----NNMSAYYPSVNANRW----LAYRLEFIGTIIIFGASSLSILRLKSGSLT 1212

Query: 410  IGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY---- 465
             G +   + Y      S+  +     E+     +  R+ E ++ +P   P L +      
Sbjct: 1213 PGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSP 1271

Query: 466  -LPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY 523
              P  G I+F++ S  Y  RP  + I K++N  I+P   + IVG +G GKS++ L L   
Sbjct: 1272 NWPTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRL 1329

Query: 524  YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRK 583
                 G+I+IDG  I +M    LR KL I+ Q+  +  GS+R+NI     Y  + EEI +
Sbjct: 1330 IEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENIDPTEQY--SDEEIWR 1387

Query: 584  VAKQCFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 642
            V       N +    +    TQ+   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+
Sbjct: 1388 VLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAV 1447

Query: 643  DVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            DVE++  +  T       +  TI++IAHRL+TI  S+ ++VL + G V E    + L  +
Sbjct: 1448 DVETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKN 1504

Query: 703  P 703
            P
Sbjct: 1505 P 1505

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 127/498 (25%), Positives = 234/498 (46%), Gaps = 57/498 (11%)

Query: 225 LVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISD--GFKSLICG 282
           L + L S + K+++   ++  D+  TGD+++ +  D         Q++ D   +  LI  
Sbjct: 381 LKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDV--------QRLQDLAQWCHLIWS 432

Query: 283 GVGVGMMCSLSL----DLSAVLGVLIIPVV--ISASIFGKQIRINSRELQDATGQLTRVS 336
           G    ++C  SL      S  +GV+I+ V+  +++S+   Q  +   ++++   Q TR+ 
Sbjct: 433 GPFQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNK-DQRTRLI 491

Query: 337 EEQLNGVKTVQSFVAEQ-----REIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLS 391
            E LN +K+++ +  E+      E  R  + ++N+  +G  +A IN +F      V   +
Sbjct: 492 NEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCST 551

Query: 392 FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 451
           F  V VY     L   L    LT F L +         L+++    ++ + +  RL+   
Sbjct: 552 F-AVFVYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSY----IEASVSIGRLYSFL 606

Query: 452 DYVPEIRPTLGKTYLP---GKGEIEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVC 504
                 R ++ +  LP     G++  K   N +F +  +P+ ++  KN+NF+ + G   C
Sbjct: 607 TNEELQRDSVQR--LPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNC 664

Query: 505 IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSI 564
           +VG  G GKS +   LL       G   + G              +  V Q   +M+G++
Sbjct: 665 VVGRVGSGKSALIQSLLGDLFRVKGFATVHGN-------------IAYVSQVAWIMNGTV 711

Query: 565 RDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIAR 624
           +DNI +G  Y P  E   K  K C     +   P    T +G  G  LSGGQK R+++AR
Sbjct: 712 KDNILFGHKYDP--EFYEKTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLAR 769

Query: 625 ALIKKPNILILDEATSALDVE-SEGAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENV 681
           A+  + +I +LD+  +A+D   S   I++  G   L+KTK+  + +  +++S +  +++V
Sbjct: 770 AVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTKTKILAT--NKISALSIADSV 827

Query: 682 IVLGNDGSVIEMGKFKEL 699
            +L N G +I+ G F E+
Sbjct: 828 TLLEN-GEIIQQGTFCEI 844

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 129/501 (25%), Positives = 231/501 (46%), Gaps = 72/501 (14%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-CGGVGV 286
            ++ ++++K ++H   +F+D    G +++R   D   V + +   +   F  L+ C     
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVEC----F 1224

Query: 287  GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNG 342
             ++  ++L     LGV I   V    +    I   SREL+  D+  +  + +   E L G
Sbjct: 1225 SIIVLITLITPQFLGVAIFIAVFYWFVGAVYIS-GSRELKRFDSITKSPIYQHFSETLAG 1283

Query: 343  VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYL 402
            + TV+++  E R ++   E I             N  FF        LSF T ++ G+++
Sbjct: 1284 ITTVRAYGDESRFMRENLEKIDEN----------NKPFFYMWVSNRWLSFRTQII-GAFV 1332

Query: 403  VL-HGSLTIGDLTAF--------MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY 453
            +L  G  +I ++           + Y     ++   L  FY +      +  R+ E  + 
Sbjct: 1333 ILGAGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNI 1392

Query: 454  VPE------IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIV 506
              E      + P       P  G+IE  +VS  Y P  P+  + KN++F ++  S V IV
Sbjct: 1393 DQEPYNEGTVEPPAD---WPENGKIEINDVSLRYAPNLPR--VIKNVSFTVDSKSKVGIV 1447

Query: 507  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
            G +G GKSTI   L  +  P +G I ID  DI  ++ + LRR + I+ Q+P L +G+IR 
Sbjct: 1448 GRTGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRS 1507

Query: 567  NITYGLTYTPTKEEIRKVAKQCFCHNFITK---------------------FPHTYDTQ- 604
            N+     YT   +  +++     C N +++                     F H  D + 
Sbjct: 1508 NLD---PYTQYSD--KEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEY 1562

Query: 605  -IGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM 663
             +   G+ +S GQ+Q + +AR+L+ KP I++LDEAT+++D ES+  I  T     +  + 
Sbjct: 1563 NVSEGGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRN--EFGNS 1620

Query: 664  TIVSIAHRLSTIRRSENVIVL 684
            TI++IAHRL ++   + ++V+
Sbjct: 1621 TILTIAHRLRSVIDYDKILVM 1641

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 115/470 (24%), Positives = 209/470 (44%), Gaps = 54/470 (11%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVI- 309
           G +I+ +  DA+ V+  I   +     ++I   V + ++ +L L  +A +G L I V+I 
Sbjct: 540 GAIINLIAVDAFKVAE-IGAYLHTFIGTIIMTFVSIYLLFNL-LGSAAFIGALTIIVLIP 597

Query: 310 -SASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE---QREIKRFNEAIRN 365
            +  I      +  + L+    ++ +++E     ++ ++ F  E   + +I +  E    
Sbjct: 598 VNYKIANWLGNLQQKNLKTTDKRIQKLNE-TFQAIRIIKFFSWEKNFENDIHKIREEELY 656

Query: 366 IFH----VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTE 421
           I      V   S FI   FF S ++V  LSF       +Y +      +    AF     
Sbjct: 657 ILLLRCLVWSFSTFI---FFISPTIVTSLSF-------AYYIFIQKQELTSPVAF----- 701

Query: 422 YTGNSIFGL--------STFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIE 473
            T  S+F L        +   S ++Q   +  R+    D  P+ +     T    K ++ 
Sbjct: 702 -TALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLDE-PDTKKYEQLTVPVEKNKLS 759

Query: 474 FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
           FKN + S+     +   +NL+   + G    ++GP+G GK+++ + LL     T GQI I
Sbjct: 760 FKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQINI 819

Query: 534 ---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVA---KQ 587
              D +    + S      +    Q   L++ ++R+NI +   Y   + +   VA   K+
Sbjct: 820 PSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAAGLKR 879

Query: 588 CFCHNFITKFPHTYD-TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
            F      +     D T+IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 880 DF------EILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHT 933

Query: 647 EGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
              I  N   G LM+ ++  +VS  H ++   ++ +++V+  +G V + G
Sbjct: 934 AAWIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG 981

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 127/499 (25%), Positives = 234/499 (46%), Gaps = 54/499 (10%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + ++K+ ++   +F+D    G +++R   D   V + +T  +   F SL+     V 
Sbjct: 1128 KIFNLILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVI 1187

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQLNGV 343
            ++  ++ D   V     I + I   + G      SREL+     +   + +   E L G+
Sbjct: 1188 LIAYITPDFFFV----AIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGI 1243

Query: 344  KTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG 399
             T+++F  E+R     + + +E  +  F++   + ++  +      ++G      +   G
Sbjct: 1244 TTIRAFGDERRFMQENLTKIDENNKPFFYLWVANRWLAFR----IDMIGAC---VIFAAG 1296

Query: 400  SYLVLH-GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIR 458
             +++L+  SL  G     + Y          L   YS +     +  RL E  +   E  
Sbjct: 1297 IFVLLNIKSLDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEV--EQE 1354

Query: 459  PTLGKTY-----LPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKG 512
            P    T+      P +G+IE  ++S  Y P+ P+  + KN+ F ++P   V IVG +G G
Sbjct: 1355 PHYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLPK--VIKNVTFTVDPNCKVGIVGRTGAG 1412

Query: 513  KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGL 572
            KSTI   L  + +P SG I ID  DIT +  K LR+ + I+ Q+P L +G+++ N+    
Sbjct: 1413 KSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYD 1472

Query: 573  TYTP-------------TKEEIRKVAK------QCFCHNFITKFPHTYDTQIGPSGTLLS 613
             Y+              T+EE+   A            N + KF    + +I   G+ LS
Sbjct: 1473 EYSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFLFL-ENEISEGGSNLS 1530

Query: 614  GGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLS 673
             GQ+Q + +AR+L++ P +++LDEAT+++D +S+  I  T     +    TI++IAHRL 
Sbjct: 1531 QGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLR 1588

Query: 674  TIRRSENVIVLGNDGSVIE 692
            +I   + ++V+ + G V E
Sbjct: 1589 SIIDYDKILVM-DAGEVKE 1606

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 111/469 (23%), Positives = 217/469 (46%), Gaps = 40/469 (8%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  DA+ VS  I   +    ++L+   V + ++  L L  SA++G L+I  ++ 
Sbjct: 473 GAIINLMAVDAFKVSE-ICAYLHSFVEALVMTIVALTLLYKL-LGWSAIIGALLIVAILP 530

Query: 311 -----ASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRN 365
                A++ GK      +E    T +  +   E    ++ ++ F  E+   K   ++IR+
Sbjct: 531 LNFRLATLIGKL----QKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEKDI-QSIRD 585

Query: 366 --IFHVGKRS---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL--TIGDLTAFML 418
             +  + KRS   A     +F + ++V  +SF        Y+ + G +  T    TA  L
Sbjct: 586 QELKMLVKRSVAWALTAFVWFITPTIVTSVSF------AFYIYVQGEVLTTPVAFTALSL 639

Query: 419 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVS 478
           +T    N +  LS   S ++Q   +  R+    +++ E      +     + +I F+N +
Sbjct: 640 FT-LLRNPLDMLSDMLSYVIQSKVSLDRV---QEFLEEEETEKYEQITVHRNKIGFENAT 695

Query: 479 FSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI---LIDG 535
           FS+  +  +   KN+N   + G    ++GP+G GK+++ + LL   +   G++    +D 
Sbjct: 696 FSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDP 755

Query: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKE-EIRKVAKQCFCHNFI 594
           ++   + +  +   +    Q   L++ ++++NI +    +P  E     V + C      
Sbjct: 756 REDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS---SPFNEGRYNAVIEACGLKRDF 812

Query: 595 TKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NY 652
                   T+IG  G  LSGGQKQR+++ARAL      L+LD+  SA+D  +   I  N 
Sbjct: 813 EILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENC 872

Query: 653 TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             G LM+ ++  +VS  H ++   ++   +V   +G V + G+  EL++
Sbjct: 873 ISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELYN 919

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 132/492 (26%), Positives = 231/492 (46%), Gaps = 47/492 (9%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L S+++   +     F++    G +++R   D Y +   + +  S  F + +     + +
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILV 1092

Query: 289  MCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVK 344
            +C  +        +L+IP+ +    + +     SREL+  D+  +  +    +E L G+ 
Sbjct: 1093 ICWNTWQFI----LLVIPMGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLA 1148

Query: 345  TVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL-TVLVYG---- 399
            T++ +  ++R I   N+A      V    +       ++  L   L FL +++++G    
Sbjct: 1149 TIRGYEQQKRFI-HINQA-----RVDNNMSAYYPSINSNRWLAYRLEFLGSLIIFGAASL 1202

Query: 400  SYLVLH-GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY----- 453
            S L L  G+LT G +   + Y      S+  +     E+     +  R+ E  +      
Sbjct: 1203 SILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAP 1262

Query: 454  --VPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSG 510
              + E RP+      P +G I+F+N S  Y  RP  + + KN++  I+P   V IVG +G
Sbjct: 1263 LIIEEKRPSEN---WPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTG 1317

Query: 511  KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570
             GKS++ L L        G I++DG +I+++    LR KL I+ Q+  +  G+IR+NI  
Sbjct: 1318 AGKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENIDP 1377

Query: 571  GLTYTPTKEEIRKVAKQCFCHNFITKF---------PHTYDTQIGPSGTLLSGGQKQRIA 621
               Y  T E+I    +       I +           +   T++   G  LS GQ+Q + 
Sbjct: 1378 TNIY--TDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMC 1435

Query: 622  IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENV 681
            +ARAL+    ILILDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ +
Sbjct: 1436 LARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKI 1493

Query: 682  IVLGNDGSVIEM 693
            +VL + G V E 
Sbjct: 1494 VVL-DKGEVAEF 1504

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 121/480 (25%), Positives = 223/480 (46%), Gaps = 63/480 (13%)

Query: 246 DIHKTGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAV 299
           D+  TGD+++ +  D         Q++ D   + ++I  G    ++C  SL      S  
Sbjct: 399 DLSSTGDVVNLMSVDV--------QRLQDLTQWCNIIWSGPFQIILCLFSLYKLLGHSMW 450

Query: 300 LGVLIIPVVISASIFGKQIRINSRELQ-DATGQLTRVSEEQLNGVKTVQSFVAEQ----- 353
           +GV+++ V+I  + +  +I+   +++Q     + TRV  E LN +K+++ +  EQ     
Sbjct: 451 VGVIVLIVMIPLNSYLMRIQKQLQKVQMKYKDERTRVINEILNNIKSLKLYAWEQPYKEK 510

Query: 354 REIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDL 413
            E  R  + ++N+  +G  +A  N +F     LV   +F  V VY     L   L    L
Sbjct: 511 LEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLVSCSTF-AVFVYIEDKPLTTDLVFPAL 569

Query: 414 TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL-------TDYVPEIRPTLGKTYL 466
           T F L T      +  L    +  ++ + + SRLF         TD +  + P      +
Sbjct: 570 TLFNLLTF----PLAALPIVITAFIEASVSMSRLFSFMTNEELQTDAIQRLPP------V 619

Query: 467 PGKGEIEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
             +G+I      N +F +  +P+ ++  KN+ F+ + G   CIVG  G GKS     +L 
Sbjct: 620 KKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSILG 679

Query: 523 YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR 582
                 G   I G              +  V Q P +M+G+++DNI +G  Y   +E   
Sbjct: 680 DLFRVKGFATIHGN-------------VAYVSQLPWIMNGTVKDNILFGHKYN--QEFYE 724

Query: 583 KVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 642
           K  + C     ++  P    T +G  G  LSGGQK R+++ARA+  + ++ +LD+  +A+
Sbjct: 725 KTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDPLAAV 784

Query: 643 DVE-SEGAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           D   S+  I +  G   L+ TK+  + +  +++S +  ++N+ +L +DG +++ G + E+
Sbjct: 785 DEHVSKHLIQHVIGPNGLLHTKTRVLAT--NKISVLSIADNITLL-DDGEIVQQGTYNEV 841

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 129/474 (27%), Positives = 224/474 (47%), Gaps = 49/474 (10%)

Query: 244  FYDIHKTGDLISRLGADAY----IVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAV 299
            F++    G +++R   D Y    ++ R+ +Q + +  K +    V    +C  +     +
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIV----ICWTTWQFIFI 1100

Query: 300  LGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQR 354
            +G    P+ +    + +     SREL+     +TR       +E L G+ T++ +  +QR
Sbjct: 1101 IG----PLGVLYIYYQQYYLRTSRELR-RLDSITRSPIYSHFQETLGGMSTIRGY-NQQR 1154

Query: 355  EIKRFNEA-IRNIFHVGKRSAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSL 408
                 N   I N       SAF   INA  + +  L  +G +  L       Y +  G+L
Sbjct: 1155 RFDHINHCRIDN-----NMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTL 1209

Query: 409  TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTL 461
            T G +   + Y      ++  +     E+     +  R+ E ++        + E RP  
Sbjct: 1210 TAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPA- 1268

Query: 462  GKTYLPGKGEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLL 520
               + P  G+I F + S  Y  RP+ + + +++N  I+P   + IVG +G GKS++ L L
Sbjct: 1269 --AHWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLAL 1324

Query: 521  LHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEE 580
                  +SG I+IDG  I ++    LR  L I+ Q+  +  G+IR+N+    TY  T +E
Sbjct: 1325 FRIVEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY--TDDE 1382

Query: 581  IRKVAKQCFCHNFITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEAT 639
            I +V +    +  +    P     ++   G+ LS GQ+Q + +ARAL+    ILILDEAT
Sbjct: 1383 IWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEAT 1442

Query: 640  SALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            +A+DVE++  I  T     + +  TI++IAHR++TI  S+ ++VL + G V E 
Sbjct: 1443 AAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEF 1493

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 115/477 (24%), Positives = 222/477 (46%), Gaps = 59/477 (12%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   F  L+  G    ++C +SL      S  +GV+
Sbjct: 401 TGDIVNLMSVDV--------QKLQDLCQFIHLLWSGPFQVVICLVSLYKLLGPSMWIGVV 452

Query: 304 IIPVVISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQ-----R 354
           I+ V+   + F  +I+   + LQ +      + T V  E LN +K+++ +  E+      
Sbjct: 453 ILLVMTPLNTFLAKIQ---KRLQKSQMGFKDERTSVISEILNNIKSLKLYAWEEPYKKKL 509

Query: 355 EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLT 414
           E  R ++ ++N+  +G   A  + +F     LV   +F  V VY     L   L    LT
Sbjct: 510 EHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVYTEDRALTVDLVFPALT 568

Query: 415 AFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE-LTDYVPEIRPTLGKTYLPGKGEIE 473
            F L +      +F +    +  ++ + + +RLF  LT+   +         +   G++ 
Sbjct: 569 LFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKDSVQRLPKVTNVGDVA 624

Query: 474 FK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
            K   + +F +  +P+ ++  KN+NF+ + G   C+VG  G GKS +   L       SG
Sbjct: 625 VKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKSALIQSL-------SG 677

Query: 530 QILIDGQDITKMNS-KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC 588
                  D+ ++    ++   +  V Q   +M+G++++NI +G  Y P  E   K  K C
Sbjct: 678 -------DLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGHRYDP--EFYDKTIKAC 728

Query: 589 FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SE 647
                +       +T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D    +
Sbjct: 729 ALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVGK 788

Query: 648 GAINYTFG--QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
             + +  G   L++TK+  + +  +++S +  ++ + +L N G ++E G + E+ +D
Sbjct: 789 HLLEHVLGPTGLLRTKTKILAT--NKISVLSIADRIALLEN-GEIVEQGSYDEVTAD 842

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 141/542 (26%), Positives = 249/542 (45%), Gaps = 71/542 (13%)

Query: 188  MFGLTIYEFLGGFSIALLAG--CMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFY 245
            M+ L+IY FL G + ALL     + NF         S ++   L    +K+ +H   +F+
Sbjct: 1106 MYYLSIY-FLIGIAQALLGSLKVLINF---FLGVKASRKIFIDL----LKKVMHSKLRFF 1157

Query: 246  DIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLII 305
            D    G +++R   D   + + +   +   F SL+         C  ++    +L   I 
Sbjct: 1158 DSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVS--------CVTTI----LLITFIT 1205

Query: 306  PVVISASIF--------GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQSFVAE- 352
            P  +S +I         G      SRE +  D+  +  + +   E L GV T+++F  E 
Sbjct: 1206 PQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDEG 1265

Query: 353  ---QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH-GSL 408
               Q  + + +E  R  F++   + +++ +      +VG L    V   GS+++ +  ++
Sbjct: 1266 RFMQENLSKIDENNRPFFYLWVANRWLSFRI----DMVGAL---VVFGSGSFIIWNIKNI 1318

Query: 409  TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY--- 465
              G     + Y          L   YS +     +  RL E      E  P    T    
Sbjct: 1319 DAGMAGISLTYAISFTEGALWLVRLYSNVEMNMNSVERLKEYMKI--EQEPYEDATCTPP 1376

Query: 466  --LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY 523
               P +G+IE  ++S  Y      ++ KN+ F + P + + IVG +G GKSTI   L  +
Sbjct: 1377 PEWPQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRF 1435

Query: 524  YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT-YGL-----TYTPT 577
             +P +G I ID  DIT +N   LRR + I+ Q+P L +G+I+ N+  YG       +T  
Sbjct: 1436 LDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTAL 1495

Query: 578  K------EEI-RKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKP 630
            +      E++   +  +      + KF +  + +I   G+ LS GQ+Q + +AR+L++ P
Sbjct: 1496 RRVNLVPEDVSSNIETESISSQNVNKFLNL-NNEISEGGSNLSQGQRQLVCLARSLLRSP 1554

Query: 631  NILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
             I++LDEAT+++D  S+  I  T  +  +  S TI++IAHRL ++   + ++V+ + G V
Sbjct: 1555 KIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKILVM-DAGEV 1611

Query: 691  IE 692
             E
Sbjct: 1612 KE 1613

 Score =  104 bits (260), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 116/473 (24%), Positives = 212/473 (44%), Gaps = 48/473 (10%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDL-------SAVLGVL 303
           G +I+ +  DA+ VS            + +   V   +M  +SL L       SA++G +
Sbjct: 491 GGIINLMAVDAFKVSEVC---------AYLFAFVEATVMAIISLTLLYRLIGSSAIIGTI 541

Query: 304 IIPVVISASIFGKQIRINSRELQDATGQLT--RVSE--EQLNGVKTVQSFVAEQREIKRF 359
           +I +   A+ +   +     ++Q AT  +T  R+ +  E L  ++ ++ F  E    K  
Sbjct: 542 VILIAAPANYYFATLL---GKIQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDNFEKSI 598

Query: 360 NEAIRNIFHVG-KRS-AFINAKF--FTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415
           N+       +  KRS A++ + F  F + SLV   +F    +Y    VL   +    L+ 
Sbjct: 599 NDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAF-AFYIYVQKEVLTTPIAFTALSL 657

Query: 416 FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL---TDYVPEIRPTLGKTYLPGKGEI 472
           F L      N +  LS   S ++Q   +  R+ +    TD     + T+     P   ++
Sbjct: 658 FTLLR----NPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYDQLTVA----PQGDQL 709

Query: 473 EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
           EFKN + S+ +  Q+   K+LN   + G    ++GP+G GK+++ + LL       G+I+
Sbjct: 710 EFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEII 769

Query: 533 I---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
           +   D ++   ++       +    Q   L++ ++R+NI +   Y   +     V + C 
Sbjct: 770 VPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEAR--YTSVIEACG 827

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 649
                        T+IG  G  LSGGQKQR+++ARA+      ++LD+  SA+D  +   
Sbjct: 828 LKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALW 887

Query: 650 I--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
           I  N   G LM  ++  +VS  H ++   ++ +++V+  DG V + G   EL 
Sbjct: 888 IYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMELL 938

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 152/311 (48%), Gaps = 23/311 (7%)

Query: 407  SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLG---- 462
            +L+ G +   M Y     N +  +     ++     +  R+ E  D  PE  P +     
Sbjct: 1229 ALSTGMVGLLMSYALQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRP 1288

Query: 463  KTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
            +   P +G + FK+ S  Y     + + K LN +I P   + IVG +G GKST++L L  
Sbjct: 1289 EKNWPAQGHVVFKDYSARY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFR 1347

Query: 523  YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR-----------DNITYG 571
               P  G I+IDG DITK+    LR  L I+ Q+     GS+R           D I   
Sbjct: 1348 ILEPCGGTIVIDGVDITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPFEQYSDDEIWRA 1407

Query: 572  LTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPN 631
            L  +  K  I K+A +        K  +  +T+I  +G+ LS GQ+Q + ++RAL+ +  
Sbjct: 1408 LELSHLKPHILKMANE----EGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSR 1463

Query: 632  ILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVI 691
            IL+LDEAT+A+D E++  I  T     K +  TI++IAHR+ T+  S+ ++VL + G V 
Sbjct: 1464 ILVLDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVK 1520

Query: 692  EMGKFKELFSD 702
            E      L +D
Sbjct: 1521 EFDSPSNLLAD 1531

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 101/434 (23%), Positives = 193/434 (44%), Gaps = 51/434 (11%)

Query: 301 GVLIIPVVISA-SIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRF 359
           GV+I+ V+    S   ++I++  ++  +      +   E LN VKTV+ +  E+  +KR 
Sbjct: 443 GVVIMAVMFPINSYLSRKIKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRL 502

Query: 360 NEAIRNIFHV---GKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416
           +  +RN   +    K +   N   F    +   ++  T L+Y   LV+   LT   +   
Sbjct: 503 DH-VRNELELESFKKIAVMNNLTLFAWNCVPILVASSTFLIYA--LVMDVPLTPQIVFPS 559

Query: 417 MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYL--------PG 468
           +   +   + I+ +       ++   +  RL    D++  +   L K+++        P 
Sbjct: 560 LSLFDILNDCIYTIPRTIINFIETGVSMGRL---KDFL--LAKELDKSFIEFESLPDDPN 614

Query: 469 KGEIEFKNVSF--SYPTRPQNQ--------------IFKNLN-FKIEPGSNVCIVGPSGK 511
              IE  N +F  + PT+  ++                KN++ F+   G  VC+VG  G 
Sbjct: 615 VPVIEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGA 674

Query: 512 GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
           GKST    LL      S       Q   KM+ +     + +  Q+  +++ S++ N+ +G
Sbjct: 675 GKSTFLHALLGQLPCISSS---HDQATPKMHFRC--DSVALCSQQAWILNASVKYNVLFG 729

Query: 572 LTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPN 631
             Y   +   +   + C     +       +T +G  G  LSGGQK RI++ARA+  + +
Sbjct: 730 HKYD--EASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSD 787

Query: 632 ILILDEATSALDVE-SEGAINYTFGQ---LMKTKSMTIVSIAHRLSTIRRSENVIVLGND 687
           + +LD+  SA+D E  +  I++   +   L+K K  T++   + +S ++ S+++  L N 
Sbjct: 788 VYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYALEN- 844

Query: 688 GSVIEMGKFKELFS 701
           G ++E G F E+ S
Sbjct: 845 GEIVERGSFDEIMS 858

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 146/561 (26%), Positives = 258/561 (45%), Gaps = 43/561 (7%)

Query: 152  CV-IGMMIPKVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLG-GFSIALLAGCM 209
            CV +G +I  ++  ++ +  ++  ++   E+   P     L IY  LG G ++A L   +
Sbjct: 955  CVFLGFLILSMLLAVIGNFWLKHWSEVNTEKGYNPHATRYLMIYLALGVGSALATLIQTI 1014

Query: 210  ANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSIT 269
              +         S+ L   + S+V+K  +     F++    G +++R   D Y V   + 
Sbjct: 1015 VLW--VFCTIHGSKYLHDAMASSVLKAPM----SFFETTPIGRILNRFSNDIYKVDEILG 1068

Query: 270  QKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDAT 329
            +  +  F +++     + ++C  +     +    ++P+ +    + +     SREL+   
Sbjct: 1069 RTFAQFFANVVKVSFTIVVICMATWQFIFI----VLPLSVLYIYYQQYYLRTSRELR-RL 1123

Query: 330  GQLTRVS-----EEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAF---INAKFF 381
              +TR       +E L G+ T++ +  + R +      + N       SAF   +NA  +
Sbjct: 1124 DSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRVDN-----NMSAFYPSVNANRW 1178

Query: 382  TSTSL--VGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQ 439
             +  L  +G +  L   +     + +G+LT G +   + +      S+  +     E+  
Sbjct: 1179 LAFRLEFIGSVIILAASMLAVIRLGNGTLTAGMIGLSLSFALQITQSLNWIVRMTVEVET 1238

Query: 440  GAGAASRLFELTDYVPEIRPTLGKTY-----LPGKGEIEFKNVSFSYPTRPQNQ-IFKNL 493
               +  R+ E  +   E  P + K +      P  GEI+F N S  Y  RP+ + I K++
Sbjct: 1239 NIVSVERIKEYAELKSE-APYIIKDHRPPASWPESGEIKFVNYSTRY--RPELELILKDI 1295

Query: 494  NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIV 553
            +  I P   + IVG +G GKS++ L L       SG I+IDG  I  +    LR  L I+
Sbjct: 1296 DLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSII 1355

Query: 554  QQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKF-PHTYDTQIGPSGTLL 612
             Q+  +  G++R+NI     Y  T EEI          + I     +  +T +   G+ L
Sbjct: 1356 PQDSQIFEGTVRENIDPTNRY--TDEEIWNALALSHLKDHILGMGSNGLETMLTEGGSNL 1413

Query: 613  SGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRL 672
            S GQ+Q + +ARAL+   NILILDEAT+A+DVE++  I  T     K +  TI++IAHR+
Sbjct: 1414 SVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTIRNAFKER--TILTIAHRI 1471

Query: 673  STIRRSENVIVLGNDGSVIEM 693
            +TI  S+ +IVL + G V E 
Sbjct: 1472 NTIMDSDRIIVL-DKGRVTEF 1491

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 98/386 (25%), Positives = 177/386 (45%), Gaps = 49/386 (12%)

Query: 333 TRVSEEQLNGVKTVQSFVAE-----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLV 387
           TRV+ E LN +K+++ +  E     + +  R  + ++N+  +G   A  N +F     LV
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQFNIVPFLV 541

Query: 388 GDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL 447
              +F  V VY     L   L    LT F L +         +S+F    ++ + + +RL
Sbjct: 542 SCSTF-AVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAISSF----IEASVSINRL 596

Query: 448 FE-LTDYVPEIRPTLGKTYLPGKGE--IEFKNVSFSYPTRPQNQI-FKNLNFKIEPGSNV 503
           F  LT+   +    L +  +   G+  ++  + +F +  +P+ ++  KN+NF  + G   
Sbjct: 597 FAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELT 656

Query: 504 CIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
           CIVG  G GKS +   LL             G  I      ++   +  V Q P +M+G+
Sbjct: 657 CIVGKVGSGKSALIQSLL-------------GDLIRVKGFATVHGDVANVSQVPWIMNGT 703

Query: 564 IRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIA 623
           ++DNI +G  Y P  E  +   K C     ++  P    T +G  G  LSGGQK R+++A
Sbjct: 704 VKDNILFGHKYDP--EFYQLTIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLA 761

Query: 624 RALIKKPNILILDEATSALDVE-SEGAINYTFG---------QLMKTKSMTIVSIAHRLS 673
           RA+  + +  +LD+  +A+D   ++  I +  G         +++ T  +T++SIA    
Sbjct: 762 RAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA---- 817

Query: 674 TIRRSENVIVLGNDGSVIEMGKFKEL 699
                 + I L  +G +I+ G + ++
Sbjct: 818 ------DSITLMENGEIIQQGSYDQV 837

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 130/505 (25%), Positives = 241/505 (47%), Gaps = 64/505 (12%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-CGGVGV 286
            ++ + ++ + +H   +F+D   TG +++R   D   + + +T  I   F SLI C    +
Sbjct: 1136 KIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIEC----L 1191

Query: 287  GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQLNG 342
              +  ++      L V I+ V I     G      SREL+     +   + +   E L G
Sbjct: 1192 STVILITFITPQFLSVAIV-VSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVG 1250

Query: 343  VKTVQSFVAE----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVY 398
            V T+++F  E    Q  +++ +E  +  F++   + ++  +      ++G L     +++
Sbjct: 1251 VTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRI----DMIGSL-----VIF 1301

Query: 399  GSYLVLHGSLTIGD-------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 451
            G+ L +  ++   D       LT  + +TE        L   YSE+     +  R+ E  
Sbjct: 1302 GAGLFILSNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYM 1357

Query: 452  DYVPE---IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVG 507
            +   E       +     P  G+IE  ++S  Y P  P+  + KN++F ++  S V IVG
Sbjct: 1358 EIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKVGIVG 1415

Query: 508  PSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN 567
             +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR + I+ Q+P L SG+I+ N
Sbjct: 1416 RTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTN 1475

Query: 568  ITYGLTYTPTK------------EE------IRKVAKQCFCHNF--ITKFPHTYDTQIGP 607
            +     ++  K            EE      +R+VA      +   + KF    ++++  
Sbjct: 1476 LDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLDL-ESEVSE 1534

Query: 608  SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVS 667
             G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++
Sbjct: 1535 GGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILT 1592

Query: 668  IAHRLSTIRRSENVIVLGNDGSVIE 692
            IAHRL ++   + ++V+ + G V E
Sbjct: 1593 IAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 101/419 (24%), Positives = 195/419 (46%), Gaps = 42/419 (10%)

Query: 297 SAVLGVLIIPVVISASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR 354
           +A+LGVLII  ++  +    K I  +  + L     ++ +++E     ++ ++ F  E+ 
Sbjct: 520 AAILGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWEEN 578

Query: 355 ---EIKRFNEA------IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 405
              +IK   E+      +R+I  +   S+F+   +F + ++V   SF        Y+ + 
Sbjct: 579 FENDIKAIRESELALLLMRSI--IWSISSFV---WFVTPTIVTAASF------AYYIYVQ 627

Query: 406 GSL--TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK 463
           G +  T    TA  L+T    + +  LS   S ++Q   +  R+    D++ E + T   
Sbjct: 628 GEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRV---QDFLNE-KDTEKY 682

Query: 464 TYL---PGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLL 520
             L   P      F+N + S+    Q+   K+LN + + G    ++GP+G GK+++ + L
Sbjct: 683 DQLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMAL 742

Query: 521 LHYYNPTSGQILIDGQDITK---MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT 577
           L      +G++++   D  +   + +      +    Q   L++ ++++NI +   +  T
Sbjct: 743 LGEMYLLNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET 802

Query: 578 KEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDE 637
           +   + V + C              T+IG  G  LSGGQKQR+++ARAL      ++LD+
Sbjct: 803 R--YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDD 860

Query: 638 ATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
             SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 861 CLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 139/545 (25%), Positives = 247/545 (45%), Gaps = 52/545 (9%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G +S I + +    N          S R   +L   + K  I     F++    G
Sbjct: 1017 VWMFVGVYSLIGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVG 1076

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  S+    S  FKS++   V V ++   ++    V  + ++ + I  
Sbjct: 1077 RIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTV-ILVGYNMPWFFVFNMFLLVIYIYY 1135

Query: 312  SIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQREI----KRFNEAI 363
              F     + SREL+     +   +  +  E LNG   + ++   +R I    ++    I
Sbjct: 1136 QTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNI 1192

Query: 364  RNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT-EY 422
              +F+    + +++ +  T   +   +   T ++  + +     L+ G +   M Y+ E 
Sbjct: 1193 DFVFNFRSTNRWLSVRLQT---IGATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSLEV 1249

Query: 423  TGNSIFGLSTFYSEIMQGAGAASRLFELTDY-------VPEIRPTLGKTYLPGKGEIEFK 475
            TG+  + + T    I     +  R+ E  +         PE RP       P KG IEFK
Sbjct: 1250 TGSLTWIVRTTVM-IETNIVSVERIVEYCELPSEARSINPENRP---DESWPSKGSIEFK 1305

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            N S  Y     + + K++N +I+P   + IVG +G GKST++L L     PT G I+ID 
Sbjct: 1306 NYSTKY-RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDD 1364

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             +I+ +    LR  L I+ Q+     G++R N+     Y  ++ E++K          + 
Sbjct: 1365 INISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRY--SEGELKKAVDLAHLGPHLE 1422

Query: 596  KF------------------PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDE 637
            K                       + +I  +GT LS GQ+Q + +ARAL+ +  IL+LDE
Sbjct: 1423 KMLDNEIRGADGAAEENGNVSDVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDE 1482

Query: 638  ATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
            AT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL ++G+V E     
Sbjct: 1483 ATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPS 1539

Query: 698  ELFSD 702
            +L SD
Sbjct: 1540 KLLSD 1544

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 97/396 (24%), Positives = 180/396 (45%), Gaps = 52/396 (13%)

Query: 338 EQLNGVKTVQSFVAEQREIKRFNEA-----IRNIFHVGKRSAFINAKFFTSTSLVGDLSF 392
           E LN +K+++ +  E+  ++R N       ++N   +G  S  I   +     L+   S 
Sbjct: 477 EILNAIKSIKLYAWEEPMMERLNHVRNDMELQNFRKIGIVSNLIYFAW-NCVPLMVTCST 535

Query: 393 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL--FEL 450
             +    S   L  ++    L+ F +      ++I+ + +  + I++ + +  RL  F L
Sbjct: 536 FGLFSLFSDTPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFLL 591

Query: 451 TD-----YVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRP-------------------- 485
           +D     ++  I P++ +  LP    IE  N++F + ++                     
Sbjct: 592 SDEIDDSFIERIDPSMSERTLP---VIEMNNITFLWKSKEALASGQFEGNSNADEESIIG 648

Query: 486 QNQI-FKNLN-FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNS 543
            +QI  KN++ F+ + G  VC+VG  G GKST    +L      SG     G    K+  
Sbjct: 649 SSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKGILGQLPCMSGS---KGSIPPKLII 705

Query: 544 KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDT 603
           ++    L    QE  +M+ S+R+NI +G  +     ++    K C     +   P   +T
Sbjct: 706 RA--SSLAYCSQESWIMNSSVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDET 761

Query: 604 QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKTK 661
            +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  + Y   G+    K
Sbjct: 762 LVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLK 821

Query: 662 SMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
           + TI+   + +  ++ S+ +  L N G +IE G ++
Sbjct: 822 NKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYE 856

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 135/508 (26%), Positives = 238/508 (46%), Gaps = 72/508 (14%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-CGGVGV 286
            ++ + ++ + +H   +F+D    G +++R   D     + +T  I   F SL+ C    V
Sbjct: 1123 KIFNLLLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQC----V 1178

Query: 287  GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSE--------E 338
              +  ++      L V I+  V+   + G      SREL+    +L  +S         E
Sbjct: 1179 STVVLITFITPQFLFVAILVAVLYYFV-GYFYLTGSRELK----RLESISRSPIYQHFSE 1233

Query: 339  QLNGVKTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLT 394
             L GV T+++F  E R     +++ +E  R  F++   + +++ +      ++G L    
Sbjct: 1234 TLVGVTTIRAFGDESRFMRENLQKIDENNRPFFYLWVANRWLSFRI----DMIGAL---V 1286

Query: 395  VLVYGSYLVLH------GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 448
            +   G +++L+      G   I  LT  + +TE        L   YS +     +  RL 
Sbjct: 1287 IFGAGIFVLLNIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSVERLK 1341

Query: 449  ELTDYVPE------IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGS 501
            E  D   E      + P +     P +G IE  ++S  Y P  P+  + KN++F ++P S
Sbjct: 1342 EYMDVEQEPYDQSILTPPVE---WPQQGRIEVNDLSLRYAPNLPK--VIKNVSFTVDPRS 1396

Query: 502  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMS 561
             V IVG +G GKSTI   L  + +P +G I ID  DIT ++ + LRR + I+ Q+P L +
Sbjct: 1397 KVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFT 1456

Query: 562  GSIRDNITYGLTYTP-------------TKEEIRK---VAKQCFCHNFITKFPHTYDTQI 605
            G+I+ N+     YT              T+EE+ +             I KF     ++I
Sbjct: 1457 GTIKSNLDPYDEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLDL-SSEI 1515

Query: 606  GPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTI 665
               G  +S GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +    TI
Sbjct: 1516 SEGGGNISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRK--EFGGNTI 1573

Query: 666  VSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            ++IAHRL ++   + ++V+ + G V E 
Sbjct: 1574 LTIAHRLRSVIDYDKILVM-DAGEVKEF 1600

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 110/474 (23%), Positives = 201/474 (42%), Gaps = 60/474 (12%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLG----VLIIP 306
           G +I+ +  DA+ VS  I   +    ++++   V   ++  L L  +A++G    V ++P
Sbjct: 478 GAIINLMAVDAFKVSE-ICAYLHAFVEAVVMALVAFVLLYHL-LGFAAIVGAALIVAMMP 535

Query: 307 VVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNI 366
           +    + +   ++   +E    T +  +   E    ++ ++ F  E      F + IR++
Sbjct: 536 LNFKLATWLGHLQ---KETLSVTDKRIQKLNEAFQAIRIIKFFSWENN----FEKDIRDV 588

Query: 367 FHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT------ 420
                       KF    SLV           GS  V + + TI    AF  Y       
Sbjct: 589 RET-------ELKFLMKRSLVWA---------GSSFVWYITPTIVTSCAFWFYIYIQGEV 632

Query: 421 -----EYTGNSIFGL--------STFYSEIMQGAGAASRLFE-LTDYVPEIRPTLGKTYL 466
                 +T  S+F L        S   S ++Q   +  R+ E L +   E    L     
Sbjct: 633 LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDTEKYNQLSTA-- 690

Query: 467 PGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
             K +I F+N + ++     +   KNLN   + G    I+GP+G GK+++ + LL   + 
Sbjct: 691 KDKKKIGFENATITWDAERPDFKLKNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHL 750

Query: 527 TSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRK 583
            SG+I++   D +    + +  +   +    Q   L++ ++++NI +   Y   + E   
Sbjct: 751 VSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNEGRYE--A 808

Query: 584 VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
           V + C      +       T+IG  G  LSGGQKQRI++AR+L      ++LD+  SA+D
Sbjct: 809 VVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVD 868

Query: 644 VESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGK 695
             +   I  N   G LM+ ++  +VS  H  +   R+  ++V   +G V   G+
Sbjct: 869 SHTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 132/475 (27%), Positives = 224/475 (47%), Gaps = 51/475 (10%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  +  F ++      + ++C  +         L
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRTFAQFFVNVTKVSFTIIVICVTTWQFI----FL 1097

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS--------EEQLNGVKTVQSFVAEQRE 355
            I+P+++    + +     SREL+    +L  V+        +E L G+ T++ +  + R 
Sbjct: 1098 ILPMIVLYVYYQQYYLRTSRELR----RLDSVTKSPVYAHFQESLGGLSTIRGYDQQDRF 1153

Query: 356  IKRFNEAIRNIFHVGKRSAF---INAKFFTSTSLVGDLSFL-TVLVYG----SYLVLH-G 406
                   I N       SAF   +NA  +    L   L F+ T++++G    S L L  G
Sbjct: 1154 THINQSRIDN-----NMSAFYPSVNANRW----LAFRLEFIGTIIIFGAASLSMLRLKAG 1204

Query: 407  SLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD-------YVPEIRP 459
            SLT G +   + Y      S+  +     E+     +  R+ E ++        + + RP
Sbjct: 1205 SLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRP 1264

Query: 460  TLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALL 519
                   P KG+I+F++ S  Y     N + K++N  ++P   + IVG +G GKS++ L 
Sbjct: 1265 PAD---WPSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLA 1320

Query: 520  LLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKE 579
            L        G+I+IDG  I ++    LR KL I+ Q+  +  G++R+NI     Y  + E
Sbjct: 1321 LFRIIEAAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDE 1378

Query: 580  EIRKVAKQCFCHNFITKFPHT-YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
            EI +V +     N +         T++   G  LS GQ+Q + +ARAL+    ILILDEA
Sbjct: 1379 EIWRVLELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEA 1438

Query: 639  TSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            T+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL + G V E 
Sbjct: 1439 TAAVDVETDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREF 1490

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 120/504 (23%), Positives = 226/504 (44%), Gaps = 71/504 (14%)

Query: 229 LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGV 286
           L ST+ K+ +    +  D+  TGD+++ +  D         Q++ D   +  LI  G   
Sbjct: 386 LTSTIYKKALVLSNEAADMSSTGDIVNLMSVDV--------QRLQDLTQYCHLIWSGPFQ 437

Query: 287 GMMCSLSL----DLSAVLGVLIIPVVISASIFGKQIRINSRELQ-DATGQLTRVSEEQLN 341
            ++C +SL      S  +GV+I+ +++  +    +I+   +++Q     + +R+  E LN
Sbjct: 438 ILLCLVSLYKLLGRSMWIGVIILVIMMPLNSMLMRIQKKLQKVQMKNKDERSRLISEILN 497

Query: 342 GVKTVQSFVAE-----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
            +K+++ +  E     + E  R ++ ++N+  +G   A  + +F     LV   +F  V 
Sbjct: 498 NIKSLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVSCSTF-AVF 556

Query: 397 VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE-LTDYVP 455
           VY     L   L    L  F L +         L+ F    ++ + + +RL+  LT+   
Sbjct: 557 VYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSFLTN--E 610

Query: 456 EIRPTLGKTYLPGK---GEIEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGP 508
           E++      +LP     G++  K   + +F +  +PQ Q+  KN+N +++ G   C+VG 
Sbjct: 611 ELQKD-AVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGK 669

Query: 509 SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
            G GKS +   LL       G   + G                 V Q P +M+G+++DNI
Sbjct: 670 VGSGKSALVQSLLGDLYRVKGYAAVHGST-------------AYVSQVPWIMNGTVKDNI 716

Query: 569 TYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIK 628
            +G  Y P   ++    K C     +   P    T +G  G  LSGGQK R+++ARA   
Sbjct: 717 LFGHKYDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYA 774

Query: 629 KPNILILDEATSALDVE-SEGAINYTFG---------QLMKTKSMTIVSIAHRLSTIRRS 678
           + +  +LD+  +A+D   ++  I +  G         +L+ T  +T++SIA  +S +   
Sbjct: 775 RADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE-- 832

Query: 679 ENVIVLGNDGSVIEMGKFKELFSD 702
                    G +I+ G ++++  D
Sbjct: 833 --------GGEIIQHGSYEDISKD 848

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 145/544 (26%), Positives = 254/544 (46%), Gaps = 51/544 (9%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G +S I + +    N          S R   +L  ++ K  I     F++    G
Sbjct: 1017 VWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVG 1076

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  ++    S  FKS++   V V ++   ++    V  + ++ + I  
Sbjct: 1077 RIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTV-ILVGYNMPWFLVFNMFLVVIYIYY 1135

Query: 312  SIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRN-- 365
              F     + SREL+     +   +  +  E LNG   + ++   +R I    E I+   
Sbjct: 1136 QTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNV 1192

Query: 366  --IFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYT-EY 422
              +F+    + +++ +  T   +   +   T ++  + +     L+ G +   M Y+ E 
Sbjct: 1193 DFVFNFRSTNRWLSVRLQT---IGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEV 1249

Query: 423  TGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTYLPGKGEIEFK 475
            TG+  + + T  + I     +  R+ E  +  PE        RP       P KG IEFK
Sbjct: 1250 TGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDEN---WPSKGGIEFK 1305

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            N S  Y     + +  N+N KIEP   V IVG +G GKST++L L     PT G+I+IDG
Sbjct: 1306 NYSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDG 1364

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             DI+ +    LR  L I+ Q+     G+++ N+     Y  +++E+++  +Q      + 
Sbjct: 1365 IDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRY--SEDELKRAVEQAHLKPHLE 1422

Query: 596  KFPHT-----------------YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
            K  H+                  D +I  +G+ LS GQ+Q + +ARAL+ +  IL+LDEA
Sbjct: 1423 KMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEA 1482

Query: 639  TSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
            T+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + GSV E     +
Sbjct: 1483 TASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSK 1539

Query: 699  LFSD 702
            L SD
Sbjct: 1540 LLSD 1543

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 115/499 (23%), Positives = 233/499 (46%), Gaps = 75/499 (15%)

Query: 250 TGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGV-GMMCSLSLDL-SAVLGVLI--- 304
           TGD+++ +  D   +     Q+  +  +++I   + +  ++ SL   L  AV+G L+   
Sbjct: 390 TGDILNLMSVDVLRI-----QRFFENAQTIIGAPIQIIVVLTSLYWLLGKAVIGGLVTMA 444

Query: 305 IPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIR 364
           I + I+A +  K  +++  +++    ++  ++E  LN +K+++ +  E+  + R N  +R
Sbjct: 445 IMMPINAFLSRKVKKLSKTQMKYKDMRIKTITE-LLNAIKSIKLYAWEEPMMARLNH-VR 502

Query: 365 NIFHVGKRSAFINAKFFTSTSLVGDLSFLT-----VLVYGSYLVLHGSLTIGDLTAFMLY 419
           N   +         K F    +V +L +       ++V  S   L    +   L+  +++
Sbjct: 503 NDMEL---------KNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDSPLSPAIVF 553

Query: 420 TEYT-----GNSIFGLSTFYSEIMQGAGAASRL--FELTD-----YVPEIRPTLGKTYLP 467
              +      ++I+ + +  + I++ + +  RL  F L+D     ++  I P+  +  LP
Sbjct: 554 PSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSADERALP 613

Query: 468 GKGEIEFKNVSFSYPTRP--------------------QNQI-FKNLN-FKIEPGSNVCI 505
               IE  N++F + ++                      +QI  KN++ F+ + G  VC+
Sbjct: 614 A---IEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCV 670

Query: 506 VGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSI 564
           VG  G GKST    +L      SG +  I  + I + +S      +    QE  +M+ S+
Sbjct: 671 VGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSS------VAYCSQESWIMNASV 724

Query: 565 RDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIAR 624
           R+NI +G  +     ++    K C     +   P   +T +G  G  LSGGQK R+++AR
Sbjct: 725 RENILFGHKFDQDYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLAR 782

Query: 625 ALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKTKSMTIVSIAHRLSTIRRSENVI 682
           A+  + +I +LD+  SA+D E S+  I Y   G+    K+ TI+   + +S ++ S+ + 
Sbjct: 783 AVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIY 842

Query: 683 VLGNDGSVIEMGKFKELFS 701
            L N G ++E G ++++ +
Sbjct: 843 ALEN-GEIVEQGNYEDVMN 860

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 121/495 (24%), Positives = 238/495 (48%), Gaps = 40/495 (8%)

Query: 224  RLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGG 283
            R   ++ + ++K  ++   +F+D    G +++R   D   + + +T  +   F SLI   
Sbjct: 1127 RASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCV 1186

Query: 284  VGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
              + ++  ++     V  ++++     A  +    R   R    +   + +   E L G+
Sbjct: 1187 STIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSRSPIHQHFSETLVGI 1246

Query: 344  KTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG 399
             T+++F  E+R     +K+ ++  R  F++   + +++ +      L+G L    VL  G
Sbjct: 1247 TTIRAFSDERRFLVDNMKKIDDNNRPFFYLWVCNRWLSYRI----ELIGAL---IVLAAG 1299

Query: 400  SYLVLHGSLTIGDLTAFML--YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE- 456
            S+++L+       L    L    ++T  +++ +   YS +     +  RL E T    E 
Sbjct: 1300 SFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTTIEQEP 1358

Query: 457  --IRPTLGKTYLPGKGEIEFKNVSFSYPT-RPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
              +   +     P  G+IE K++S  Y    P+  + KN+ F ++    V IVG +G GK
Sbjct: 1359 SNVGALVPPCEWPQNGKIEVKDLSLRYAAGLPK--VIKNVTFTVDSKCKVGIVGRTGAGK 1416

Query: 514  STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
            STI   L  + +P +G I ID  DIT +  K LR+ + I+ Q+P L +G+++ N+     
Sbjct: 1417 STIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNE 1476

Query: 574  YTPTK--EEIRKV-------------AKQCFCHNF-ITKFPHTYDTQIGPSGTLLSGGQK 617
            Y+  +  E +++V             +     H+  + KF    + ++   G+ LS GQ+
Sbjct: 1477 YSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLDL-ENEVSEGGSNLSQGQR 1535

Query: 618  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
            Q I +AR+L++ P +++LDEAT+++D  S+  I  T  +  +  + TI++IAHRL +I  
Sbjct: 1536 QLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIRE--EFSNSTILTIAHRLRSIID 1593

Query: 678  SENVIVLGNDGSVIE 692
             + ++V+ + G V E
Sbjct: 1594 YDKILVM-DAGEVKE 1607

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 111/488 (22%), Positives = 213/488 (43%), Gaps = 48/488 (9%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           K+ +  D +       G +I+ +  DA+ VS  I   +    +++I   V + ++  L +
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRL-I 524

Query: 295 DLSAVLGVLIIPVVIS-----ASIFG----KQIRINSRELQDATGQLTRVSEEQLNGVKT 345
             SA++G  +I   +      AS+ G    K + I  + +Q           E    ++ 
Sbjct: 525 GWSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EAFQAIRI 576

Query: 346 VQSFVAEQREIKRFNEAIRN-----IFHVGKRS---AFINAKFFTSTSLVGDLSFLTVLV 397
           ++ F  E+     F + I+N     +  + KRS   A  +  +F + S+V   SF  V +
Sbjct: 577 IKFFSWEEN----FEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSASF-AVYI 631

Query: 398 YGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI 457
           Y     L   +    L+ F L      N +  LS   S ++Q   +  R+ E   ++ E 
Sbjct: 632 YVQGQTLTTPVAFTALSLFALLR----NPLDMLSDMLSFVIQSKVSLDRVQE---FLNEE 684

Query: 458 RPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA 517
                +     + ++  +N +F++    Q+   KNL    + G    IVGP+G GK+++ 
Sbjct: 685 ETKKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLL 744

Query: 518 LLLLHYYNPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
           + LL      +G++ +   + ++   + +  +   +    Q   L++ ++R+NI +   Y
Sbjct: 745 MGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPY 804

Query: 575 TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
              +     V   C              T+IG  G  LSGGQKQR+++AR+L      L+
Sbjct: 805 NENR--YNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLL 862

Query: 635 LDEATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
           LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   ++ + +++  +G V E
Sbjct: 863 LDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKE 920

Query: 693 MGKFKELF 700
            G+  EL 
Sbjct: 921 QGEPVELL 928

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 156/579 (26%), Positives = 264/579 (45%), Gaps = 101/579 (17%)

Query: 179  GEEAPPP---IMMFGLTIYEFLGGFSIALLAGC--MANFGXXXXXXXXSERLVARLRSTV 233
            G   PP      ++ L++Y FL G   ALL G   MA F           +   ++ + +
Sbjct: 1028 GSSNPPKNRHTAVYYLSMY-FLIGIIQALLGGIKTMATF-------LSGLQASKKIFNNM 1079

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLS 293
            +   +H + +F+D+   G +++R   D             +G    +   + V + C + 
Sbjct: 1080 LDLVLHANIRFFDVTPVGRIMNRFAKDI------------EGVDQELIPYLEVTIFCLIQ 1127

Query: 294  LDLSAVLGVLIIP---------VVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQL 340
              LS +  + II          V++     GK      REL+  D+  +  + +   E L
Sbjct: 1128 C-LSIIFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETL 1186

Query: 341  NGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGS 400
             GV T+++F  E+R I      + N+  + +     N  FF  +  V   +F  V + G+
Sbjct: 1187 AGVCTIRAFGDEKRFI------LENMDKIDQN----NRAFFYLSVAVKWFAF-RVDIIGA 1235

Query: 401  YLVL-HGS---LTIGDLTAFMLYTEYTGNSIF-----GLSTFYSEIMQGAGAASRLFELT 451
            ++VL  GS   L IGD+ + +     T + +F      L   YS       +  RL E +
Sbjct: 1236 FIVLGSGSFILLNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYS 1295

Query: 452  -----DYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
                 +Y       L  +  P  G+IE  N+S  Y +     + KN++F ++P + + IV
Sbjct: 1296 GIEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIV 1354

Query: 507  GPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
            G +G GKSTI   L     P +G I IDG DI+K++  +LRR + I+ Q+P+L +G+I+ 
Sbjct: 1355 GRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKS 1414

Query: 567  NITYGLTYTPTKE-EIRKVAKQCFCHNFIT------------KFPHTYD------TQIGP 607
            N+       P  E + R++ K     N I+             F   ++      T+I  
Sbjct: 1415 NL------DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVE 1468

Query: 608  SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES----EGAINYTFGQLMKTKSM 663
             G  LS G+KQ + IAR+L+++P I++LDEATS++D +S    +G I   F +       
Sbjct: 1469 GGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------S 1522

Query: 664  TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            TI++IAHRL ++   + V+V+ + G V E     EL  +
Sbjct: 1523 TILTIAHRLRSVIDYDKVLVM-DAGEVKEYDHPYELLKN 1560

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 131/513 (25%), Positives = 229/513 (44%), Gaps = 59/513 (11%)

Query: 225 LVARLRSTVIKRTIHQDAQFYDIHKT-----GDLISRLGADAYIVSRSITQKISDGFKSL 279
           L++ + S  ++R +    +  D   +     G +I+ +  D++ VS  I+  I    +++
Sbjct: 413 LISEIYSKALRRKLFTSPKVNDDKDSASANLGTVINLISIDSFKVSE-ISNCIYTTVQAV 471

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS-----ASIFGKQIRINSRELQDATGQLTR 334
           I   + + ++    L LSA+ G+ II V+       AS+ G   R     L+    +++R
Sbjct: 472 IMILIVIVLLFKF-LGLSALAGISIILVMFPLNFKLASLLG---RCQELALRCTDERISR 527

Query: 335 VSEEQLNGVKTVQSFVAEQR---EIKRFNEA-IRNIFHVGKRSAFINAKFFTSTSLVGDL 390
           ++E  L  ++ V+ F  E     +IK   +  ++ +F      A  +  +F + +LV  +
Sbjct: 528 LNE-CLQNIRIVKYFAWENNISNDIKSSRQKELKFLFRKSLLWAVSSFLWFVTPTLVTSV 586

Query: 391 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450
           +F  V ++     L+  L    L+ F L        +  LS   S + Q   +  R+ E 
Sbjct: 587 TF-AVYIFVQQQELNAPLAFTTLSLFTLLK----TPLDQLSNMLSFMNQSKVSLERIVEF 641

Query: 451 TDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFK------NLNFKIEPGSNVC 504
            +     +     T  P K +I+FK  +  +     N I K      N+NF+I  G    
Sbjct: 642 LNEEDTAKYN-QLTVSPDKNKIKFKKATLVW-NENDNDINKFRLCDLNINFRI--GKLNL 697

Query: 505 IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD-----ITKMNSKSLRRKLGIVQQEPVL 559
           I+G +G GKS + + LL      SG I++ G +     I  +N   L        Q   L
Sbjct: 698 ILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLNG--LTNSFAYCSQSAWL 755

Query: 560 MSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQR 619
           ++G++R+NI +   Y   +   + V   C     +   P    T+IG  G  LSGGQKQR
Sbjct: 756 LNGTVRNNIIFNGVYDENR--YKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQR 813

Query: 620 IAIARALIKKPNILILDEATSALDVESEGAINYTF---GQLMKTKSMTIVSIAHRLS-TI 675
           I++ARA+      ++LD+  SA+D  +   I Y     G LMK +  T + + H +S  I
Sbjct: 814 ISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAI 870

Query: 676 RRSENVIVLGN-----DGSVIEM---GKFKELF 700
           R++   ++L N      G++ E+   G FKE F
Sbjct: 871 RKAYFAVILENGKVKSQGTITELKNKGVFKEDF 903

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 126/480 (26%), Positives = 236/480 (49%), Gaps = 47/480 (9%)

Query: 233  VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
            ++ + +H   +F+D    G +++R   D      +I Q+++   +S++   V +     L
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDI----EAIDQELTPYVESVVYNSVQLIATVLL 1191

Query: 293  SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQS 348
               ++    V+ + V++     G      SREL+  ++T +  + +   E L GV T+++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 349  FVAEQREIK----RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLT--VLVYGSYL 402
            +  E R +K    + +E  +  F++   + ++  +      ++G L      VLV  +  
Sbjct: 1252 YGDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRI----DIIGSLVIFGAGVLVLMNIN 1307

Query: 403  VLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPT-- 460
             +   L    LT  + +TE    S   L   YS +     +  R+ E  D   E      
Sbjct: 1308 KIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAGI 1363

Query: 461  --LGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA 517
              + K++ P +G+IE  ++S  Y P+ P+  + KN++F +EP   V +VG +G GKSTI 
Sbjct: 1364 VNVDKSW-PSEGKIEVNDLSLRYAPSLPK--VIKNVSFTVEPKMKVGVVGRTGAGKSTII 1420

Query: 518  LLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT 577
              L  + +P +G I ID  DIT ++ K LR+ + I+ Q+P L +G+I+ N+     Y   
Sbjct: 1421 TALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDD 1480

Query: 578  K--EEIRKV-----------AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIAR 624
            +  + +R+V                  N + KF +   ++I   G+ LS GQ+Q + +AR
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSEN-VNKFLNL-QSEISEGGSNLSQGQRQLMCLAR 1538

Query: 625  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVL 684
            +L++ PNI++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++   + ++V+
Sbjct: 1539 SLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVM 1596

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 115/231 (49%), Gaps = 11/231 (4%)

Query: 470 GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
            +I  +NV+ S+  + Q+   +NLN   + G    ++GP+G GK+++ + LL   +   G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 530 QILIDGQD---ITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK 586
           +I +   D       +S  L   +    Q   L++ ++++NI +   Y   +E    V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYN--EERYLAVIS 813

Query: 587 QCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
            C              T+IG  G  LSGGQKQRI++ARAL      ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 647 EGAI--NYTFGQLMKTKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVIEMG 694
              I  N   G LM+ ++  +VS  H ++ T++ +E VI++ N G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN-GKISHIG 921

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 144/567 (25%), Positives = 260/567 (45%), Gaps = 82/567 (14%)

Query: 175  TQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVI 234
              S+ E +P     + L++Y FL G   A+LA  + N          S ++     S ++
Sbjct: 1096 VNSKKEHSPA----YYLSVY-FLIGIINAILAA-LKNIFNYYSGIAASRKIF----SLLL 1145

Query: 235  KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
             + +H + +F+D    G +++R   D   V + +   +      +I     + ++  ++ 
Sbjct: 1146 NKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTILLITYITP 1205

Query: 295  DLSAVLGVLIIPVVISASIF--GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQS 348
            +       LII ++++   +  G      SREL+  D+  +  + +   E L GV TV++
Sbjct: 1206 EF------LIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVTTVRA 1259

Query: 349  FVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGS--YL 402
            +  E R     +K  +E  +  F++   + ++  +      +VG L     +++GS  ++
Sbjct: 1260 YGDEARFMRENLKMIDENNKPFFYLWVSNRWLAFRI----DVVGAL-----VIFGSGVFV 1310

Query: 403  VLHGSLTIGDLTAFML-----YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI 457
            +L+       L    L     +TE    S   L   YS +     +  RL E  +   E 
Sbjct: 1311 LLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYME--VEQ 1364

Query: 458  RPTLGKTY-----LPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGK 511
             P    +       P +G+IE  +VS  Y P  P+  + KN  F ++P   V IVG +G 
Sbjct: 1365 EPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLPR--VIKNATFTVDPKMKVGIVGRTGA 1422

Query: 512  GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
            GKSTI   L  + +P +G I ID  DI+ +  K LRR + I+ Q+P L SG+I+ N+   
Sbjct: 1423 GKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPY 1482

Query: 572  LTYTPTK--EEIRKVA-------------KQCFCHNFITKFPHTYDTQIGPSGTLLSGGQ 616
              Y+  +  E +++V              +Q        KF +  + +I   G+ LS GQ
Sbjct: 1483 DEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGGSNLSQGQ 1541

Query: 617  KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIR 676
            +Q + +AR+L++ P +++LDEAT+++D  S+  I  T     +    TI++IAHRL T+ 
Sbjct: 1542 RQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRLRTVI 1599

Query: 677  RSENVIVLGNDGSVIEMGKFKELFSDP 703
              + ++V+       + G+ KE F  P
Sbjct: 1600 DYDKILVM-------DAGEVKE-FDHP 1618

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 128/554 (23%), Positives = 239/554 (43%), Gaps = 75/554 (13%)

Query: 193 IYEFLGGFSIALLAGC--MANFGXXXXXXXXSERLVARLRSTVIKRTIHQD--AQFYDIH 248
           +Y FL  F   ++A C   A F            LV+ + S  +KR I  D  A   D++
Sbjct: 398 LYVFLMFFCRVIVAACSGQALFFGRRVCVRMRSILVSEIYSKALKRKISNDKSASLKDLN 457

Query: 249 KT-------------------------GDLISRLGADAYIVSRSITQKISDGFKSLICGG 283
           +                          G +I+ +  D + V+  I   +    ++++   
Sbjct: 458 EQEEVDPQIENDLENIDGDEESKSSNLGSIINLMAVDTFKVA-DICAYLHHFVEAVVMTI 516

Query: 284 VGVGMMCSLSLDLSAVLGVLIIPVVIS-----ASIFGKQIRINSRELQDATGQLTRVSEE 338
           V + ++  L L ++A++G  +I  ++      AS+ GK  +  S E+ D   Q      E
Sbjct: 517 VALILLFKL-LGVAAIVGASLIIALLPLNFKLASLLGKYQK-KSLEVTDKRIQKLN---E 571

Query: 339 QLNGVKTVQSFVAE-----------QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLV 387
               ++ ++ F  E           +RE++     IR+I  V   S+F+   +F + ++V
Sbjct: 572 AFQAIRIIKFFSWEDNFEKDILEVRERELRMI--LIRSI--VWAISSFV---WFVTPTIV 624

Query: 388 GDLSF-LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASR 446
              SF   V V G  L +  + T   L A +     T       S   S ++Q   +  R
Sbjct: 625 TGASFTYYVYVQGEVLTIPVAFTALSLFALLKIPLDT------FSDMLSFVIQSKVSLDR 678

Query: 447 LFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIV 506
           + E  +   + +     T    + +I FKN + ++    Q+   +N++   + G    I+
Sbjct: 679 IQEFLEE-EDTKKYEQLTVDKYQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVII 737

Query: 507 GPSGKGKSTIALLLLHYYNPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGS 563
           GP+G GK+++ + LL   +   G+I++   D ++  K+++  L   +    Q   L++ +
Sbjct: 738 GPTGSGKTSLLMALLGEMDLIDGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDT 797

Query: 564 IRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIA 623
           +R+NI +   Y   +E    V +                T+IG  G  LSGGQKQR+++A
Sbjct: 798 VRNNILFNSPYC--EERYNAVVEASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLA 855

Query: 624 RALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENV 681
           RAL      L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+ + 
Sbjct: 856 RALYSNSKHLLLDDCLSAVDSHTATWIYDNCISGPLMENRTCILVS--HNIALTLRNADY 913

Query: 682 IVLGNDGSVIEMGK 695
           +V   +G ++E G+
Sbjct: 914 VVKLENGKIVEHGE 927

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 128/496 (25%), Positives = 223/496 (44%), Gaps = 58/496 (11%)

Query: 233  VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
            ++ R ++    F+D    G +++R   D  ++   +   + DG  S     V   M+   
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFL-DGVFSCFIQAVTALMLIVF 1197

Query: 293  SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ----DATGQLTRVSEEQLNGVKTVQS 348
               ++    ++ I ++ S+   G      SREL+     +   + +   E L+G+ T+++
Sbjct: 1198 ---ITPKFLIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 349  FVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSF-------LTVLVYGSY 401
            F  E + +K       N+  + + + F    FF   S+   LSF       +TV   G++
Sbjct: 1255 FGNEIKFLKE------NLDFIDENNKF----FFYMWSVNSWLSFRIDLLGAITVFGSGAF 1304

Query: 402  LVLHGS-----LTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE 456
            ++L+       L    LT  + +TE+       +  FYS +     +  RL E  +   E
Sbjct: 1305 ILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEE 1360

Query: 457  IRPTLG----KTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGK 511
                 G        P +G I F N S  Y P  P   + K LN KI+ GS + +VG +G 
Sbjct: 1361 ALADPGAITPSENWPVQGAITFANYSLRYAPKLPD--VLKQLNLKIDGGSKIGVVGRTGA 1418

Query: 512  GKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYG 571
            GKSTI   L  + + +SG+ILID  DI+++N + LR  L I+ Q+P L  G+IR N+   
Sbjct: 1419 GKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPN 1478

Query: 572  LTYTPTKEEIRKVAKQCFCHNFITKFPH--------------TYDTQIGPSGTLLSGGQK 617
              Y         V       +++    +                D+ I   G  LS GQ+
Sbjct: 1479 EEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQR 1538

Query: 618  QRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR 677
            Q I +AR+++    I++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++  
Sbjct: 1539 QLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVID 1596

Query: 678  SENVIVLGNDGSVIEM 693
             + ++VL + G  +E 
Sbjct: 1597 YDKILVL-DAGQALEF 1611

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 115/461 (24%), Positives = 206/461 (44%), Gaps = 34/461 (7%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G +I+ +  DA  V   +   +    ++LI   V V ++  + L  +A +G  +I   I 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRI-LGTAAFIGTAVIIFFIP 553

Query: 311 ASIF-GKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHV 369
            ++F  K I    RE    T Q  +   E    ++ ++SF  E   I++          V
Sbjct: 554 FNVFLTKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWENNIIQKILGLRNKEISV 613

Query: 370 GKRSAFINAKFFTSTSLVGDLS--FLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSI 427
            KR    N+  ++  +LV  LS   +T L +  Y+++       DLT  + +T     ++
Sbjct: 614 LKR----NSITWSINALVWYLSPTIITTLSFSYYILVDKQ----DLTTPVAFTALALFNL 665

Query: 428 FG-----LSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYP 482
                  LS   + + Q   +  R+ +    V E       +    +  + F   +  + 
Sbjct: 666 LKAPLDQLSNTINFLTQSKVSLDRIEKFLS-VKETTKFENLSVDSSQNRLAFSGATLGWC 724

Query: 483 TRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMN 542
              ++   +N+N + E G    ++GP+G GK+++ + LL   +  SG++ +   + +K N
Sbjct: 725 GNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFN 783

Query: 543 ----SKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFP 598
               S +L   +    Q P + + +IR+NI + + Y   K+    V   C          
Sbjct: 784 LIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILN 841

Query: 599 HTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTF---G 655
               T +G  G+ LSGGQKQRI++ARAL  K   LILD+  SA+D  S   I Y     G
Sbjct: 842 LGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI-YNVCITG 900

Query: 656 QLMKTKSMTIVSIAHRLS-TIRRSENVIVLGNDGSVIEMGK 695
            LM+ ++  +VS  H +S TI+++  V ++ N G ++  G+
Sbjct: 901 PLMQGRTCILVS--HNVSLTIKKASKVFMIEN-GYIVASGR 938

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 125/495 (25%), Positives = 233/495 (47%), Gaps = 66/495 (13%)

Query: 233  VIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSL 292
            ++ + +H   +F+D    G +++R   D   + + +       F S I     + ++  +
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 293  S---LDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKT 345
            +   L ++ ++G+L   +       G      SREL+  D+  +  + +   E L GV T
Sbjct: 1194 TPQFLSVAIIVGMLYYMI-------GYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTT 1246

Query: 346  VQSFVAEQREIK----RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSY 401
            +++F  E R ++    + +E  R  F++   + +++ +      ++G L     +V+GS 
Sbjct: 1247 IRAFGDESRFLRENLLKIDENNRPFFYLWVANRWLSFRI----DVIGAL-----VVFGSG 1297

Query: 402  LVLHGSLTIGD-------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT--- 451
            + +  ++   D       LT  + +TE        L  FYSE+     +  R+ E     
Sbjct: 1298 IFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIE 1353

Query: 452  -DYVPEIRPTLGKT--YLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGP 508
             +   E++ +  K     P +G IE  ++S  Y      ++ KN+ F ++P + V +VG 
Sbjct: 1354 QEPYDEVQVSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGR 1412

Query: 509  SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
            +G GKSTI   L  +    +G I IDG DIT +N   LRR + I+ Q+P L SG+I+ N+
Sbjct: 1413 TGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNL 1472

Query: 569  TYGLTYTPTK--EEIRKV----------------AKQCFCHNFITKFPHTYDTQIGPSGT 610
                 Y   +  E +R+V                 +       I +F    +++I   GT
Sbjct: 1473 DPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLDL-ESEIAEGGT 1531

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
              S GQ+Q I +AR+L++ P IL+LDEAT+++D +S+  +  T     +    TI++IAH
Sbjct: 1532 NFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAH 1589

Query: 671  RLSTIRRSENVIVLG 685
            RL ++   + ++V+G
Sbjct: 1590 RLRSVIDYDKILVMG 1604

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 113/475 (23%), Positives = 211/475 (44%), Gaps = 32/475 (6%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           K  I+ D +     K G +I+ +  D++ +S  I   +     +++   V + ++  L +
Sbjct: 467 KENINGDEESIPSAKLGAVINLMAVDSFKISE-ICAYLHLFIGAIVMVVVALTLLFKL-I 524

Query: 295 DLSAVLGVLIIPVVISASIF-GKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ 353
             +A +GVL+I +V+  + +    +    RE    T +  +   E    ++ ++ F  E 
Sbjct: 525 GYAAFVGVLVILIVLPINFYLANWLGRLQRESLAFTDKRIQKLNETFQAIRIIKFFSWED 584

Query: 354 R---EIKRFNEAIRNIFHVGKRSAFINA-KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLT 409
               +I +  E   N+      S  I+   ++ + S+V   SF T  +Y    VL   + 
Sbjct: 585 NFSSDIDKIREGELNLLLWRAISWAISGFVWYLTPSIVTTASF-TFYIYVQGEVLTTPVA 643

Query: 410 IGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL-----TDYVPEIRPTLGKT 464
              L+ F L  +     +  LS   S ++Q   +  R+ +      TD   ++      T
Sbjct: 644 FTALSLFSLLRD----PLDRLSDMLSFVIQSKVSLDRVQDFLNEEDTDKYNQL------T 693

Query: 465 YLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
               K +I FKN + ++     +   +NLN   + G    I+GP+G GK+++ + LL   
Sbjct: 694 VATNKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEM 753

Query: 525 NPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEI 581
           N   GQI++   + +    + S      +    Q   L++ ++R+NI +   Y  T+   
Sbjct: 754 NLLEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--Y 811

Query: 582 RKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSA 641
             V + C              T+IG  G  LSGGQKQRI++ARAL      ++LD+  SA
Sbjct: 812 HNVVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSA 871

Query: 642 LDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
           +D  +   +  N   G LM+ ++  +VS  H ++   R+ +++V+  DG V + G
Sbjct: 872 VDAHTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 125/466 (26%), Positives = 212/466 (45%), Gaps = 33/466 (7%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     + ++CS +     V    
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIVICSSTWQFVFV---- 1075

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            IIP+      + +     SREL+     +TR       +E L G+ T++ +  + R +  
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELR-RLDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHI 1134

Query: 359  FNEAIRNIFHVGKRSAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTIGDL 413
                + N       SAF   +NA  + +  L  +G +  L       + +  G+LT G +
Sbjct: 1135 NQARVDN-----NMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMI 1189

Query: 414  TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE----IRPTLGKTYLPGK 469
               + Y      S+  +     E+     +  R+ E  +  PE    I         P  
Sbjct: 1190 GLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWPTH 1249

Query: 470  GEIEFKNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTS 528
            G I+F+N S  Y  RP+  +  +N+N  I+P   + IVG +G GKS++ L L        
Sbjct: 1250 GAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAE 1307

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC 588
            G+I+IDG     +  + LR  L I+ Q+  +  G++R+NI     Y  T EEI    +  
Sbjct: 1308 GRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEY--TDEEIWHALELA 1365

Query: 589  FCHNFITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 647
               + I        ++ +   G  LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++
Sbjct: 1366 HLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETD 1425

Query: 648  GAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
              I  T     K +  TI++IAHR++TI  S+ ++VL + G + E 
Sbjct: 1426 QVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEF 1468

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 112/480 (23%), Positives = 218/480 (45%), Gaps = 64/480 (13%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         Q++ D   +  +I  G    ++C +SL      S  +GV+
Sbjct: 386 TGDIVNLMSVD--------VQRLQDLTQWGQIIWSGPFQLILCLISLYKLLGNSMWVGVI 437

Query: 304 IIPVVISAS--IFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE-----QREI 356
           I+ ++I A+  I   Q ++   ++++   + TR   E LN +K+++ +  E     + + 
Sbjct: 438 IMVIMIPANSVIIRYQKKLQKIQMKN-KDERTRTISEILNNIKSLKLYAWEVPFREKLDK 496

Query: 357 KRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416
            R  + ++N+  +G  +A  + +F     LV   +F   +       L   L    LT F
Sbjct: 497 VRNEKELQNLKRMGITTAIASFQFNIVPFLVSCSTFAVFVWTQKDRPLSTDLVFPALTLF 556

Query: 417 MLYTEYTGNSIFGLS---TFYSEIMQGAGAASRLF------ELTDYVPEIRPTLGKTYLP 467
            L +       F L+   T  +  ++ + + +RL       EL     + +P + KT   
Sbjct: 557 NLLS-------FPLAIIPTALTSFIEASVSVNRLHSFLTNEELQRDSVQRKPKVTKT--- 606

Query: 468 GKGEIEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY 523
             GE+      + +F +  +P+ ++  KN+NF+ + G   CIVG  G GKS +   +L  
Sbjct: 607 --GEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL-- 662

Query: 524 YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRK 583
                      G         S+   +  V Q P +M+G++++NI +G  Y     +   
Sbjct: 663 -----------GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKYDADFYD--T 709

Query: 584 VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643
             + C     ++  P   +T +G  G  LSGGQK RI++ARA+  + +  +LD+  +A+D
Sbjct: 710 TLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVD 769

Query: 644 VE-SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              ++  I +  G      S   V   +++S +  ++++ +L N G +I+ G ++E+ SD
Sbjct: 770 EHVAKHLIEHVLGSQGLLSSKVKVLATNKISVLSIADHISLLEN-GEIIQQGSYEEVTSD 828

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 132/506 (26%), Positives = 235/506 (46%), Gaps = 66/506 (13%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLI-CGGVGV 286
            ++  +++   +H   +F+D    G +++R   D   V + +T  +   F  L+ C    V
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVEC----V 1214

Query: 287  GMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQLNG 342
              M  ++  ++    +L I +     + G      SREL+         + +   E L G
Sbjct: 1215 STMLLIAF-ITPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVG 1273

Query: 343  VKTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVY 398
            + T++++  E+R     + + +E  +  F++   + +++ +      ++G L    V   
Sbjct: 1274 IVTIRAYGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSFRI----DMIGSL---VVFGA 1326

Query: 399  GSYLVLH-GSLTIG----DLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT-- 451
            G +++L+  +L  G     LT  + +TE    +   L  FY+++     +  RL E    
Sbjct: 1327 GVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEI 1382

Query: 452  DYVP-----EIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
            D  P     E    L     P  G+IE  N+S  Y P  P+  + KN+ F +EP   V +
Sbjct: 1383 DQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLPK--VIKNVTFVVEPNCKVGV 1440

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
            VG +G GKSTI   L  + +  +G I ID  DIT +N   LRR + I+ Q+P L SG+IR
Sbjct: 1441 VGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIR 1500

Query: 566  DNITYGLTYTP-TKEEIRKVAKQCFCHN------------------FITKFPHTYDTQIG 606
             N+     Y   + + I K  ++    N                   + KF +    +I 
Sbjct: 1501 SNLD---PYNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNL-KNEIT 1556

Query: 607  PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIV 666
              G  LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + K  TI+
Sbjct: 1557 EGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTIL 1614

Query: 667  SIAHRLSTIRRSENVIVLGNDGSVIE 692
            +IAHRL ++   + ++V+ + G V E
Sbjct: 1615 TIAHRLRSVCDYDKILVM-DAGEVKE 1639

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 112/466 (24%), Positives = 209/466 (44%), Gaps = 46/466 (9%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLG----VLIIP 306
           G +I+ +  DA+ VS  I   +    ++L+   V + ++  L L  +A++G    V  +P
Sbjct: 513 GAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHL-LGYAALVGGALVVAFLP 570

Query: 307 VVIS-ASIFG----KQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQ---REIKR 358
           + +  A++ G    K + +  + +Q           E    ++ ++ F  E    R+I+ 
Sbjct: 571 LNLKLATLLGEYQKKSLAVTDKRIQKLN--------ETFQAIRIIKYFSWEDNFTRDIET 622

Query: 359 FNEAIRNIFHVGKRS---AFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415
             E  + +  + KRS   AF +  +F + S+V   SF        Y+ + G  T+    A
Sbjct: 623 VRE--KELHLLFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGE-TLTTPVA 673

Query: 416 FMLYTEYT--GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIE 473
           F   + +T     +  LS   S ++Q   +  R+ +L     E       T       I 
Sbjct: 674 FTALSLFTLLKTPLDQLSNMISFVIQSKVSLDRIQDLLQE-KETEKYSQLTIDKNGNRIA 732

Query: 474 FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
           F+N + ++  +      ++LN   +PG    ++GP+G GKS++ L LL   +  +G I++
Sbjct: 733 FQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIV 792

Query: 534 ---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
              D +D   ++   +   +    Q   L++ ++R+NI +   Y   +     V + C  
Sbjct: 793 PSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEAR--YNAVVEACCL 850

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
                       T+IG  G  LSGGQKQR+++ARAL      ++LD+  SA+D  +   I
Sbjct: 851 KRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWI 910

Query: 651 --NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
             N   G LM+ ++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 911 YDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 214/507 (42%), Gaps = 62/507 (12%)

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLS 293
            +KR IH    F D    G +++R   D   +   + + +     S     VGV +MC + 
Sbjct: 973  LKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTV-SQFANIVGVCVMCIVY 1031

Query: 294  LDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVS-----------EEQLNG 342
            L   A+     +P ++   +F +         Q A  ++ R+             E L G
Sbjct: 1032 LPWFAI----AVPFLVFIFVFIQN------HYQSAGREIKRLEAIQRSFVYNNFNEILGG 1081

Query: 343  VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYL 402
            + T++ + +E+R I + +  I  +   G  +  +         ++     L + +     
Sbjct: 1082 MDTIKFYKSEERYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLCVTR 1141

Query: 403  VLHGSLT-IGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL--------FELTDY 453
              H S + +G L  ++L      N++       S++     +  RL         E   +
Sbjct: 1142 QFHISASSVGVLLTYVLQLPGLFNTLLRA---VSQVENDMNSTERLVSYATDLPLEAQYH 1198

Query: 454  VPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKG 512
             PE  P       P +G I+F+NV F+Y P  P   + KN+N +I     + I G +G G
Sbjct: 1199 KPETAPPES---WPEEGTIKFENVDFAYRPGLPI--VLKNINLQINGTEKIGICGRTGAG 1253

Query: 513  KSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN----- 567
            KSTI   L      TSG ILID  DI K+    LR+KL I+ Q+PVL  G IR N     
Sbjct: 1254 KSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFH 1313

Query: 568  ----------ITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGTLLSGG 615
                      +  G    P  E++ +   Q    +  +   H +  D  +   G   S G
Sbjct: 1314 ERTDEELWDVLVRGGAIAP--EDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLG 1371

Query: 616  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI 675
            ++Q +A+ RAL++   ILILDEATS++D E++  I             TI+ IAHRL TI
Sbjct: 1372 ERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTI 1429

Query: 676  RRSENVIVLGNDGSVIEMGKFKELFSD 702
               + ++VL + G V E      LF D
Sbjct: 1430 LNYDRILVLEH-GEVAEFDTPMNLFKD 1455

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 111/206 (53%), Gaps = 20/206 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F NLNF+I+ G  V I GP G GK+++      +   TSG I I+G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  Y   K   ++V + C   + +   P    T+IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFGSPYEEDK--YKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR + K+ +I +LD+  SA+D    +  ++    +L+  K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMG 694
            H+LS I ++  +IVLGNDGSV E+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGSV-EIG 798

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  132 bits (333), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 138/503 (27%), Positives = 229/503 (45%), Gaps = 77/503 (15%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            +L  + ++R +H    F D    G +++R   D   +   +T+ +           +GV 
Sbjct: 951  KLNLSAVRRILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVRLMLAQF-ANIIGVC 1009

Query: 288  MMCSLSLDLSAVL--GVLIIPVVISASI--FGKQI-RINSRELQDATGQLTRVSEEQLNG 342
            +MC + L   A+    +L+I V++S      G++I R+ + +       L  V    L G
Sbjct: 1010 VMCIIYLPWFAIAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEV----LGG 1065

Query: 343  VKTVQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAF-----------------INA 378
            + T++ + +E+R        I + NEA   +  V +  A                  +  
Sbjct: 1066 MDTIRFYNSEERFMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTR 1125

Query: 379  KFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIM 438
            +F  S S VG      +L Y    VL     +  +   +  TE   NS+  L ++ +E+ 
Sbjct: 1126 QFHISASSVG-----VLLTY----VLQLPGLLNTVLRALTQTENDMNSVERLVSYATELP 1176

Query: 439  QGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKI 497
              A             PE  P       P +G+I+F+ VSF+Y P  P   + KNL+  I
Sbjct: 1177 TEAAYRK---------PESSP---DPSWPQEGKIDFEEVSFAYRPGLPA--VLKNLSMSI 1222

Query: 498  EPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEP 557
              G  + I G +G GKSTI   L       SG+I+IDG +I+ +    LRR L I+ Q+P
Sbjct: 1223 NGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDP 1282

Query: 558  VLMSGSIRDNIT-YGLTY------------TPTKEEIRKVAKQCFCHNFITKFPHTY--D 602
            VL  G+IR N+  +G               +  KE + +V  Q    N   +  H +  D
Sbjct: 1283 VLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLD 1342

Query: 603  TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKS 662
             ++   G+  S G++Q +A+ARAL++   +LILDEATS++D E++  I     ++++  S
Sbjct: 1343 QEVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFS 1399

Query: 663  -MTIVSIAHRLSTIRRSENVIVL 684
              TI+ IAHRL TI   + ++VL
Sbjct: 1400 ECTILCIAHRLKTILNYDRILVL 1422

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 105/211 (49%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FK++N +I  G  + I GP G GK+++   +      T G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  +  +K  +  V K C     +   P    T+IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI-NYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR + K  +I + D+  SA+D      I +     L+  K+  + + 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLAT- 766

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+LS +  +  VIVLGNDGSV ++G  +EL
Sbjct: 767 -HQLSLVENASRVIVLGNDGSV-DIGTVEEL 795

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 132/545 (24%), Positives = 245/545 (44%), Gaps = 52/545 (9%)

Query: 193  IYEFLGGFSI-ALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G +S+  + +    N          S R   +L   + K  I     F++    G
Sbjct: 1017 VWMFVGVYSLLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVG 1076

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  S+    S  FKS++   V + ++   ++    V  + ++ + I  
Sbjct: 1077 RIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTI-VLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 312  SIFGKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAEQREI----KRFNEAI 363
              F     + SREL+     +   +  +  E LNG   + ++   +R I     +    I
Sbjct: 1136 QTF---YIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNI 1192

Query: 364  RNIFHVGKRSAFINAKFFT-STSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEY 422
              +F+    + +++ +  T   ++V   + L +    +       L+ G +   M Y+  
Sbjct: 1193 DLVFNFRSINRWLSVRLQTIGATIVLATALLALATINT----KNQLSSGMVGLLMAYSFE 1248

Query: 423  TGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTYLPGKGEIEFK 475
              +S+  +      I     +  R+ E  +  PE        RP       P +G IEFK
Sbjct: 1249 VTSSLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDEN---WPSEGRIEFK 1305

Query: 476  NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535
            N S  Y     + + K++N  I+P   + IVG +G GKST++L L     P+ G+I+ID 
Sbjct: 1306 NYSTKY-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDD 1364

Query: 536  QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595
             +I+++    LR  L I+ Q+     G++R N+     Y  +++E+++  +     + + 
Sbjct: 1365 VNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLE 1422

Query: 596  KF------------------PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDE 637
            K                       D +I  +G+ LS GQ+Q + +ARAL+    IL+LDE
Sbjct: 1423 KMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDE 1482

Query: 638  ATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
            AT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL + G+V E     
Sbjct: 1483 ATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPS 1539

Query: 698  ELFSD 702
            +L SD
Sbjct: 1540 KLLSD 1544

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 94/397 (23%), Positives = 179/397 (45%), Gaps = 54/397 (13%)

Query: 338 EQLNGVKTVQSFVAEQREIKRFNEA-----IRNIFHVGKRSAFINAKFFTSTSLVGDLSF 392
           E LN +K+++ +  E+  +K+ N       ++N   +G  S  I   +     +V   +F
Sbjct: 477 ELLNAIKSIKLYAWEEPMMKKLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTF 536

Query: 393 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL--FEL 450
               ++     L  S+    L+ F +      ++I+ + +  + I++ + +  RL  F L
Sbjct: 537 GLFSLFND-TPLSPSIVFPSLSLFNI----LNSAIYSVPSMINSIIETSVSMERLKSFLL 591

Query: 451 TDYVPEIRPTLGKTYLPGKGE----IEFKNVSFSYPTRP--------------------Q 486
           +D V +    + +T  P        +E  N++F + ++                      
Sbjct: 592 SDEVDD--SFIERTNSPSSDSALPVLEMNNITFLWKSKEALASSQLENNSRTDEESIMGS 649

Query: 487 NQI-FKNL-NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSK 544
           +QI  KN+ +F+ + G  +C+VG  G GKST    +L       GQ+         +  K
Sbjct: 650 SQIALKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPK 702

Query: 545 SLRR--KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYD 602
            + R   L    QE  +M+ S+R+NI +G  +     ++    K C     +   P   +
Sbjct: 703 LIIRASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDE 760

Query: 603 TQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKT 660
           T +G  G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I +   G+    
Sbjct: 761 TLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALL 820

Query: 661 KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
           K+ TI+   + +S ++ S+ +  L N G ++E G ++
Sbjct: 821 KNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYE 856

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  132 bits (332), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 137/549 (24%), Positives = 250/549 (45%), Gaps = 78/549 (14%)

Query: 188  MFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDI 247
            M+ L +Y  + GF+ ALL       G              ++ + ++ + +H   +F+D 
Sbjct: 1102 MYYLVLY-LIIGFAQALLGA-----GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDA 1155

Query: 248  HKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPV 307
              TG +++R   D   + + +T  I   F SLI         C  ++ L   +    + V
Sbjct: 1156 TPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLI--------ECLSTVILITFITPQFLSV 1207

Query: 308  VISASIF----GKQIRINSRELQD----ATGQLTRVSEEQLNGVKTVQSFVAE----QRE 355
             I  SI     G      SREL+     +   + +   E L GV T+++F  E    Q  
Sbjct: 1208 AIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQEN 1267

Query: 356  IKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGD--- 412
            + + +E  +  F++   + ++  +      ++G L     +++G+ L +  ++   D   
Sbjct: 1268 LHKIDENNKPFFYLWVANRWLAFRI----DMIGSL-----VIFGAGLFILFNINNLDSGM 1318

Query: 413  ----LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE---IRPTLGKTY 465
                LT  + +TE        L   YSE+     +  R+ E  +   E       +    
Sbjct: 1319 AGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQ 1374

Query: 466  LPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
             P  G+IE  ++S  Y P  P+  + KN++F ++  S + IVG +G GKSTI   L  + 
Sbjct: 1375 WPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFL 1432

Query: 525  NPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK--EEIR 582
             P +G I ID  DI+ ++ + LRR + I+ Q+P L SG+I+ N+     ++  +  E ++
Sbjct: 1433 EPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALK 1492

Query: 583  KV-------------------AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIA 623
            +V                   A      N + KF     ++I   G+ LS GQ+Q + +A
Sbjct: 1493 RVNLISEEQLQQGATRETSNEASSTNSEN-VNKFLDL-SSEISEGGSNLSQGQRQLMCLA 1550

Query: 624  RALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIV 683
            R+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL ++   + ++V
Sbjct: 1551 RSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTILTIAHRLRSVIDYDKILV 1608

Query: 684  LGNDGSVIE 692
            + + G V E
Sbjct: 1609 M-DAGEVKE 1616

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 108/478 (22%), Positives = 216/478 (45%), Gaps = 38/478 (7%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           +++I+ D +       G +I+ +  DA+ VS  I   +    ++ +   V + ++  L L
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRL-L 517

Query: 295 DLSAVLGVLIIPVVISASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
             +A++GVLII  ++  +    K I  +  + L     ++ +++E     ++ ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 353 QREIKRFNEAIRNIFH-------VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 405
           +   K  N    N          V   S+F+   +F + ++V   SF        Y+ + 
Sbjct: 577 ENFEKDINTIRENELSLLLMRSIVWSISSFL---WFVTPTIVTAASF------AYYIYVQ 627

Query: 406 GSL--TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE--IRPTL 461
           G +  T    TA  L+T    + +  LS   S ++Q   +  R+    D++ E   +   
Sbjct: 628 GEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRV---QDFLNENDTKKYD 683

Query: 462 GKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL 521
             T  P      F+N + S+    Q+   K+LN + + G    ++GP+G GK+++ + LL
Sbjct: 684 QLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALL 743

Query: 522 HYYNPTSGQILIDGQDITK---MNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK 578
                 +G++++   +  +   +++      +    Q   L++ ++++NI +   +   +
Sbjct: 744 GEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEAR 803

Query: 579 EEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEA 638
              + V + C              T+IG  G  LSGGQKQR+++ARAL      ++LD+ 
Sbjct: 804 --YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDC 861

Query: 639 TSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
            SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 862 LSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 123/471 (26%), Positives = 210/471 (44%), Gaps = 23/471 (4%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D + V   + +  +  F + I     + ++C  +     V    
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIKVSFTIIVICFSTWQFILV---- 1081

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            I+P+      + +     SREL+     +TR       +E L G+ T++ +  ++R +  
Sbjct: 1082 ILPMGTLYIYYQQYYLRTSRELR-RLDSVTRSPIYAHFQETLGGISTIRGYNQQKRFVHI 1140

Query: 359  FNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFML 418
                + N       S   N         +G +  L         +  G+LT G +   + 
Sbjct: 1141 NQARVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVLRLKQGALTPGMIGLSVS 1200

Query: 419  YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE----IRPTLGKTYLPGKGEIEF 474
            Y      S+  +     E+     +  R+ E  +   E    I         P +G I+F
Sbjct: 1201 YALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPSEDWPSQGSIKF 1260

Query: 475  KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
            +N S  Y  RP+ ++  K++N  I+P   + IVG +G GKS++ L L       SG+I I
Sbjct: 1261 ENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIEAASGRIYI 1318

Query: 534  DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNF 593
            DG  I  +  + LR  L I+ Q+  L  G+IR+NI     Y  T E+I +  +     + 
Sbjct: 1319 DGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENIDPTNEY--TDEQIWRALELSHLKDH 1376

Query: 594  ITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
            +        D  +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  
Sbjct: 1377 VKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDQVIQE 1436

Query: 653  TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
            T     K +  TI++IAHR++TI  S+ ++VL + G V E      L  +P
Sbjct: 1437 TIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNP 1484

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 110/474 (23%), Positives = 215/474 (45%), Gaps = 55/474 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         Q+I D   +  +I  G    ++C +SL      S  +GV+
Sbjct: 392 TGDIVNLMSVD--------VQRIQDLTQWGQIIWSGPFQLILCLVSLYKLLGNSMWIGVI 443

Query: 304 IIPVVISAS--IFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFN- 360
           I+ + I A+  I   Q ++   +++   G+ TR+  E LN +K+++ +  E+   K+ + 
Sbjct: 444 IMVITIPANSLIMRYQKKLQKVQMKYKDGR-TRLISEILNNIKSLKLYAWEEPYRKKLDY 502

Query: 361 ----EAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416
               + ++N+  +G  +A  + +F     LV   +F  V ++     L   L    LT F
Sbjct: 503 VRNEKELKNLRRMGITNACASFQFNVIPFLVSCSTF-GVFIWTQDAPLTTDLVFPALTLF 561

Query: 417 MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYV--PEIR--PTLGKTYLPGKGEI 472
            L         F L+   + I     A+  +  L  ++   E++      K+ +  KGE+
Sbjct: 562 NLLA-------FPLAVIPTAITAFVEASVSITRLQSFLTNEELQRDSVQRKSKVTKKGEV 614

Query: 473 EFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTS 528
                 + +F +  +P+ ++  KN+NF  + G   C+VG  G GKS +   +L       
Sbjct: 615 AVNVGADATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------- 667

Query: 529 GQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC 588
                 G         S+   +  V Q P +M+G+++DNI +G  Y  +   +    K C
Sbjct: 668 ------GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKAC 719

Query: 589 FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SE 647
                +   P    T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   ++
Sbjct: 720 ALIVDLAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTK 779

Query: 648 GAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             + +  G      S T V   ++++ +  ++++ +L N G +I+ G + ++ S
Sbjct: 780 HLVEHVLGPNGLLASKTKVLATNKITVLSIADHIALLEN-GEIIQQGSYDDVTS 832

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 134/532 (25%), Positives = 238/532 (44%), Gaps = 35/532 (6%)

Query: 193  IYEFLGGFSIALLAGCMAN-FGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            +++F+  +++  L     N F         S R    L  ++ K  I    QF++    G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R  +D   V  ++    S  F+S++   + V ++ S+++    +   LI+ +    
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTV-ILVSVAMPWFLLFNALIMIIYF-- 1117

Query: 312  SIFGKQIRINSRELQDATG----QLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIF 367
              + K   + SREL+  T      +  +  E L G   + ++     ++ +F    R  +
Sbjct: 1118 -YYEKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAY--NHSKMFKFMNIERVQY 1174

Query: 368  HVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG--SYLVLHGSLTIGD--LTAFMLYTEYT 423
            ++     F +   + S  L    +F+ +L  G  +   L  S  IG   +   M Y    
Sbjct: 1175 NLNVLFTFRSTNRWLSIRLQSIGAFI-ILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQV 1233

Query: 424  GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYL----PGKGEIEFKNVSF 479
             +++  +     +I     +  R+ E     PE    +    +    P +G IEFKN + 
Sbjct: 1234 TSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTT 1293

Query: 480  SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
            +Y     + + KN++  I P   V IVG +G GKST++L L        G I IDG DI+
Sbjct: 1294 TYRAN-LSPVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDIS 1352

Query: 540  KMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPH 599
            ++    LR  + I+ Q+     G++R N+     +T    E+  V +       + +   
Sbjct: 1353 RIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV--ELWNVIELSHLKPHVLRMAE 1410

Query: 600  T---------YDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
                       D +I  +G+ LS GQ+Q + +ARAL+ +  +L+LDEAT+A+DVE++  I
Sbjct: 1411 DDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKII 1470

Query: 651  NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              T     K +  TI++IAHRL TI  ++ ++VL + G V E    K L SD
Sbjct: 1471 QETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNLLSD 1519

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 121/259 (46%), Gaps = 40/259 (15%)

Query: 465 YLPGKGEIEFKNVSFSYPTRPQ---------------NQI-FKNLN-FKIEPGSNVCIVG 507
           Y+P    +E +N +F + ++ Q                Q+  KN++ F   P S  C++G
Sbjct: 603 YIPA---VEIENATFLWKSQAQLINSENDDSEANIETTQVALKNIDHFTASPKSLTCVIG 659

Query: 508 PSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKMNSKSLR-RKLGIVQQEPVLMSGSIR 565
             G GK+T+   +L       GQ+  I G   +     S+R   +    QE  +M+ +I+
Sbjct: 660 KVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRGESIAYCPQEAWIMNDTIK 712

Query: 566 DNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARA 625
           +NI +G  +  T   +   A +      I   P    T +G  G  LSGGQK R+++ARA
Sbjct: 713 ENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGISLSGGQKARVSLARA 770

Query: 626 LIKKPNILILDEATSALDVE-----SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSEN 680
           +  + +I +LD+  SA+D        E  ++   G L   ++ T++   + +S ++ S+ 
Sbjct: 771 VYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSGLL---RNKTVILSTNTVSVLKHSQL 827

Query: 681 VIVLGNDGSVIEMGKFKEL 699
           +  L N G ++E G + ++
Sbjct: 828 IYALEN-GIIVERGNYNDI 845

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 141/266 (53%), Gaps = 27/266 (10%)

Query: 455 PEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
           PE RP       P +G IEFKN S  Y     + + K++N  I+P   + IVG +G GKS
Sbjct: 717 PEKRP---DENWPSEGRIEFKNYSTKY-RENLDPVLKDINVSIQPCEKIGIVGRTGAGKS 772

Query: 515 TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
           T++L L     P+ G+I+ID  +I+++    LR  L I+ Q+     G++R N+     Y
Sbjct: 773 TLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVRTNLDPFNRY 832

Query: 575 TPTKEEIRKVAKQCFCHNFITKF------------------PHTYDTQIGPSGTLLSGGQ 616
             +++E+++  +     + + K                       D +I  +G+ LS GQ
Sbjct: 833 --SEDELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKINENGSNLSVGQ 890

Query: 617 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIR 676
           +Q + +ARAL+    IL+LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+ 
Sbjct: 891 RQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVL 948

Query: 677 RSENVIVLGNDGSVIEMGKFKELFSD 702
            S+ +IVL + G+V E     +L SD
Sbjct: 949 DSDKIIVL-DKGNVKEFDSPSKLLSD 973

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 107/213 (50%), Gaps = 15/213 (7%)

Query: 490 FKNL-NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548
            KN+ +F+ + G  +C+VG  G GKST    +L       GQ+         +  K + R
Sbjct: 83  LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIR 135

Query: 549 --KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIG 606
              L    QE  +M+ S+R+NI +G  +     ++    K C     +   P   +T +G
Sbjct: 136 ASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVG 193

Query: 607 PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTF-GQLMKTKSMT 664
             G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I +   G+    K+ T
Sbjct: 194 EKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKT 253

Query: 665 IVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
           I+   + +S ++ S+ +  L N G ++E G ++
Sbjct: 254 IILTTNTVSILKHSQMIYALEN-GEIVEQGNYE 285

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  130 bits (327), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 126/508 (24%), Positives = 239/508 (47%), Gaps = 70/508 (13%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + ++ + +H   +F+D   TG +++R   D   + + +T  I   F SLI       
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLI------- 1188

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIF----GKQIRINSRELQD----ATGQLTRVSEEQ 339
              C  ++ L   +    + V I  SI     G      SREL+     +   + +   E 
Sbjct: 1189 -ECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSET 1247

Query: 340  LNGVKTVQSFVAE----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
            L GV T+++F  E    Q  +++ +E  +  F++   + ++  +      ++G L     
Sbjct: 1248 LVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRI----DMIGSL----- 1298

Query: 396  LVYGSYLVLHGSLTIGD-------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 448
            +++G+ L +  ++   D       LT  + +TE        L   Y+E+     +  R+ 
Sbjct: 1299 VIFGAGLFILFNINHLDSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVK 1354

Query: 449  ELTDYVPE---IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVC 504
            E  +   E       +     P  G+IE  ++S  Y P  P+  + KN++F ++  S + 
Sbjct: 1355 EYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDAQSKIG 1412

Query: 505  IVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSI 564
            IVG +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR + I+ Q+P L SG+I
Sbjct: 1413 IVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTI 1472

Query: 565  RDNITYGLTYTPTK--EEIRKV------------AKQCFCHNF------ITKFPHTYDTQ 604
            + N+     ++  K  E +++V             ++    N       + KF     ++
Sbjct: 1473 KTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLDL-SSE 1531

Query: 605  IGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMT 664
            +   G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  T
Sbjct: 1532 VSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRK--EFQGST 1589

Query: 665  IVSIAHRLSTIRRSENVIVLGNDGSVIE 692
            I++IAHRL ++   + ++V+ + G V E
Sbjct: 1590 ILTIAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 110/479 (22%), Positives = 217/479 (45%), Gaps = 40/479 (8%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           +++I+ D +       G +I+ +  DA+ VS  I   +    ++ +   V + ++  L L
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALVLLYRL-L 517

Query: 295 DLSAVLGVLIIPVVISASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
             +A++GVLII  ++  +    K I  +  + L     ++ +++E     ++ ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 353 QREIKRFNEAIRNIFH-------VGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 405
           +   K  N    N          V   S+F+   +F + ++V   SF        Y+ + 
Sbjct: 577 ENFEKDINAIRENELSLLLMRSIVWSISSFV---WFVTPTIVTAASF------AYYIYVQ 627

Query: 406 GSL--TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE--IRPTL 461
           G +  T    TA  L+T    + +  LS   S ++Q   +  R+    D++ E   +   
Sbjct: 628 GEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRV---QDFLNEKDTKKYD 683

Query: 462 GKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL 521
             T  P      F+N + S+    Q+   K+LN + + G    ++GP+G GK+++ + LL
Sbjct: 684 QLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALL 743

Query: 522 HYYNPTSGQILIDG----QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT 577
                 SG++++      Q++  +++      +    Q   L++ ++++NI +   +   
Sbjct: 744 GEMYLLSGKVVVPALEPRQELV-VDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEA 802

Query: 578 KEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDE 637
           +   + V + C              T+IG  G  LSGGQKQR+++ARAL      ++LD+
Sbjct: 803 R--YKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDD 860

Query: 638 ATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
             SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G
Sbjct: 861 CLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 127/507 (25%), Positives = 240/507 (47%), Gaps = 68/507 (13%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            ++ + ++ + +H   +F+D   TG +++R   D   + + +T  I   F SLI     V 
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI 1195

Query: 288  MMCSLS---LDLSAVLGVLIIPVVISASIFGKQIRINSRELQD----ATGQLTRVSEEQL 340
            ++  ++   L ++ V+ +L   V       G      SREL+     +   + +   E L
Sbjct: 1196 LITFITPQFLSIAIVVSILYYFV-------GYFYMAGSRELKRFESISRSPIYQHFSETL 1248

Query: 341  NGVKTVQSFVAE----QREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
             GV T+++F  E    Q  +++ +E  +  F++   + ++  +      ++G L     +
Sbjct: 1249 VGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRI----DMIGSL-----V 1299

Query: 397  VYGSYLVLHGSLTIGD-------LTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
            ++G+ L +  ++   D       LT  + +TE        L   YSE+     +  R+ E
Sbjct: 1300 IFGAGLFILFNIDHIDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKE 1355

Query: 450  LTDYVPE---IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
                  E       +  +  P  G+IE  ++S  Y P  P+  +  N++F ++  S + I
Sbjct: 1356 YMKIEQEPYNQHKEVPPSQWPQDGKIEVNDLSLRYAPNLPR--VINNVSFSVDAQSKIGI 1413

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
            VG +G GKSTI   L  +  P +G I ID  DI+ ++ + LRR + I+ Q+P L SG+I+
Sbjct: 1414 VGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIK 1473

Query: 566  DNITYGLTYTPTK--EEIRKV---------------AKQCFCHNF---ITKFPHTYDTQI 605
             N+     ++  K  E +++V               A      N    I KF     +++
Sbjct: 1474 TNLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLDL-SSEV 1532

Query: 606  GPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTI 665
               G+ LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI
Sbjct: 1533 SEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK--EFQGSTI 1590

Query: 666  VSIAHRLSTIRRSENVIVLGNDGSVIE 692
            ++IAHRL ++   + ++V+ + G V E
Sbjct: 1591 LTIAHRLRSVIDYDKILVM-DAGEVKE 1616

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 112/481 (23%), Positives = 222/481 (46%), Gaps = 44/481 (9%)

Query: 235 KRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSL 294
           +++I+ D +       G +I+ +  DA+ VS  I   +    ++ +   V + ++  L L
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYHL-L 517

Query: 295 DLSAVLGVLIIPVVISASI-FGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
             +A++GVLII  ++  +    K I  +  + L     ++ +++E     ++ ++ F  E
Sbjct: 518 GFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNE-AFQAIRIIKYFSWE 576

Query: 353 Q---REIK--RFNEA----IRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
           +   +EI   R NE     +R+I  +   S+F+   +F + ++V   SF        Y+ 
Sbjct: 577 ENFEKEINTIRENELSLLLMRSI--IWSISSFV---WFVTPTIVTAASF------AYYIY 625

Query: 404 LHGSL--TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE--IRP 459
           + G +  T    TA  L+T    + +  LS   S ++Q   +  R+    D++ E   + 
Sbjct: 626 VQGEVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRV---QDFLNEKDTKK 681

Query: 460 TLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALL 519
               T  P       +N + S+    Q+   K+LN + + G    ++GP+G GK+++ + 
Sbjct: 682 YDQLTIDPNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMA 741

Query: 520 LLHYYNPTSGQILIDG----QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYT 575
           LL      +G+I++      Q++  +++      +    Q   L++ +I+ NI +   + 
Sbjct: 742 LLGEMYLLNGKIVVPALEPRQELV-VDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFN 800

Query: 576 PTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILIL 635
             +   + V + C              T+IG  G  LSGGQKQR+++ARAL      ++L
Sbjct: 801 EAR--YKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLL 858

Query: 636 DEATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
           D+  SA+D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG + + 
Sbjct: 859 DDCLSAVDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQ 916

Query: 694 G 694
           G
Sbjct: 917 G 917

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 126/468 (26%), Positives = 219/468 (46%), Gaps = 37/468 (7%)

Query: 244  FYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVL 303
            F++    G +++R   D Y V   + +  S  F + +     +G++   +     V    
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGVIAYTTWQFVFV---- 1117

Query: 304  IIPVVISASIFGKQIRINSRELQDATGQLTRVS-----EEQLNGVKTVQSFVAEQREIKR 358
            I+P+ I    + +     SREL+     +TR       +E L G+ T++ +  +Q+  + 
Sbjct: 1118 IVPLGIFYIYYQQYYLRTSRELRRLES-VTRSPIFSHFQETLGGLATIRGY-GQQKRFEH 1175

Query: 359  FNEAIRNIFHVGKRSAF---INAKFFTSTSL--VGDLSFLTVLVYGSYLVLHGSLTIGDL 413
             NE   +       SAF   INA  + +  L  +G +  L       + +  G++T G +
Sbjct: 1176 INECRVD----NNMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRAGTMTAGMI 1231

Query: 414  TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE----IRPTLGKTYLPGK 469
               + Y      ++  +     E+     +  R+ E ++   E    I         P  
Sbjct: 1232 GLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWPVA 1291

Query: 470  GEIEFKNVSFSYPTRPQ---NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP 526
            GEI+F++    Y TR +   + + K++N +I+P   + IVG +G GKS++ L L      
Sbjct: 1292 GEIKFEH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEA 1347

Query: 527  TSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAK 586
            TSG ILIDG  I ++    LR  L I+ Q+  +  G+IR+NI    T   T  +I +  +
Sbjct: 1348 TSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENI--DPTNQFTDADIWRALE 1405

Query: 587  QCFCHNFITKF-PHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 645
                   I +       T +   G+ LS GQ+Q + +ARAL+    +L+LDEAT+A+DVE
Sbjct: 1406 LSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVE 1465

Query: 646  SEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            ++  I  T     K +  TI++IAHR++TI  ++ +IVL + G V+E 
Sbjct: 1466 TDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEF 1510

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 127/520 (24%), Positives = 223/520 (42%), Gaps = 51/520 (9%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         QK+ D   +  LI  G    ++C +SL      S  +GVL
Sbjct: 421 TGDIVNLMSVDV--------QKLQDLTQWIHLIWSGPLQIVLCLISLYKLLGHSMWVGVL 472

Query: 304 IIPVVISASIFGKQIRINSRELQ-DATGQLTRVSEEQLNGVKTVQSFVAEQ-----REIK 357
           I+ ++I  + F  +I+ N ++ Q     + TRV  E LN +K+++ +  EQ      E  
Sbjct: 473 ILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEILNNMKSLKLYAWEQPYKEKLEYV 532

Query: 358 RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 417
           R  + ++N+  +G   A  + +F     LV   +F  V VY     L   L    LT F 
Sbjct: 533 RNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-AVFVYTEDKALTTDLVFPALTLFN 591

Query: 418 LYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEF--- 474
           L +      +  +    + I++ + + SRLF         +  + +  LP   EI     
Sbjct: 592 LLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEELQKDAVQR--LPKVKEIGDVAV 645

Query: 475 ---KNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQ 530
               N +F +  +P+ ++  KN+N++ + G   CIVG  G GKS     LL       G 
Sbjct: 646 NVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGF 705

Query: 531 ILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
             I G              +  V Q   +M+G++RDN+ +G  Y P  E   K  K C  
Sbjct: 706 ATIHGS-------------VAYVSQVAWIMNGTVRDNVLFGHKYDP--EFYEKTIKACAL 750

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGA 649
              +        T +G  G  LSGGQK R+++ARA+  + +  +LD+  +A+D   S   
Sbjct: 751 TIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHL 810

Query: 650 INYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXX 709
           + +  G      S T +   +++S +  ++++ +L N G + + G + +   D       
Sbjct: 811 VEHVLGPNGLLHSKTRILATNKISVLSAADSITLLEN-GEITQQGTYADCRKDEESALGK 869

Query: 710 XXXXXXXXXXTKSDPISSAPEVDADATGEPVEPIDPAIED 749
                        D I+S+    + +  EP  P++  +E+
Sbjct: 870 LLKEFGRKESKNDDTITSSSSAVSISDKEPTVPLEDELEE 909

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 162/335 (48%), Gaps = 28/335 (8%)

Query: 388  GDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL 447
            G +  +T L+  + +     +T G +   M Y     NS+  +    + I     +  R+
Sbjct: 1222 GAMVLITALLTLATIGTKKQMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERI 1281

Query: 448  FELTDYVPEIRPTLGKTYLPGK-----GEIEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGS 501
            +E    +P   P + ++  P K     GEI FK+ S  Y  RP+ + + K +N  I+P  
Sbjct: 1282 YEYCQ-LPSEAPAIIESSRPEKSWPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPRE 1338

Query: 502  NVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMS 561
             + +VG +G GKS+++L L      T G I IDG DI+K+    LR  L I+ Q+     
Sbjct: 1339 KIGVVGRTGAGKSSLSLALFRLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFE 1398

Query: 562  GSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKF----------PH----TYDTQIGP 607
            G++R N+     Y+   +EI K  +       I K           P       D +I  
Sbjct: 1399 GTVRSNLDPFNQYSV--QEIWKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISE 1456

Query: 608  SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVS 667
            +G  +S GQ+Q + ++RAL+ K  +L+LDEAT+A+D+E++  I  T     + K  TI++
Sbjct: 1457 NGNNMSMGQRQLLCLSRALLSKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILT 1514

Query: 668  IAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            IAHR+ T+  S+ ++VL + G V E      L  D
Sbjct: 1515 IAHRIDTVLDSDKILVL-DKGEVKEFESPDTLLKD 1548

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 108/213 (50%), Gaps = 16/213 (7%)

Query: 494 NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDITKMNSKSLRRKLGI 552
           +F+ + G+  C+VG  G GKST+   +L      SG +  I  + + +       R +  
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILVRA------RSVAY 714

Query: 553 VQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLL 612
             Q P +M+ SI+DNI +G  Y  T   +    K C     +       +T +G  G  L
Sbjct: 715 CPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISL 772

Query: 613 SGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSMTIVSI 668
           SGGQK R+++ARA+  + ++ ++D+  SA+D E S+  I+   G+   L+K K  TI+  
Sbjct: 773 SGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILT 830

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            + +S ++ S N+I     G ++E G +++  S
Sbjct: 831 TNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVS 862

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 138/562 (24%), Positives = 249/562 (44%), Gaps = 65/562 (11%)

Query: 164  IILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSE 223
            + + SL  + A  S+G +       + L IY  +G  + +L A  + N          S 
Sbjct: 1055 LFVKSLMTEHAVNSDGSKG----TFYYLAIYVLIGLTTASLSA--LKNIISVMAGLYASR 1108

Query: 224  RLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGG 283
            ++     + V+ + +H   +F+D   TG +++RL  D   V + +       F +++   
Sbjct: 1109 KIF----NLVLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVV--- 1161

Query: 284  VGVGMMCSLSLDLSAVL--GVLIIPVVIS--ASIFGKQIRINSRELQDATGQLTRVS--- 336
                  C  +L L A +    LI+ + I    ++ G      SREL+     +TR     
Sbjct: 1162 -----QCISTLVLIAYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKRFE-SITRSPIYQ 1215

Query: 337  --EEQLNGVKTVQSFVAEQR----EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL 390
               E L G+ +++++  E+R     + R ++  R  F++   + ++  +       V  L
Sbjct: 1216 HFSETLVGITSIRAYGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFR-------VDLL 1268

Query: 391  SFLTVLVYGSYLVLH-GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 449
              L     G ++ L+ G L  G     + Y  +           YS +     +  RL E
Sbjct: 1269 GALVTFFSGLFIYLNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKE 1328

Query: 450  LTDYVPE---IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCI 505
              +   E       L     P  G I+  ++S  Y P  P+  + KN+NF +EP   V I
Sbjct: 1329 YMEIEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLPK--VIKNVNFSVEPKLKVGI 1386

Query: 506  VGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIR 565
            VG +G GKSTI   +  + +P +G + ID  DIT +    LR+ + I+ Q+P L +G+++
Sbjct: 1387 VGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLK 1446

Query: 566  DNITYGLTYTPTK--EEIRKV-------------AKQCFCHNFITKFPHTYDTQIGPSGT 610
              +     Y+  +  E +++V                      I KF    + ++   G 
Sbjct: 1447 SILDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLDL-NNEVTEGGA 1505

Query: 611  LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
             LS GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + +  TI++IAH
Sbjct: 1506 NLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAH 1563

Query: 671  RLSTIRRSENVIVLGNDGSVIE 692
            RL +I   + V+V+ + G V E
Sbjct: 1564 RLKSIIDYDKVLVM-DAGEVKE 1584

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 110/467 (23%), Positives = 200/467 (42%), Gaps = 48/467 (10%)

Query: 251 GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
           G++I+ +  DA+ VS  I+  +     S +   V +  +  L L  SA++GV ++  ++ 
Sbjct: 456 GEIINLMAVDAFKVSE-ISSYLYFFIGSFVMVVVSMIFLYRL-LGWSALVGVALLVAMLP 513

Query: 311 ASIFGKQIRINSRELQDATGQLTRVS-----------EEQLNGVKTVQSFVAE---QREI 356
            +           +L    G LT V+            E L  ++ ++ F  E   ++E+
Sbjct: 514 LNY----------KLAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIKFFAWETNFEKEV 563

Query: 357 KRFNE-AIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGS-LTIG-DL 413
           +   E  +  +       + I+  +F  +++V   SF        Y+ + G  LTI    
Sbjct: 564 QAIREDELATLLKRAIVWSAISFLWFMVSTIVVSASF------ACYIYIQGEVLTIPVAF 617

Query: 414 TAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIE 473
           TA  L+     N +  L+   S ++Q   +  R+    D   E   T  +        + 
Sbjct: 618 TALSLFVMLR-NPLDVLADMLSYVVQSKVSLDRIQAFLD---EDETTKYEQLTISGNRLA 673

Query: 474 FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
           F+N + ++   P +   +N++ +   G      GP+G GKS++ L LL       G+I +
Sbjct: 674 FENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYV 733

Query: 534 ---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
              D ++   + +  L   +    Q   L++ + R NI +   Y   ++    V + C  
Sbjct: 734 PSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN--EQRYNDVLEACGL 791

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
                       TQIG  G  LSGGQKQRI++ARAL      L+LD+  SA+D  +   I
Sbjct: 792 KKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLI 851

Query: 651 --NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGK 695
             N   G LM+ ++  +VS  H ++   R+ + +V+  +G V   G+
Sbjct: 852 YENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQGE 896

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 136/557 (24%), Positives = 236/557 (42%), Gaps = 72/557 (12%)

Query: 191  LTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKT 250
            +TIY  +G     LL+    N          S R   +L   +    +     F++    
Sbjct: 1024 VTIYAIIG-----LLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 251  GDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVIS 310
            G +++R  +D   +   +    S  F+S++   V + ++   +L     L  ++I +   
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSL-ILVGYNLPWFIALNAVLIMIYFY 1137

Query: 311  ASIFGKQIRINSRELQDAT----GQLTRVSEEQLNGVKTVQSFVAEQR------EIKRFN 360
               +   +   SREL+  T      +  +  E L G   + +F    R      E  ++N
Sbjct: 1138 YQAYYIML---SRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFETVQYN 1194

Query: 361  EAIRNIFHVGKRSAFINAKFFTSTSLV----GDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416
              I  +F     + +++ +  T  +L+    G LSF T       L     L+ G +   
Sbjct: 1195 --IDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFAT-------LGTKKQLSSGMVGLL 1245

Query: 417  MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RPTLGKTYLPGK 469
            M Y+    +S+  +     +I     +  R  E  +  PE        RP  G    P +
Sbjct: 1246 MSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEG---WPRE 1302

Query: 470  GEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG 529
            G IEF N +  Y     + + K++N  I+P   + IVG +G GKST+ L L      T G
Sbjct: 1303 GAIEFNNYTTKY-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGG 1361

Query: 530  QILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF 589
             I IDG DI+K+  + LR  L I+ Q+     G+IR N+     +  + EE+ +  +   
Sbjct: 1362 SISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQH--SDEELWRAVELSH 1419

Query: 590  CHNFITKF------------------PHTYD------TQIGPSGTLLSGGQKQRIAIARA 625
                I +                   P +++      T I  +G+ +S GQ+Q + ++RA
Sbjct: 1420 LKQHILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRA 1479

Query: 626  LIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLG 685
            L+    +LILDEAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + ++VL 
Sbjct: 1480 LLNPSKVLILDEATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL- 1536

Query: 686  NDGSVIEMGKFKELFSD 702
            + G V E      L SD
Sbjct: 1537 DKGEVAEFDTVSNLLSD 1553

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 112/511 (21%), Positives = 234/511 (45%), Gaps = 62/511 (12%)

Query: 229 LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
           L + V K+++   +     H +GD+I+ +  D   +     Q+  +  +S+I   + + +
Sbjct: 366 LMALVYKKSLRISSDARQKHSSGDIINLMSTDVLNL-----QRFFENSQSIIGAPIQIVI 420

Query: 289 MC---SLSLDLSAVLGV--LIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343
           +     L LD +   G+  ++I + I+A +  K   +   +++    +LT ++E  LN +
Sbjct: 421 VLISLYLLLDKAVFAGMISMVIMIPINAYLSRKVGSLYKTQMKYKDSRLTILTE-ILNSI 479

Query: 344 KTVQSFVAEQREIKRFNEAIRN---IFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYG- 399
           K+++ +  E+  +K+    +RN   + +  K   F N  FF    +   ++  T L++  
Sbjct: 480 KSIKLYSWEKPMLKKLLH-VRNDLELENFKKIGIFSNLIFFAWNCVPLMVTCSTFLIFSM 538

Query: 400 -SYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIR 458
            S + L   +    LT F +      ++I+ + +  ++++Q   +  RL +      E+ 
Sbjct: 539 ISDVPLSPDIIFPSLTLFNI----LNDAIYVVPSTINDVIQANISMKRLRDFL-LAEELD 593

Query: 459 PTLGKTYLPGKGE----IEFKNVSFSYPTRP----------------QNQIFKNL-NFKI 497
            +  +   P + +    IE  N +F + ++                      KN+ NF +
Sbjct: 594 DSFIEYKSPSETDDAPVIEINNATFLWQSKKIINENSSTDEESNIETSKAALKNIDNFTV 653

Query: 498 EPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKMNSKSLRR-KLGIVQQ 555
           + GS  CIVG  G GKSTI   +L       GQ+  I   D T+    ++R   +    Q
Sbjct: 654 KKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIAYCPQ 706

Query: 556 EPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGG 615
           E  +M+ S+++NI +G  +      +  V + C   + ++  P   +T +G  G  L GG
Sbjct: 707 EAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGISLVGG 764

Query: 616 -QKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSMTIVSIAH 670
            QK RI++ARA+  + ++ +LD+  SA+D   S+  I Y   +   L++ K  TI+   +
Sbjct: 765 VQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILSTN 822

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
            ++ ++ S+ +  +   G ++E   ++ + +
Sbjct: 823 NVNVLKNSQKIYAI-EKGEIVEESDYENVMN 852

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  124 bits (311), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 151/561 (26%), Positives = 244/561 (43%), Gaps = 88/561 (15%)

Query: 189  FGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIH 248
            F + +Y F    SI  L G  +           S  L A      + R IH    F +  
Sbjct: 839  FYMGMYSFFVFGSIVFLTGQFSLLCYIGLRASKSLNLQA------VNRVIHSPMWFMEST 892

Query: 249  KTGDLISRLGADAYIVSRSITQKISDGFKSLI---CGGVGVGMMCSLSLDLSAV----LG 301
              G +++R   D    + S+  +I D  + ++   C  VG+ ++C + L   A+    LG
Sbjct: 893  PMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLG 948

Query: 302  VLIIPVVISASIFGKQI-RINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQR------ 354
            +++           ++I R+ + +       L  V    L GV T++++ AE+R      
Sbjct: 949  LILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDV----LGGVDTIRAYGAEERFSYKLD 1004

Query: 355  -EIKRFNEAIRNIFHVGKR--SAFINAKFFTSTSLVGDLSFLTVL--------VYGSYLV 403
              I + NEA   ++   +R  +  IN    + T +V  L    V         V  SY++
Sbjct: 1005 YLIDKTNEA-SYLYTAVQRWINIVINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVL 1063

Query: 404  LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK 463
            L   L    LT  +  TE   NS+  L T+ +E+ Q A            VP       K
Sbjct: 1064 LIPDLLNNTLT-MVTQTENDMNSVERLVTYATELPQEASHGEE-------VP------SK 1109

Query: 464  TYLPGKGEIEFKNVSFSYPT-RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
            T+ P  GEI+F+NV +++    P   +      KI  G  V I G +G GKST+   L  
Sbjct: 1110 TW-PENGEIKFENVRYTHRDGLPA--VLDKFTLKIAAGERVGICGRTGAGKSTVLGALYR 1166

Query: 523  YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR 582
                 SG+++ID  D++K+N  +LR +L I+ Q+PVL  GS+R N+       P  E   
Sbjct: 1167 LREVESGRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNL------DPFGEYDD 1220

Query: 583  KVAKQCFCHNFITKFPHT---------------------YDTQIGPSGTLLSGGQKQRIA 621
             V K       + KF  T                      D  +  +G   S G++Q +A
Sbjct: 1221 DVLKNALMRCTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLA 1280

Query: 622  IARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENV 681
            +ARALI+  +IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + +
Sbjct: 1281 LARALIRNSSILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRI 1338

Query: 682  IVLGNDGSVIEMGKFKELFSD 702
            +VL N G +I +   K L  +
Sbjct: 1339 LVLEN-GKIIGLDTPKSLLDN 1358

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 115/449 (25%), Positives = 208/449 (46%), Gaps = 67/449 (14%)

Query: 280 ICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFG--KQIRINSRELQDATGQLTRVSE 337
           IC G+ +  +  +++   + +G+  + +++   +FG   ++R+N  ++ D   Q   +  
Sbjct: 314 ICLGLLIKNLGGIAM---SGVGLFFVTIIVVIFLFGIVMKMRLNINQVTD---QRVSILR 367

Query: 338 EQLNGVKTVQSFVAEQ---REIKRFNEAIRNI--FHVGKRSAFINAKFFTSTSLVGDLSF 392
           E LN +K V+ +  EQ   + IK+    IR++    + +     N  F  + SL    S 
Sbjct: 368 EVLNNIKMVKLYCWEQAYEKSIKK----IRSLETSKLTRMEILKNVIFSVTFSLPNICSL 423

Query: 393 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAG-----AASRL 447
           +T L   +   +HG L      A  +++  +   I  L +FY  +  G       +  R 
Sbjct: 424 MTFL---ALFKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRF 476

Query: 448 FELTDYVPE-----IRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQI-------FKNLNF 495
            E  +         IR T  + Y      I+  + SF + T  ++         F +LNF
Sbjct: 477 QEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNF 536

Query: 496 KIEPGSNVCIVGPSGKGKST----IALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLG 551
           +I  G  + IVGP G GK++    I  L+  Y N   G++ +DG  ++            
Sbjct: 537 EIMKGELIIIVGPIGSGKTSLLNAICGLMPQYGN--EGELEVDGSLVS------------ 582

Query: 552 IVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
                P + + ++RDNI +G  Y  +K   ++V + C     + K      T+IG  G  
Sbjct: 583 --CGYPWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLSAYDMTEIGERGVT 638

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSIAH 670
           LSGGQK RI +AR+L K+ +I + D+  SA+D    +  +     + +K K+  + +  H
Sbjct: 639 LSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNKTRVLAT--H 696

Query: 671 RLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           +LS I +++ +IVLGNDG   +MG++++L
Sbjct: 697 QLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  124 bits (310), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 129/232 (55%), Gaps = 25/232 (10%)

Query: 464  TYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLH 522
            T   G  EI F +V   Y P  P   + KN++F + P S V IVG +G GKST+ + L  
Sbjct: 1230 TQWSGGAEISFDHVYVRYAPHLPD--VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFR 1287

Query: 523  YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIR 582
                T+G I I G DI  +N ++LRR+L ++ Q+P L SG+I+ NI     Y  + +E+ 
Sbjct: 1288 LIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRY--SDQELT 1345

Query: 583  KVAKQCFCHNFITKFPHTYDTQ--------IGPSGTLLSGGQKQRIAIARALIKKPNILI 634
              A++      I  F  T D +        +   G  +S GQ+Q + +ARAL++K  ILI
Sbjct: 1346 HFARR------IGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILI 1399

Query: 635  LDEATSALDVESEGAINYTFGQLMKTKSM--TIVSIAHRLSTIRRSENVIVL 684
            LDEAT+++D E++  I     Q+++  S    ++++AHR+STI   + VIVL
Sbjct: 1400 LDEATASIDHETDATIQ----QVVRDFSSGGIVITVAHRMSTIIDYDQVIVL 1447

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 110/451 (24%), Positives = 197/451 (43%), Gaps = 51/451 (11%)

Query: 278 SLICGG----VGVGMMCSLSLDL-------SAVLGVLIIPVVISASI-FGKQIRINSREL 325
           S +CG     V  G+M ++++ L       SA +GV +I +++  ++     ++    E 
Sbjct: 433 SELCGSLHYLVQAGIMTTVAISLLYQMLGWSAFVGVSVIIILLPFNVKIATLMQTYQSEA 492

Query: 326 QDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSA---FINAKFFT 382
              T + T      L  +K V+    E      F E I     +G RS+   F+  K F 
Sbjct: 493 LAMTDKKTNAISAMLGSIKNVKFLCWENH----FQELI-----MGFRSSECSFLTKKLFC 543

Query: 383 STSL--VGDLS--FLTVLVYGSYLVLHGS-LTIGD-LTAFMLYTEYTGNSIFGLSTFYSE 436
             +L  V  L+   +T   +G+ + L    +T+    TA  L+     N +  L+T    
Sbjct: 544 WATLHLVWFLTPTLVTAATFGASIYLQKQKITVASAYTALTLFA-LLRNPLTQLATMLGT 602

Query: 437 IMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFK 496
           I+Q   +  R+ +  +     +  + K       E+ F+N S ++       + KNL   
Sbjct: 603 IIQTTVSIQRIEKFLNRSNTKKHEILKDSFT---EMGFRNASLTWNRFDTGFMLKNLTID 659

Query: 497 IEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQE 556
            E      I+GPSG GKS++ L LL   +   G I      + +      R       Q 
Sbjct: 660 FELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSI-----RVPRGYMHDDRCSFAFCSQT 714

Query: 557 PVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQ 616
           P + + ++++NI +   +   + +  +V   C     I +     +T +G  G  LSGGQ
Sbjct: 715 PWITNATVKENIVFSSQFNTKRYQ--EVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQ 772

Query: 617 KQRIAIARALIKKPNILILDEATSALDVESEGAINYTF-----GQLMKTKSMTIVSIAHR 671
           +QR+A+ARA+      L+LD+  SA+D    G   + F     G LMK K  T +   H 
Sbjct: 773 RQRLALARAVYSGAEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHN 827

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
           ++ +++  ++I+L ++G V ++GK ++   D
Sbjct: 828 IALVQKHADMIILLDNGRVSKIGKARDFNFD 858

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 126/532 (23%), Positives = 221/532 (41%), Gaps = 74/532 (13%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L S ++   +     F++    G +++R   D Y V   + +  S  F + +     + +
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVKVTFTLVV 1068

Query: 289  MCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQ--DATGQLTRVS--EEQLNGVK 344
            +C  +          I+P+      + +     SREL+  D+  +   +S  +E L G+ 
Sbjct: 1069 ICVSTWQFI----FFIVPMSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHFQETLGGIS 1124

Query: 345  TVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVL 404
            T++ +  E R I    + + N       S   N         +G +  L     G Y + 
Sbjct: 1125 TIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGASTLGIYRLS 1184

Query: 405  HGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI------- 457
             G++T G +   + Y      S+  +     E+     +  R+ E ++   E        
Sbjct: 1185 QGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAPSIVEDK 1244

Query: 458  RPTLGKTYLPGKGEIEFKNVSFSYPTRPQ---NQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
            RP +     P  G ++F +    Y TR +   + + K++   I+P   + IVG +G GKS
Sbjct: 1245 RPDVN---WPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTGAGKS 1297

Query: 515  TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTY 574
            ++ L L      + G I +DG +  ++    LR KL I+ Q+  +  G++RDNI     Y
Sbjct: 1298 SLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNIDPTGQY 1357

Query: 575  TPTKEEIRKVAKQCFCHNFITKFP------------------------------------ 598
              T EEI K  +     + I                                        
Sbjct: 1358 --TDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSDGLTS 1415

Query: 599  --------HTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
                    +  +T++   G+ LS GQ+Q + +ARAL+   NIL+LDEAT+A+DVE++  I
Sbjct: 1416 SGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLI 1475

Query: 651  NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSD 702
              T     K +  TI++IAHRL+TI  S+ ++VL + G + E    + L  D
Sbjct: 1476 QETIRSAFKNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGD 1524

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 113/477 (23%), Positives = 216/477 (45%), Gaps = 57/477 (11%)

Query: 250 TGDLISRLGADAYIVSRSITQKISD--GFKSLICGGVGVGMMCSLSL----DLSAVLGVL 303
           TGD+++ +  D         Q++ D   + ++I  G     +C +SL      S  +GV 
Sbjct: 386 TGDVVNLMSVDV--------QRLQDVAQWCNIIWSGPFQITLCLVSLYKLLGNSMWIGVF 437

Query: 304 IIPVVISASIFGKQIRINSRELQ-DATGQLTRVSEEQLNGVKTVQSFVAE-----QREIK 357
           I+  ++  + +  +I+   +++Q     + TR+  E LN +K+++ +  E     + E  
Sbjct: 438 ILIFMMPINSYLMRIQKKLQKIQMKNKDERTRLISEILNNIKSLKLYAWEAPYKEKLEYV 497

Query: 358 RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 417
           R  + ++N+  +G   AF + +F     LV   +F  V V+     L   L    LT F 
Sbjct: 498 RNEKELKNLTKMGCYVAFTHFQFNIVPFLVSCSTF-AVFVWTQDRPLTTDLVFPALTLFN 556

Query: 418 LYTEYTGNSIFGLSTFYSEIMQGAGAASRLF------ELTDYVPEIRPTLGKTYLPGKGE 471
           L +      +  +    +  ++ + + +RLF      EL     +  P +  T     G+
Sbjct: 557 LLS----FPMAAIPIMITSFIEASISINRLFSFLTNEELQKDAVQRLPNVKNT-----GD 607

Query: 472 IEFK---NVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPT 527
           +  K   + +F +  +P+ ++  KN+NF+   G   CIVG  G GKS +   +L      
Sbjct: 608 VSIKLGDDATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSGKSALIQSILGDLFRV 667

Query: 528 SGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G   + G              +  V Q P +M+G++++NI +G  +   K+   K  K 
Sbjct: 668 KGFATVHGD-------------VAYVSQVPWIMNGTVKENILFGHKFD--KKFYEKTIKA 712

Query: 588 CFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-S 646
           C     ++  P    T +G  G  LSGGQK R+++ARA+  + +  + D+  +A+D    
Sbjct: 713 CALTIDLSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARADTYLFDDPLAAVDEHVG 772

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703
           +  I +  G      S T V   ++++ +  ++ + +L N G +I+ GK++E+ SDP
Sbjct: 773 KHLIEHVLGPNGLLHSKTKVLATNKITVLNIADYITLLDN-GEIIQRGKYEEVTSDP 828

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 128/489 (26%), Positives = 220/489 (44%), Gaps = 51/489 (10%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L    ++R +H    + D    G +++R   D   +   +T+ +   F +     +GV +
Sbjct: 958  LNLKAVERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLR-LFMTQFANIIGVCV 1016

Query: 289  MCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGV 343
            MC + L   A+ +  L++  V+ A  +   G+++ R+++ +       L  V    L G+
Sbjct: 1017 MCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEV----LGGM 1072

Query: 344  KTVQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
             T++++ +++R        I + NEA   +  + +  A        + +L+  L  +T  
Sbjct: 1073 DTIKAYGSQERFLVKTDFLINKMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCVTRQ 1132

Query: 397  VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAG----AASRLFELTD 452
             + S        ++G L  ++L      N+I    T     M  A      A+ L    D
Sbjct: 1133 FHIS------PASVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPLEAD 1186

Query: 453  YV-PEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSG 510
            Y  PE+ P       P KGEI F++VSF+Y P  P   + K ++  I+    + I G +G
Sbjct: 1187 YKRPELAPP---ESWPSKGEIVFEDVSFAYRPGLPV--VLKGISLDIKSQEKIGICGRTG 1241

Query: 511  KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN--- 567
             GKSTI   L      + G+I ID  DI ++    LR+KL I+ Q+PVL  G+IR N   
Sbjct: 1242 AGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDP 1301

Query: 568  ------------ITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGG 615
                        +  G   +  + E+ K  K     +  +      D ++   G   S G
Sbjct: 1302 FQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLG 1361

Query: 616  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI 675
            ++Q +A+ RAL+++  ILILDEATS++D E++  I             TI+ IAHRL TI
Sbjct: 1362 ERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTI 1419

Query: 676  RRSENVIVL 684
               + ++VL
Sbjct: 1420 LTYDRILVL 1428

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FKNLN  I+ G  V I GP G GKS++   +  +   TSG + +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  Y   KE   +V + C     I   P    T+IG  G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVS 667
             LSGGQK RI +AR++ K  +I + D+  SA+D      I      G+L   K  T + 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 668 IAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
             H+LS I ++  VIVLG DGS  E GK ++L
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 124/502 (24%), Positives = 224/502 (44%), Gaps = 37/502 (7%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            +L  T+ +  +     F++    G +I+R  +D  +V + +    +  F   I   +   
Sbjct: 1048 KLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFT-YFFIYILNYLFTV 1106

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATG----QLTRVSEEQLNGV 343
            ++ S ++ L  +   +++ +     I+   +   SREL+  T      +  +  E L G 
Sbjct: 1107 ILISFNMPLFLLFNGILLVLYFYYQIYYITL---SRELKRLTSISYSPIMSLLSETLGGH 1163

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSL--VGDLSFLTVLVYGSY 401
              + ++   QR     NE+I+  F++     F +   + S  L  +G +  L   +    
Sbjct: 1164 LVINAYKHLQRFTYLNNESIQ--FNINCMFNFRSTNRWLSMRLQTIGAVLVLLTALLSLS 1221

Query: 402  LV-LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPT 460
             +    +L+ G +   M Y      S+  +     ++     +  R+ E  +  PE    
Sbjct: 1222 TINTDKALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEADAI 1281

Query: 461  LGKTY----LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTI 516
            + ++      P +G I F+N S  Y     + + K++  +I+P   + IVG +G GKST+
Sbjct: 1282 IEESRPPKEWPSRGAITFQNYSTKY-RENLDPVLKDITVEIKPQEKIGIVGRTGAGKSTL 1340

Query: 517  ALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN--------- 567
            +L L     P+ G I+IDG DI K+    LR  L I+ Q+     G+I+ N         
Sbjct: 1341 SLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD 1400

Query: 568  --ITYGLTYTPTKEEIRKVAKQCFCHNF-----ITKFPHTYDTQIGPSGTLLSGGQKQRI 620
              I   L  +  K  I K+A +    N       T+       +I  +G  LS GQ+Q +
Sbjct: 1401 EEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLL 1460

Query: 621  AIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSEN 680
             ++RAL+    IL+LDEAT+A+D+E++  I  T     K +  TI++IAHR+ T+  S+ 
Sbjct: 1461 CLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDK 1518

Query: 681  VIVLGNDGSVIEMGKFKELFSD 702
            ++VL + G V E      L +D
Sbjct: 1519 IMVL-DKGEVKEFDTPTNLLAD 1539

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 109/220 (49%), Gaps = 21/220 (9%)

Query: 490 FKNL-NFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKMNSKSLR 547
            KN+ +F+   G   CIVG  G GKST    +L       GQ+  I G D        +R
Sbjct: 645 LKNIRHFEARKGDLTCIVGRVGSGKSTFLQAIL-------GQLPCISGLDEHVPPKLIIR 697

Query: 548 RK-LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIG 606
            K +    Q+P +M+ S++DN+ +G  +   ++  +   ++C     +   P    T +G
Sbjct: 698 AKSIAYCPQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVG 755

Query: 607 PSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-----SEGAINYTFGQLMKTK 661
             G  LSGGQK R+++ARA+  + ++ +LD+  SA+D E      E  +N   G L   K
Sbjct: 756 EKGISLSGGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGIL---K 812

Query: 662 SMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           + T++   + +S ++ S+N+  L  DG ++E   + +  S
Sbjct: 813 NKTVILTTNAVSVLKHSQNIYALL-DGEIVENKSYADAMS 851

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 129/503 (25%), Positives = 215/503 (42%), Gaps = 44/503 (8%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            RL    ++R +H    F D    G +++R   D   V   +T+ +   F   +   VGV 
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR-LFVFQLSNIVGVI 1033

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGV 343
            +MC + L   A+    ++ V +  +      + +SRE++     Q + V     E L G+
Sbjct: 1034 VMCIIYLPWFAIAVPFLMLVFVGVA---DHYQSSSREIKRLEAVQRSHVFNNFNEVLGGM 1090

Query: 344  KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403
             T++++  E+R + + +     +   G     I      +  ++     L V +      
Sbjct: 1091 DTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQ 1150

Query: 404  LH-GSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI----- 457
             H  + ++G L  ++L      N +    T      QG    +    L  Y  E+     
Sbjct: 1151 FHISAASVGVLLTYVLQLPGLLNMLLRAMT------QGENDMNSTERLISYATELPLEAA 1204

Query: 458  --RPTLGK-TYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGK 513
              RP +      P  G IEF +VS +Y P  P   + K++   +  G  + I G +G GK
Sbjct: 1205 YRRPEMSPPAEWPTDGRIEFDHVSLAYRPGLPL--VLKDVTLHVAAGEKIGICGRTGAGK 1262

Query: 514  STIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLT 573
            STI   L        G I IDG DI+ +    LR KL I+ Q+PV+  G +R N+     
Sbjct: 1263 STIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHE 1322

Query: 574  YTPTK-------------EEIRKVAKQCFCHNFITKFPHTYDTQ--IGPSGTLLSGGQKQ 618
             T  +             E +  V  Q   +       H +  Q  +   GT  S G++Q
Sbjct: 1323 RTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQ 1382

Query: 619  RIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRS 678
             +A+ RAL+++  ILILDEATS++D E++  I     +     + TI+ IAHRL+TI   
Sbjct: 1383 LLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNCTILCIAHRLNTILDY 1440

Query: 679  ENVIVLGNDGSVIEMGKFKELFS 701
            + ++VL + G V E      L++
Sbjct: 1441 DRILVL-DQGRVCEFDTPAALYA 1462

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 109/255 (42%), Gaps = 22/255 (8%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F NLN +I  G  V + G  G GKS++   L  +   T G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + ++RDNI +G  Y   +    ++ + C     +   P    T+IG  G
Sbjct: 650 -MLLCGYPWIQNATVRDNILFGSPYNEAR--YNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVS 667
             LSGGQK RI +ARA+ KK +I + D+  SA+D      I      G+L   +  T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKL---EGSTRVL 763

Query: 668 IAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISS 727
             H+LS I R+  VI +  DGSV ++G  +EL                     K   +  
Sbjct: 764 ATHQLSLIARASKVIYIDLDGSV-DVGSVEELKKRKPGFVNLMQYSNHSESEKKPGEVEE 822

Query: 728 APEVDADATGEPVEP 742
               +A A  +PV P
Sbjct: 823 EKRQEAGAGAQPVRP 837

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 134/266 (50%), Gaps = 21/266 (7%)

Query: 443  AASRLFELTDYVPE----IRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIE 498
            +  R+ E  D  PE    I  +      P +GEI F++ +  Y     + + K+++ +I+
Sbjct: 1282 SVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY-RENLDPVLKDIDLRIK 1340

Query: 499  PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
                + +VG +G GKST+ L L     P  G+I IDG DI+ +    LRR L I+ Q+  
Sbjct: 1341 HQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQDAQ 1400

Query: 559  LMSGSIRDN-----------ITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGP 607
               G++R N           I   L  +  K  I ++  +    +   K     DTQI  
Sbjct: 1401 AFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSE--LPDDENKPTDLLDTQISD 1458

Query: 608  SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVS 667
            +G  LS GQ+Q + ++RAL+    ILILDEAT+A+D E++  I  T     K +  TI++
Sbjct: 1459 NGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--TILT 1516

Query: 668  IAHRLSTIRRSENVIVLGNDGSVIEM 693
            IAHR+ T+  S+ ++VL + G V E 
Sbjct: 1517 IAHRIDTVLDSDKIMVL-DKGEVKEF 1541

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 118/514 (22%), Positives = 230/514 (44%), Gaps = 70/514 (13%)

Query: 229 LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVG-VG 287
           L S V ++++   A+  +    GD+++ +  D   +     Q+  +  + L+   +  +G
Sbjct: 365 LMSLVYQKSLRLSAEAREDKANGDVLNLMSVDVIRI-----QRFFENAQILVGSPIQLIG 419

Query: 288 MMCSLSLDL-SAVLG-----VLIIPV-----VISASIFGKQIRINSRELQDATGQLTRVS 336
           ++ SL + L +A +G     V+++P+      +   +F  Q++   + ++  T       
Sbjct: 420 VLISLYVLLGNATIGGLVSIVIMVPINSYMTRLYKKLFKTQMQYKDKRIKTVT------- 472

Query: 337 EEQLNGVKTVQSFVAEQREIKRFNEAIRNI-FHVGKRSAFINAKFFTSTSLVGDLSFLTV 395
            E LN +K+++ +  E+  + R N    ++  H  K+ A ++   F   ++V  L   + 
Sbjct: 473 -EILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCST 531

Query: 396 LVYGSYL---VLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRL----- 447
            V  SYL   VL   +    LT F +      +++F + T  S I++   +  RL     
Sbjct: 532 FVLFSYLTDQVLSPQIIFPSLTLFSM----LNDALFTVPTMISNIIEIGVSLKRLKGYLL 587

Query: 448 -FEL-TDYVPEIRPTLGKTYLPGKGEIEF----KNVSFSYPTRPQNQI------FKNL-N 494
             EL T ++   R T     +     +      K+ + S  T  + +I       K++ N
Sbjct: 588 AEELDTSFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSIEN 647

Query: 495 FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI-LIDGQDITKMNSKSLRR--KLG 551
           F  +     CIVG  G GKST    +L       GQ+  +     + +  K + R   L 
Sbjct: 648 FSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNLA 700

Query: 552 IVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
              Q+P +M+ S++DNI +G  Y   +   +K  K C     +   P    T +G  G  
Sbjct: 701 YCPQQPWIMNASLKDNILFGYKYD--EAMYKKTIKACQLLPDLEILPDGDQTLVGEKGIS 758

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSMTIVS 667
           LSGGQK R+++ARA+  + ++ +LD+  SA+D    +  I+    +   L+K K  T++ 
Sbjct: 759 LSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--TVIL 816

Query: 668 IAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             + ++ +  S+ + +L N G ++E   ++E+ S
Sbjct: 817 TTNAVNVLVHSDMIYLLKN-GKIVESNSYEEVMS 849

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 227/510 (44%), Gaps = 60/510 (11%)

Query: 229 LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
           L    +K  +H    F D    G +++R   D   +   +T+ I      L    +GV +
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIRLMMFQL-GNIIGVIV 540

Query: 289 MCSLSLDLSAV-LGVLIIPVVISASIF---GKQI-RINSRELQDATGQLTRVSEEQLNGV 343
           MC + L   A+ +  L+I  V+ A  +   G+++ R+ + +       L  V    L G+
Sbjct: 541 MCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEV----LGGL 596

Query: 344 KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFIN---AKFFTSTSLVGDLSFLTVLVYGS 400
            T++++ ++ R + + +  I  +   G   A +    A F    +++  L  +T+L    
Sbjct: 597 DTIRAYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFAL-IITLLCVTR 655

Query: 401 YLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPE---- 456
              +  S T G L  ++L      N++    T   +   G  +A RL      +P+    
Sbjct: 656 QFKISPSST-GVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEY 711

Query: 457 IRPTLGK-TYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKS 514
            RP +      P +GEI+F+ VSF+Y P+ P   + KN +  I  G  + I G +G GKS
Sbjct: 712 RRPEMSPPENWPDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSGEKIGICGRTGAGKS 769

Query: 515 TIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDN------- 567
           TI   L        G+I ID  +I  +    LR KL I+ Q+PVL  G+I+ N       
Sbjct: 770 TIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEK 829

Query: 568 --------ITYGLTYTPTKEEIRKVAKQ----CFCHNFITKFPHTYDTQIGPSGTLLSGG 615
                   +  G    P  E+I +   Q       H+ + KF    + ++   G   S G
Sbjct: 830 TDQELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLG 885

Query: 616 QKQRIAIARALIKKPNILILDEATSALDVESEGAIN----YTFGQLMKTKSMTIVSIAHR 671
           +KQ +A+ RAL++   ILILDEATS++D E++  I       FG        TI+ IAHR
Sbjct: 886 EKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHR 939

Query: 672 LSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           L+TI   + ++VL   G V E      LF+
Sbjct: 940 LNTILNYDRILVL-EQGEVAEFDTPWNLFT 968

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 110/211 (52%), Gaps = 20/211 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F+NLNF I+ G  + + GP G GK+++   +  +   + G + ++G+ ++          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
            G     P + + ++RDNI +G  Y   K   RKV K C   + +   P    T+IG  G
Sbjct: 156 CGY----PWIQNATVRDNIIFGSPYEKAK--YRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RI +AR + K  +I + D+  SA+D    +  ++     L+  K+  + + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILAT- 268

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
            H+L+ I ++  +IVLGNDGS   +G ++EL
Sbjct: 269 -HQLALIEKATRLIVLGNDGSFT-IGTYEEL 297

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  112 bits (280), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 133/250 (53%), Gaps = 27/250 (10%)

Query: 466 LPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYN 525
            P  G++E KN+S  Y     ++   N++FK++ G+ V IVG +G GKS+I   +    +
Sbjct: 27  WPQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSD 85

Query: 526 PTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK--EEIRK 583
             +G I ID +DI  +  + LR  +  + Q+P L  G++R N+     Y+  +    + K
Sbjct: 86  WENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSK 145

Query: 584 VA--KQC--FCHNFITKFPH-----------TYDTQIGPSGTLLSGGQKQRIAIARALIK 628
           V   ++C   C  F  + P+             +T +   G+ LS GQ+Q + +AR+++ 
Sbjct: 146 VGLIEECDELCLIFEQEQPNFSSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLG 205

Query: 629 KPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDG 688
             NI+++DEAT+++D  S+  I  T  + M  K+ TI++IAHRL ++   + ++V+    
Sbjct: 206 ARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVM---- 259

Query: 689 SVIEMGKFKE 698
              EMG+ KE
Sbjct: 260 ---EMGRVKE 266

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 126/496 (25%), Positives = 215/496 (43%), Gaps = 44/496 (8%)

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLS 293
            +KR +H    F D    G +++R   D   +   +T+ +   F       VGV +MC + 
Sbjct: 966  VKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVR-LFLFQASNIVGVVIMCIIY 1024

Query: 294  LDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATG-QLTRVSE---EQLNGVKTVQSF 349
            L   A+  V  + ++ +A       + +SRE++     Q + V     E L+G+ T++++
Sbjct: 1025 LPWFAI-AVPFLLLIFAA--VADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAY 1081

Query: 350  VAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLT 409
              E R + + +  I  +   G    ++        S+  D+  +   +  + L +    +
Sbjct: 1082 RGEARFLTKSDFLINKMNEAG----YVVVAIQRWVSIALDMIAMAFALIITLLCVTRQFS 1137

Query: 410  IGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEI-------RP-TL 461
            I   +  +L T Y       L+T    + QG    +    L  Y  ++       RP T 
Sbjct: 1138 ISAASVGVLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETS 1196

Query: 462  GKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLL 520
                 P +G I+F +VS +Y P  P   +  +++  +  G  + I G +G GKSTI   L
Sbjct: 1197 PPESWPSEGAIDFDHVSLAYRPGLPL--VLHDVSLHVRGGEKIGICGRTGAGKSTIMSAL 1254

Query: 521  LHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT----------- 569
                    G I IDG DI ++    LR KL I+ Q+PVL  G +R N+            
Sbjct: 1255 YRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELW 1314

Query: 570  ---YGLTYTPTKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGTLLSGGQKQRIAIAR 624
                      T++E    A        +T   H +  + ++   G+  S G++Q +A+ R
Sbjct: 1315 DALVRAGAIATEDEAAARAVTRATAGALTNL-HKFHLEQEVEEDGSNFSLGERQLLALTR 1373

Query: 625  ALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVL 684
            AL++   ILILDEATS++D E++  I             T++ IAHRL+TI   + ++VL
Sbjct: 1374 ALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL 1431

Query: 685  GNDGSVIEMGKFKELF 700
             + G V E      LF
Sbjct: 1432 -DQGRVCEFDTPHALF 1446

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 100/214 (46%), Gaps = 22/214 (10%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           FKNLN +I  G  V + G  G GKS++   +  +    SG I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + +++DNI +G  +   +   ++  + C     +   P    T+IG  G
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPFDEAR--YKETIRVCSLQADLDLLPAGDKTEIGERG 697

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVS 667
             LSGGQK RI +AR++ KK +I + D+  SA+D      I      G L      T V 
Sbjct: 698 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKTRVL 754

Query: 668 IAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
             H+LS I R+  VI +  DG+V + G   EL S
Sbjct: 755 ATHQLSLIARASKVIFIDLDGTV-DSGTLDELKS 787

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 122/496 (24%), Positives = 219/496 (44%), Gaps = 40/496 (8%)

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLS 293
            ++R +H    F D+   G +++R   D   +   IT+ +      L+   +       + 
Sbjct: 949  LQRLLHAPMSFMDVTPIGRVMNRFTKDTDTLDNEITESVR-----LLIFQIANLTGIIIL 1003

Query: 294  LDLSAVLGVLIIPVVISASIF-GKQIRINSRELQ--DATGQ--LTRVSEEQLNGVKTVQS 348
              +      + +P ++   +F     + + RE++  DA  +  +     E L G+ T+++
Sbjct: 1004 CIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKRMDAVQRSFVYNNFNEVLGGMDTIKA 1063

Query: 349  FVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSL 408
            + +EQR + + +  I  +   G     I      S  ++  +  L + +       H S 
Sbjct: 1064 YRSEQRFLMKSDFLINKMNEAGYLVTSIQRWVAISLDMLAVIFALIIALLCVTRQFHVSA 1123

Query: 409  -TIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVP-----EIRPTLG 462
             ++G +  ++L      N++    T   +      +A RL      +P      I  T  
Sbjct: 1124 GSVGVMVTYVLQLPGLLNALLRSQT---QTENDLNSAERLVNYAYDLPIEAKYRILETQP 1180

Query: 463  KTYLPGKGEIEFKNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL 521
                P +G I+F+NVS +Y  RP+  +  KN++  I     + I G +G GKSTI   L 
Sbjct: 1181 PEQWPSEGRIKFENVSLAY--RPELPVALKNVSIDIGSNEKIGICGRTGAGKSTIMSALY 1238

Query: 522  HYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPT---- 577
                  +G+I ID  DI+ +    LR KL I+ Q+PVL  G IR N+      T      
Sbjct: 1239 RLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWD 1298

Query: 578  ---------KEEIRKVAKQCFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
                     ++++  +  Q    N ++   F    D  +   G+  S G++Q +A+ RAL
Sbjct: 1299 ALVRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVEDDGSNFSLGERQLLALTRAL 1358

Query: 627  IKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
            ++   ILILDEATS++D  ++  I     +  +  + TI+ IAHRL TI     ++VL +
Sbjct: 1359 VRGSKILILDEATSSVDYATDAKIQSRIVE--EFSNCTILCIAHRLKTILAYNRILVL-D 1415

Query: 687  DGSVIEMGKFKELFSD 702
             G V+E    K+L++D
Sbjct: 1416 QGQVVEFDTPKKLYND 1431

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 106/212 (50%), Gaps = 20/212 (9%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F  LNF ++    + I GP G GKS++   L  +   +SG + I G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
             ++   P + + +++DNI +G  +   K + +KV + C     +   P    T+IG  G
Sbjct: 640 --LLCGYPWVQNATVKDNILFGSPFD--KPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVSI 668
             LSGGQK RIA+AR++ K  +I + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKELF 700
            H+LS I ++  VI LG DGS  ++G   EL 
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS-FDIGTVPELL 784

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 142/509 (27%), Positives = 222/509 (43%), Gaps = 58/509 (11%)

Query: 229  LRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGM 288
            L    + + +H    F D +  G +++R   D   +   +T+ +     S I   +GVG 
Sbjct: 976  LNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAM-SQIANIIGVGA 1034

Query: 289  MCSLSLDLSAVLGVLIIPVVISASIF-GKQIRINSRELQDATG-QLTRVSE---EQLNGV 343
            MC + L   A+     IP ++   +      +   RE++     Q + V     E L G+
Sbjct: 1035 MCIIYLPWFAI----AIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGM 1090

Query: 344  KTVQSFVAEQR-------EIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVL 396
             T++++ A+ R        I + NEA      V +      A  F     V     +T+L
Sbjct: 1091 DTIKAYNAQDRFATKSEFLIDKMNEAAYISIAVQRW-----AGIFLDLVAVAFALIITLL 1145

Query: 397  VYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQG----AGAASRLFELTD 452
                   + G+ T G L  ++L      N++    T     M         A++L +   
Sbjct: 1146 CVTRQFHISGADT-GVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQ 1204

Query: 453  Y-VPEIRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSG 510
            Y  PE  P +     P  G I F+N++F+Y P  P   I KN N  I+P   + I G +G
Sbjct: 1205 YRKPECSPPID---WPQNGHIVFENINFAYRPGLPI--ILKNFNLIIKPNEKIGICGRTG 1259

Query: 511  KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570
             GKSTI   L      T+G+I+ID  DI+ +    LR KL I+ Q+PVL  G+IR N+  
Sbjct: 1260 AGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDP 1319

Query: 571  GLTYTP-------------TKEEIRKVAKQCFCHNFITKFPHTY--DTQIGPSGTLLSGG 615
               Y                 +E+  V  Q    N   K  H +  +  +   G   S G
Sbjct: 1320 FDEYQDDLLWESLVKAGAIDSQELETVKSQ--DKNSDAKNLHKFHLNQSVDEDGNNFSLG 1377

Query: 616  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKT--KSMTIVSIAHRLS 673
            ++Q +A+ RAL+++  ILILDEATS++D E++  I      L+ T     TI+ IAHRL 
Sbjct: 1378 ERQVLALTRALVRQSKILILDEATSSVDYETDAKIQ----NLIATAFNHCTILCIAHRLK 1433

Query: 674  TIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            TI   + ++VL   G V E      LF++
Sbjct: 1434 TILNYDRILVL-EKGEVAEFDTPWNLFNN 1461

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 103/214 (48%), Gaps = 21/214 (9%)

Query: 489 IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRR 548
           +  N+NF I  G  V + GP G GK+++   L       SG+          MN      
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGE----------MNHSGDLL 673

Query: 549 KLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608
             GI    P + + +IRDNI +G  Y PT    ++V   C   + +   P    T++G  
Sbjct: 674 LCGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQLMKTKSMTIVS 667
           G  LSGGQK RI++ARA+ K  +I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 668 IAHRLSTIRRSENVIVL--GNDGSVIEMGKFKEL 699
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 130/533 (24%), Positives = 234/533 (43%), Gaps = 45/533 (8%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G ++ I +++    N          S R   +L   +    ++    F++    G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R   D   V   +    S  F+SL+ G +   ++   ++    V  + +I +    
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLL-GYIVTVILVGYNMPWFFVFNIFLIVIYF-- 1129

Query: 312  SIFGKQIRINSRELQDATG----QLTRVSEEQLNGVKTVQSFVAEQREIKRFN-EAIRNI 366
              +     + SREL+  T      +  +  E L G   + ++   +R    FN E+++  
Sbjct: 1130 -YYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR-FSYFNFESVQ-- 1185

Query: 367  FHVGKRSAFINAKFFTSTSL--VGDLSFL-TVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 423
            F++     F +   + S  L  +G L  L T L+  S +     LT G +   M Y+   
Sbjct: 1186 FNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQV 1245

Query: 424  GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY----LPGKGEIEFKNVSF 479
             NS+  +     +I     +  R+ E  +  PE    + +T      P  G I+F + S 
Sbjct: 1246 TNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYST 1305

Query: 480  SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
             Y  +  + +   +N +IEP   + IVG +G GKST+ L L      T G+I+IDG DI+
Sbjct: 1306 KY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIS 1364

Query: 540  KMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH-------- 591
             +    LR  L I+ Q+     G+IR N+     +  + EE+ K  +             
Sbjct: 1365 TLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQH--SDEELWKAIEASHLKPHLERIIS 1422

Query: 592  -----------NFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATS 640
                       N   K  +  + +I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1423 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1482

Query: 641  ALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL + G V E 
Sbjct: 1483 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1532

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (51%), Gaps = 17/218 (7%)

Query: 490 FKNLN-FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDITKMNSKSLR 547
           FKN+N F+++ GS  CIVG  G GK+T+   +L      SG Q  I  + I + NS    
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 699

Query: 548 RKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGP 607
             +    Q+  +M+ S+++NI +G  Y      +    + C     +   P   +T +G 
Sbjct: 700 --IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 755

Query: 608 SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSM 663
            G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I     +   L+K+K  
Sbjct: 756 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 813

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           TI+   + +S ++ S+ +  L N   +IE G + ++ +
Sbjct: 814 TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMN 850

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 136/270 (50%), Gaps = 28/270 (10%)

Query: 449  ELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGP 508
            E T   PE  P  G  + P  G+I+FK+ +F Y       I KN N  ++ G  + I G 
Sbjct: 782  ERTSSKPETSP--GHIW-PENGKIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIGICGR 837

Query: 509  SGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
            +G GKSTI   L      T G I ID  DI+ +    LR+ L I+ Q+P+L  G+IR N+
Sbjct: 838  TGAGKSTIMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNL 897

Query: 569  ---TYGLTYTPTKEEIRK--VAKQCFCH--------NFITKFPHTYDTQIGPSGTLLSGG 615
               +Y    T  +  I    + +  F H          +TKF  T    +   GT  S G
Sbjct: 898  DPFSYFDDATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLG 955

Query: 616  QKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM---TIVSIAHRL 672
            +KQ +A  RA+I    +++LDEA+S++D E++  I     Q + +K     TI+ IAHRL
Sbjct: 956  EKQLLAFTRAIIHHSKVVVLDEASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRL 1010

Query: 673  STIRRSENVIVLGNDGSVIEMGKFKELFSD 702
            +TI + + ++VL + G++I     + LF +
Sbjct: 1011 NTILKYDRILVL-DHGNIIGFENPRVLFEN 1039

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 125/272 (45%), Gaps = 46/272 (16%)

Query: 451 TDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPT------RPQNQI--------------- 489
            D++ E  P+        +  I+F N SF + T      + +N I               
Sbjct: 148 NDFLLETMPS---NTFDTRLSIKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNG 204

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F NLNF I  G  + I GP G GK+++   +        G I IDG              
Sbjct: 205 FNNLNFSI-XGEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGN------------- 250

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
           L +    P + + ++RDNI +G  Y   KE+   V + C     +  F     T+IG  G
Sbjct: 251 LQLCGY-PWVQNTTVRDNIIFGSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVS 667
             LSGGQK RI +ARA+ K  +I + D+  SA+D      I  N   G L   K+  I++
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA 366

Query: 668 IAHRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
             H+LS I++++ ++VLGND S  E+G +KEL
Sbjct: 367 -THQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 132/544 (24%), Positives = 247/544 (45%), Gaps = 65/544 (11%)

Query: 189  FGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIH 248
            + L+ Y  +G  S  L AG +  +         ++++ A+L S++    +    +F+DI 
Sbjct: 1040 YFLSTYTIIGFISSFLTAGKV--WVAVLFGTNATKKIFAKLLSSIFLAKL----RFHDIT 1093

Query: 249  KTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVV 308
              G +++R   D  I    I Q++   F+ L    V    +  L   ++    +  IP+ 
Sbjct: 1094 PVGRIMNRFSKDMDI----IDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRFLLFAIPLC 1149

Query: 309  ISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIR 364
                I G      SREL+         + ++  E + GV T+++   E+R I +   AI 
Sbjct: 1150 ALYYIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAID 1209

Query: 365  N----IFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV--LHGSLTIGDLTAFML 418
                  F++   + +I  +     +L+   S L +++   YL   L G L    L+    
Sbjct: 1210 KSNAPFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGIL----LSNAFS 1265

Query: 419  YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY------LPGKGEI 472
            +TE T   I  +   +S +     +  R+ E  D VP +  +    Y       P  G+I
Sbjct: 1266 FTE-TAQWIIKV---FSGVELLMSSVERIKEYVD-VP-LESSESNNYATPLANWPQTGDI 1319

Query: 473  EFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQIL 532
            EF+N++  Y     ++    ++FK++ G+ V IVG +G GKS+I   +    +   G I+
Sbjct: 1320 EFENLTLRYSPH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTII 1378

Query: 533  IDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK--EEIRKVA----K 586
            ID +DI  +  + LR  +  + Q P L  G+IR N+     Y+  +  E + KV      
Sbjct: 1379 IDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQS 1438

Query: 587  QCFC------------HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
            +  C            H    +F    +T +   G+ +S GQ+Q + +AR+++   NI++
Sbjct: 1439 EGLCSLPGQKLSYPSNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLGARNIML 1497

Query: 635  LDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
            +DEAT+++D  S+  I  T  + M  ++ T+++IAHRL ++   + ++V+       +MG
Sbjct: 1498 IDEATASIDYVSDAKIQKTIRETM--RNTTVLTIAHRLRSVIDYDKILVM-------DMG 1548

Query: 695  KFKE 698
            + +E
Sbjct: 1549 RVEE 1552

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 121/251 (48%), Gaps = 9/251 (3%)

Query: 450 LTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPS 509
           + DY+ E      +     K ++ F+N +  +     +   KN++   +  +   I+GP+
Sbjct: 643 IQDYLNEPETRKYEILTQSKTKLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPT 702

Query: 510 GKGKSTIALLLLHYYNPTSGQI---LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           G GKS++ L LL   N  SG+I    +  +D  ++    +   +    Q P L+SG+I+D
Sbjct: 703 GSGKSSLLLGLLGELNLRSGKINVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKD 762

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           NI +G  +   +++   V K C     I        T +G  G  LSGGQ+QRIA+ARA+
Sbjct: 763 NIVFGEFFN--QQKFDDVIKCCCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAI 820

Query: 627 IKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVL 684
                 L+ D+  SA+D E+   I      G +MK ++  + S  H +S I +    +V+
Sbjct: 821 YSSSRYLLFDDCLSAVDPETALHIYEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVI 878

Query: 685 GNDGSVIEMGK 695
            ++G V   GK
Sbjct: 879 LDNGEVKAQGK 889

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 130/533 (24%), Positives = 234/533 (43%), Gaps = 45/533 (8%)

Query: 193  IYEFLGGFS-IALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDIHKTG 251
            ++ F+G ++ I +++    N          S R   +L   +    ++    F++    G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 252  DLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISA 311
             +I+R   D   V   +    S  F+SL+ G +   ++   ++    V  + +I +    
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLL-GYIVTVILVGYNMPWFFVFNIFLIVIYF-- 1157

Query: 312  SIFGKQIRINSRELQDATG----QLTRVSEEQLNGVKTVQSFVAEQREIKRFN-EAIRNI 366
              +     + SREL+  T      +  +  E L G   + ++   +R    FN E+++  
Sbjct: 1158 -YYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR-FSYFNFESVQ-- 1213

Query: 367  FHVGKRSAFINAKFFTSTSL--VGDLSFL-TVLVYGSYLVLHGSLTIGDLTAFMLYTEYT 423
            F++     F +   + S  L  +G L  L T L+  S +     LT G +   M Y+   
Sbjct: 1214 FNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQV 1273

Query: 424  GNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTY----LPGKGEIEFKNVSF 479
             NS+  +     +I     +  R+ E  +  PE    + +T      P  G I+F + S 
Sbjct: 1274 TNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYST 1333

Query: 480  SYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
             Y  +  + +   +N +IEP   + IVG +G GKST+ L L      T G+I+IDG DI+
Sbjct: 1334 KY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDIS 1392

Query: 540  KMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH-------- 591
             +    LR  L I+ Q+     G+IR N+     +  + EE+ K  +             
Sbjct: 1393 TLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQH--SDEELWKAIEASHLKPHLERIIS 1450

Query: 592  -----------NFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATS 640
                       N   K  +  + +I  +G+ LS GQ+Q + ++RAL+    IL+LDEAT+
Sbjct: 1451 NRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATA 1510

Query: 641  ALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
            ++D+E++  I  T       +  TI++IAHR+ T+   + ++VL + G V E 
Sbjct: 1511 SVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVREF 1560

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (51%), Gaps = 17/218 (7%)

Query: 490 FKNLN-FKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSG-QILIDGQDITKMNSKSLR 547
           FKN+N F+++ GS  CIVG  G GK+T+   +L      SG Q  I  + I + NS    
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS---- 727

Query: 548 RKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGP 607
             +    Q+  +M+ S+++NI +G  Y      +    + C     +   P   +T +G 
Sbjct: 728 --IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGE 783

Query: 608 SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE-SEGAINYTFGQ---LMKTKSM 663
            G  LSGGQK R+++ARA+  + +I +LD+  SA+D E S+  I     +   L+K+K  
Sbjct: 784 KGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK-- 841

Query: 664 TIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFS 701
           TI+   + +S ++ S+ +  L N   +IE G + ++ +
Sbjct: 842 TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMN 878

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 131/536 (24%), Positives = 238/536 (44%), Gaps = 50/536 (9%)

Query: 188  MFGLTIYEFLGGFSIALLAGCMANFGXXXXXXXXSERLVARLRSTVIKRTIHQDAQFYDI 247
            ++ L  Y  +G  S  L AG +  +         ++++ ++L S++ +  +    +F+DI
Sbjct: 1026 LYFLLFYAIIGLISSFLTAGKV--WVAMLSGTNATKKIFSKLLSSIFEAKL----RFHDI 1079

Query: 248  HKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPV 307
               G +++R   D  I    I Q++   F+ L    V    +  L   ++    +  IP+
Sbjct: 1080 TPVGRIMNRFSKDMDI----IDQQLIPNFEGLFYSVVVCLWIVILIGYVTPRFLIFAIPL 1135

Query: 308  VISASIFGKQIRINSRELQDA----TGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAI 363
                   G      SREL+         + ++  E + GV T+++   E+R I    EAI
Sbjct: 1136 CGLYYFVGALYLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHTLEAI 1195

Query: 364  RN----IFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV--LHGSLTIGDLTAFM 417
                   F++   + +I  +     +LV   S L ++    YL   L G L    L+   
Sbjct: 1196 DGSNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGIL----LSNAF 1251

Query: 418  LYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL-TDYVPEIRPTLGKTYLPGKGEIEFKN 476
             +TE T   I  + +    +M          E+  ++             P  GEIEFKN
Sbjct: 1252 SFTE-TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTGEIEFKN 1310

Query: 477  VSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQ 536
            +S  Y       +  N++FK+  G+ V IVG +G GKS+I   +    +  SG I+ID +
Sbjct: 1311 LSLRYSPHSSKAL-DNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNK 1369

Query: 537  DITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK--EEIRKVA----KQCFC 590
            DI  ++ + LR  +  + Q P L  G+IR N+     Y+  +  + + KV      +  C
Sbjct: 1370 DIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKVGLIERNEVLC 1429

Query: 591  --------HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSAL 642
                     +F        ++ +   G+ LS GQ+Q + +AR+++    I+++DEAT+++
Sbjct: 1430 LVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASI 1489

Query: 643  DVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKE 698
            D  S+  I  T  + M  ++ TI++IAHRL ++     ++V+       +MG+ KE
Sbjct: 1490 DYISDAKIQKTIRETM--ENTTILTIAHRLRSVIDYNKILVM-------DMGRVKE 1536

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 122/251 (48%), Gaps = 9/251 (3%)

Query: 450 LTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPS 509
           + DY+ E   +  +     K ++ FK+ +  +     +   KN++ + +  S   I+GP+
Sbjct: 642 IEDYLDESETSKYEILTQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPT 701

Query: 510 GKGKSTIALLLLHYYNPTSGQILI---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRD 566
           G GKS++ L LL   N  SGQI +   D +D  ++    +   +    Q P L+SG+I D
Sbjct: 702 GSGKSSLLLGLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIED 761

Query: 567 NITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARAL 626
           NI +G    P +     V K C     +        T +G  G  LSGGQ+QR+A+ARA+
Sbjct: 762 NIVFG--ERPNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAI 819

Query: 627 IKKPNILILDEATSALDVESEGAI--NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVL 684
                 L+LD+  SA+D E+   I      G +MK ++  I S  H +S I +    +V+
Sbjct: 820 YSSSRFLLLDDCLSAVDPETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVI 877

Query: 685 GNDGSVIEMGK 695
            ++G V   GK
Sbjct: 878 LDNGEVKGQGK 888

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 118/499 (23%), Positives = 218/499 (43%), Gaps = 50/499 (10%)

Query: 228  RLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVG 287
            RL  +  KR ++    F D    G +++R   D  ++   +T   +  F   +   VGV 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDS-TRMFVFQMANVVGVF 956

Query: 288  MMCSLSLDLSAVLGVLIIPVVISASIF-GKQIRINSRELQDATG-QLTRVSE---EQLNG 342
            ++    L   A+     +P+ +   +F G   +   RE++     Q + V     E L+G
Sbjct: 957  ILSIAYLPYVAI----AVPISVLLLLFIGDHYQSAGREVKRLEAIQRSFVYNNLGEVLDG 1012

Query: 343  VKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYL 402
            + T++++ A+ R +++ +  +      G     I A+ + +  L  DL  + + +  + L
Sbjct: 1013 LDTIRAYNAQSRFLRKSDYFLNRTNEAGY--LVIGARCWVA--LTTDLVAIAIALIVTLL 1068

Query: 403  VLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQG-------AGAASRLFELTDYVP 455
             +   + I   +A +L T      +  +  +++ +++G         +  R+      +P
Sbjct: 1069 CVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATALP 1123

Query: 456  EIRP-----TLGKTYLPGKGEIEFKNVSFSYPTRPQNQI-FKNLNFKIEPGSNVCIVGPS 509
            +  P            P  GEI F+ VSF+Y  RP   +    ++F +  G  + I G +
Sbjct: 1124 QEAPQYLPGAAPPAGWPAAGEIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRT 1181

Query: 510  GKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNIT 569
            G GK+++   L       SG I IDG DI  +    LR  L I+ Q+P+L  G++R N+ 
Sbjct: 1182 GAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL- 1240

Query: 570  YGLTYTPTKEEIRKVAKQCFCHNFI-------TKFPHTYDTQIGPSGTLLSGGQKQRIAI 622
                  P  E            + +       T      D ++   G   S G++Q +A+
Sbjct: 1241 -----DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLAL 1295

Query: 623  ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVI 682
            ARAL++   ILILDEATS++D  ++  +        + +  T++ +AHRL TI   + ++
Sbjct: 1296 ARALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRIL 1353

Query: 683  VLGNDGSVIEMGKFKELFS 701
            VL + G V E      LF+
Sbjct: 1354 VL-DQGRVAEFDTPYRLFA 1371

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 104/210 (49%), Gaps = 18/210 (8%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
             +L F I+ G  + ++G  G GK+++   +  Y   T+G + ++G  +           
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLLF---------- 600

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSG 609
            G+    P + + +IRDNI +G ++  T+ +  +V   C        FP    T++G  G
Sbjct: 601 CGV----PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERG 654

Query: 610 TLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIA 669
             LSGGQK RI++ARA+ K  +I + D+  SA+D      I      L + ++ T +   
Sbjct: 655 ITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILAT 713

Query: 670 HRLSTIRRSENVIVLGNDGSVIEMGKFKEL 699
           H+L+ ++ +  VI LG DGS  +MG   EL
Sbjct: 714 HQLALVQEASRVIFLGQDGS-FDMGTPAEL 742

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 111/239 (46%), Gaps = 20/239 (8%)

Query: 490 FKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRK 549
           F +L+F+++ G  + I G  G GK+++   L  + + T+G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 550 LGIVQQEPVLMSGSIRDNITYGLTYTPTKEEI-RKVAKQCFCHNFITKFPHTYDTQIGPS 608
             +    P + + +IRDNIT+G   +P  E + R+V + C     ++  P    T++G  
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668
           G  LSGGQK RI +AR + K  +I + D+  SA+D    GA       L K    T +  
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARV-GASIMNDCLLGKLGDKTRILA 751

Query: 669 AHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPXXXXXXXXXXXXXXXXTKSDPISS 727
            H++S   ++  VI LG DGS  ++G   EL +                  +K D ISS
Sbjct: 752 THQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKLASQTESESKDDNISS 809

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 90/353 (25%), Positives = 159/353 (45%), Gaps = 34/353 (9%)

Query: 234  IKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISD-GFKSLICGGVGVGMMCSL 292
            + R +H    F D    G +++R   D  I+   +T+ +    ++  +  GV +  +  L
Sbjct: 959  LHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLRMFSYQFTVIWGVIIMSIIYL 1018

Query: 293  SLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAE 352
                 AV  ++++ +++S         I   E    +  L   +E  ++GV T++++ AE
Sbjct: 1019 PWFAVAVPLLVVVFILVSDHYQCSAREIKRLEAVQRSFVLNNFNE-VISGVDTIKAYHAE 1077

Query: 353  QREIKRFNEAIRNI------FHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHG 406
             R +K+ +  I  +       +  +R   I         L+G ++ L  L+  S L + G
Sbjct: 1078 ARFLKKSDILIDRMNEMTFPLYASQRWVSI---------LIGMIAVLFALII-SILCVTG 1127

Query: 407  SLTI-----GDLTAFMLYTEYTGNSIFGLSTFYSEIMQGA----GAASRLFELTDY-VPE 456
               I     G L  ++L      N++    T     M  A      A+ L +   Y +PE
Sbjct: 1128 WFNISPASTGVLLTYVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEAPYRIPE 1187

Query: 457  IRPTLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKST 515
            + P   K + P +G I F NV+ +Y P  P   + ++++F I  G  + I G +G GKST
Sbjct: 1188 MAPP--KAW-PERGAITFDNVALAYRPGLPL--VLQDVSFHISSGEKIGICGRTGAGKST 1242

Query: 516  IALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNI 568
            I   L      ++G + IDG DI  +   +LR KL I+ Q+P+L  G+IR N+
Sbjct: 1243 ITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 595  TKFPHTY--DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINY 652
            TK  H +  D  +   G+  S G++Q +A+ARAL+++  ILILDEATS++D E++  I  
Sbjct: 1409 TKNMHKFHLDQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQA 1468

Query: 653  TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEM 693
               Q  + +  TI+ +AHRL TI   + ++V+   G V E 
Sbjct: 1469 RIVQ--EFQHATIMCVAHRLKTILHYDRILVM-EKGRVAEF 1506

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 114/227 (50%), Gaps = 9/227 (3%)

Query: 474 FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
           F++ S  +     +   KN++   +  S   I+GP+G GKS++ L LL   N  SG+I +
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 534 ---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
              + +D  ++    +   +    Q P L+SG+I+DN+ +G  +   K++   V K C  
Sbjct: 713 PTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFN--KQKFDDVMKSCCL 770

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              I        T +G  G  LSGGQ+QRIA+ARA+      LILD+  SA+D E+   I
Sbjct: 771 DKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYI 830

Query: 651 --NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGK 695
                 G +MK ++  I S  H +S + +  + +V+ + G V   GK
Sbjct: 831 YEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGK 875

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 115/229 (50%), Gaps = 30/229 (13%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F  +SF+Y   P++ +++NLNF ++  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +E+   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VREKYSHISQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              + ++  T D Q    GT LS GQ+ R+  A   ++ PNIL+LDE T+ LD+ +  ++
Sbjct: 496 RGQLGRYGLTGDGQKAQMGT-LSEGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSL 554

Query: 651 NYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
                + + T +  +V ++H    + + ++++ V+ N      DGS++E
Sbjct: 555 ----AEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGSILE 599

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVES 646
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 92/177 (51%), Gaps = 25/177 (14%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SFSY   P+N +++ LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP---TKEEIRKVAKQC 588
                      S+    KLG+  Q         +D +   LT +P    +++   +++  
Sbjct: 451 -----------SRHTHVKLGVYSQHS-------QDQLD--LTKSPLEFVRDKYPNISQDF 490

Query: 589 -FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
            +    + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 491 QYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 90/180 (50%), Gaps = 31/180 (17%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F  +SFSY  +P+N +++NLNF ++  S V +VGP+G GKST+  ++     P  G++
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQ---EPVLMSGS----IRDNITYGLTYTPTKEEIRKV 584
                      S+    KLG+  Q   + + ++ S    +RD       Y    E+ +  
Sbjct: 452 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK------YGHISEDFQ-- 492

Query: 585 AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
               +    + ++  T + Q    GTL S GQ+ R+  A   + +PN+L+LDE T+ LD+
Sbjct: 493 ----YWRGQLGRYGLTGEGQTVQMGTL-SEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 115/229 (50%), Gaps = 30/229 (13%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SFSY   P+N +++NL+F ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPNISQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +  ++
Sbjct: 496 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 651 NYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
                +     +  +V ++H    + + ++++ V+ N      +GS++E
Sbjct: 555 AEAINEF----NGGVVVVSHDFRLLDKIAKDIFVVENKTATRWNGSILE 599

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 114/238 (47%), Gaps = 48/238 (20%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF+Y  +P+N ++++LNF ++  S V +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S+    KLG+  Q         +D +   LT +P   E  +       H
Sbjct: 450 -----------SRHTHVKLGVYSQHS-------QDQLD--LTKSPL--EFVRDKYSHISH 487

Query: 592 NF------ITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 645
           +F      + ++  T + Q     T LS GQ+ R+  A   ++ PN+L+LDE T+ LD+ 
Sbjct: 488 DFQYWRGQLGRYGLTGEGQTSQMAT-LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIA 546

Query: 646 S----EGAINYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
           +      AIN   G         +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 547 TIDSLADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSILD 596

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 114/232 (49%), Gaps = 30/232 (12%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF+Y   P+N ++++LNF ++  S   +VGP+G GKST+  ++     P SG++
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   + 
Sbjct: 563 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQYW 605

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              + ++  T D Q    GT LS GQ+ R+  A   ++ PN+L+LDE T+ LD+ +  ++
Sbjct: 606 RGQLGRYGLTGDAQKVQMGT-LSEGQRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSL 664

Query: 651 NYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIEMGK 695
                +     +  +V ++H    + + ++++ V+ +      DGS+++  K
Sbjct: 665 ADAINEF----NGGVVVVSHDFRLLDKIAKDIFVVEDKTATRWDGSILDYKK 712

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 391

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 112/235 (47%), Gaps = 42/235 (17%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F  +SFSY   P+N +++ LNF ++  S   +VGP+G GKST+  ++     P  G++
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 532 LIDGQDITKMNSKSLRRKLGIV---QQEPVLMSGS----IRDNITYGLTYTPTKEEIRKV 584
                      S+    KLG+     Q+ + ++ S    +RD       Y    E+ +  
Sbjct: 450 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK------YAHISEDFQ-- 490

Query: 585 AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
               F    + ++  T + Q     T LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 491 ----FWRGQLGRYGLTGEAQTAQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

Query: 645 ESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
            +  ++       +   +  +V ++H    + R ++++ V+ N      DGS+++
Sbjct: 546 PTIDSL----ADAIDAFNGGVVVVSHDFRLLDRIAKDIYVVENKTATRWDGSILD 596

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 90/174 (51%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SFSY  +P+N ++++LNF ++  S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEAQTVLMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 105/219 (47%), Gaps = 10/219 (4%)

Query: 474 FKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILI 533
           F   +  +    +  I +NLN K +      + GP+G GKS + + LL   +   G+I +
Sbjct: 693 FSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHV 752

Query: 534 ---DGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFC 590
                +    ++   L   +    Q P +++ SI++NI +G  +   +     V + C  
Sbjct: 753 PSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFGSEFNLKRYN--DVIRACCL 810

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
            N +       ++ +G  G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +    I
Sbjct: 811 TNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI 870

Query: 651 NYTF---GQLMKTKSMTIVSIAHRLSTIRRSENVIVLGN 686
            Y     G LMK ++  +VS    L  I+++  +++L N
Sbjct: 871 -YDLCLTGPLMKGRTCILVSHNVEL-VIKKAAYLLILDN 907

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 112/246 (45%), Gaps = 32/246 (13%)

Query: 290  CSLSLDLSAVLGVLIIPVVISASIF--------GKQIRINSRELQDATG----QLTRVSE 337
            C+L   +S +L   + P  I  +IF        G      SREL+         + +   
Sbjct: 1142 CTLQTLMSLILITYVNPNFIFPAIFIFLFCCFIGHSYLCCSRELKRYESITKTPIYQHFS 1201

Query: 338  EQLNGVKTVQSFVAEQREIK----RFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFL 393
            E L G+ ++++F  E R IK    R +E  ++ F++ + + +++ +      L+G +   
Sbjct: 1202 ESLAGLVSIRAFGDELRFIKVIFTRVDEYNKSFFYLWEANNWLSFR----IELIGSI--- 1254

Query: 394  TVLVYGSYLVLHGSLTIGDLTA--FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 451
            T+L  G +L+ + ++    L    F     +T ++++ +  FY+ +     +  RL+E T
Sbjct: 1255 TILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEYT 1313

Query: 452  DYVPEIRP---TLGKTYLPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVG 507
            +   E      T      P  G+I+FKNV+  Y P  P  ++ +++ F I     + +VG
Sbjct: 1314 NLEQEPYSRCITNVDNQWPNSGDIKFKNVTLRYSPELP--KVLQDVTFVIGDKEKIGVVG 1371

Query: 508  PSGKGK 513
             +G GK
Sbjct: 1372 RTGAGK 1377

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 90/174 (51%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F  ++FSY   P+N ++++LNF ++  S + +VGP+G GKST+  ++     P +G++
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++  ++++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPQISQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 110/231 (47%), Gaps = 38/231 (16%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF+Y  +P+N ++ +LNF ++  S + +VGP+G GKST+  ++       SG++
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK-EEIRKVAKQCFC 590
                      S+    KLG+  Q     S    D     L +   K  EI +  +  + 
Sbjct: 453 -----------SRHSHVKLGVYSQH----SQDQLDLTKSALEFVRDKYPEISQDFQ--YW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES---- 646
              + ++  T + Q    GT LS GQ+ R+  A   ++ PN+L+LDE T+ LD+ +    
Sbjct: 496 RGQLGRYGLTGEAQTVQMGT-LSEGQRSRVVFALLALEAPNVLLLDEPTNGLDIPTIDSL 554

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSV 690
             AIN   G         +V ++H    + R ++++ V+ N      DGS+
Sbjct: 555 ADAINEFNG--------GVVVVSHDFRLLDRIAKDIFVVENQTATRWDGSI 597

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 115/229 (50%), Gaps = 30/229 (13%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SFSY   P++ +++NL+F ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   + 
Sbjct: 452 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPNISQDFQYW 494

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +  ++
Sbjct: 495 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 553

Query: 651 NYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
                +     +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 554 AEAINEF----NGGVVVVSHDFRLLDKIAKDIFVVENRTATRWDGSILQ 598

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 112/233 (48%), Gaps = 38/233 (16%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF Y + P   ++++LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQFW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVES---- 646
              + ++  T + Q     T LS GQ+ R+  A   +++PN+L+LDE T+ LD+ +    
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 647 EGAINYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
             AIN   G         +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 555 ADAINEFNG--------GVVVVSHDFRLLDKIAQDIFVVENKTATRWDGSILQ 599

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 95/180 (52%), Gaps = 31/180 (17%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F N+SF+Y   P++ +++NL+F ++  S + +VGP+G GKST+  ++       +GQ+
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGQL 443

Query: 532 LIDGQDITKMNSKSLRRKLGIV---QQEPVLMSGS----IRDNITYGLTYTPTKEEIRKV 584
           +     +    S+    KLG+     Q+ + ++ S    +RD       Y+   ++ +  
Sbjct: 444 MAQAGRV----SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDK------YSSISQDFQ-- 491

Query: 585 AKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
               +    + ++  T ++Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 492 ----YWRGQLGRYGLTGESQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF Y + P   +++NLNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   V++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPSVSQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q     T LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 87/174 (50%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF Y + P   ++++LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQFW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q     T LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 87/174 (50%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF Y + P   ++++LNF ++  S + +VGP+G GKST+  ++     P SG++
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQFW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q     T LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 123/246 (50%), Gaps = 29/246 (11%)

Query: 472 IEFKNVSFSYPTRPQNQ----IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP- 526
           + F+N+S++ P+   N     I KN++  ++PG  + I+G SG GK+T+  +L       
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 527 -TSGQILIDGQDITKMNSKSLRRKLGIVQQ-----------EPVLMSGSIRDNITYGLTY 574
             SG I I+G+++++   + + + +G V Q           E VL S  +R  +   +T+
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTF 547

Query: 575 TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI 634
              ++ + +V ++   +N   +     D + G     +SGG+K+R++IA  L+  P IL 
Sbjct: 548 YQKQQRVFQVLEELRIYNIKDRLIGD-DFERG-----ISGGEKRRVSIACELVTSPLILF 601

Query: 635 LDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR-LSTIRRSENVIVLGNDGSVIEM 693
           LDE TS LD  +   +     +L K  + T+V   H+  S I    + +VL + G ++  
Sbjct: 602 LDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYS 661

Query: 694 GKFKEL 699
           G+ + +
Sbjct: 662 GEIRRV 667

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 105/236 (44%), Gaps = 48/236 (20%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y     + + K++N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R ++G   Q  V       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
           LD     A+     N+T G LM +  +++  I H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT 
Sbjct: 359 EAQQKPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTY 413

Query: 662 SMTIVSIAH 670
             T++ ++H
Sbjct: 414 PATVLVVSH 422

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 113/232 (48%), Gaps = 36/232 (15%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF+Y  + +N ++++LNF ++  S V +VGP+G GKST+  ++    +  SG++
Sbjct: 390 LAFDDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRV 449

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP---TKEEIRKVAKQC 588
                      S+    KLG+  Q                L  +P    +++   +++  
Sbjct: 450 -----------SRHTHVKLGVYSQHS---------QEQLDLNKSPLEFVRDKFPHISQDF 489

Query: 589 -FCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 647
            +    + ++  T + Q    GT LS GQ+ R+  A   ++ PN+L+LDE T+ LD+   
Sbjct: 490 QYWRGQLGRYGLTGEGQTSQMGT-LSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI--- 545

Query: 648 GAINYTFGQLMKTKSMTIVSIAHRLSTIRR-SENVIVLGN------DGSVIE 692
            A   +  + +   +  +V ++H    + + ++++ V+ N      DGS+++
Sbjct: 546 -ATIDSLAEAINDFNGGVVVVSHDFRLLDKIAKDIFVVENKTATRWDGSILD 596

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {ON}
           complement(62452..64284) [1833 nt, 611 aa]
          Length = 610

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 89/174 (51%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SF+Y    +N +++NLNF ++  S + +VGP+G GKST+  ++       +G++
Sbjct: 393 LSFDDISFAYDGNKENNLYQNLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQAGRV 452

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++  ++++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPQISQDFQYW 495

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 104/238 (43%), Gaps = 55/238 (23%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y    Q+ + K++N  ++  S + +VG +G GK+T+  +++    PTSG +
Sbjct: 532 IQLQDVSFGY--EEQSLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R ++G   Q  V       D++           ++   A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            +  K    Y   +G  G           LLSGGQK R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
           LD     A+      +T G LM         ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT 
Sbjct: 359 EAQQKPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTY 413

Query: 662 SMTIVSIAH 670
             T+++++H
Sbjct: 414 PSTVLTVSH 422

>KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534
           YER036C
          Length = 660

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 89/174 (51%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F N+SF+Y  + ++ +++NL+F ++  S + +VGP+G GKST+  ++       +G++
Sbjct: 443 LAFDNISFAYDGKKEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMAQTGRV 502

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   +++   + 
Sbjct: 503 -----------SRHTHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYSNISQDFQYW 545

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + +F  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 546 RGQLGRFGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 598

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 277 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 331

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 91/189 (48%), Gaps = 27/189 (14%)

Query: 499 PGSNVCIVGPSGKGKSTIALLLLHY---YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQ 555
           PGS++ I+GP+  GKS+I  +L      YN T G + I  +             L  + Q
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIWPIYNKT-GLVSIPAES-----------DLMCIAQ 644

Query: 556 EPVLMSG-SIRDNITYGLTYTPTKE------EIRKVAKQCFCHNFITKFPH-TYDTQIGP 607
            P  + G + RD I Y ++     E      E+ ++ K+      + +    +Y   +  
Sbjct: 645 RPYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVAD 704

Query: 608 SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVS 667
              +LSGG+KQR+  AR +  +P  L+LDEAT+A+ V+ E   +Y F  L K +    +S
Sbjct: 705 WKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFIS 760

Query: 668 IAHRLSTIR 676
           I+ R S I+
Sbjct: 761 ISQRPSLIK 769

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 114/237 (48%), Gaps = 25/237 (10%)

Query: 472  IEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP--TS 528
              ++NV +    + +  +I  N++  ++PG+   ++G +G GK+T+   L         +
Sbjct: 819  FHWRNVCYDVQIKSETRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLT 878

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTK----EEIRK 583
            G I +DG    K+  +S  R +G  QQ+ + L + ++R+++ +       K     E RK
Sbjct: 879  GSIFVDG----KLRDESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVPASEKRK 934

Query: 584  VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSAL 642
              ++    N +   P+  D  +G +G  L+  Q++R+ I   L  KPN+L+ LDE TS L
Sbjct: 935  YVEEVI--NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGL 991

Query: 643  DVESEGAINYTFGQLMK---TKSMTIVSIAHRLST--IRRSENVIVLGNDGSVIEMG 694
            D ++  +I     QLMK    +   I+   H+ S   I+  + ++ L   G  +  G
Sbjct: 992  DSQTAWSI----CQLMKKLANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 105/219 (47%), Gaps = 14/219 (6%)

Query: 488  QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYN--PTSGQILIDGQDITKMNSKS 545
            +I  N++  ++PG+   ++G SG GK+T+  +L +       +G I +DG     +   S
Sbjct: 859  RILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRDTS 914

Query: 546  LRRKLGIVQQEPVL-MSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT--KFPHTYD 602
             +RK G  QQ+ +   + ++RD + +   Y    + I +  K  +  + I         D
Sbjct: 915  FQRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEKNAYVEDIIKLLGMEAYAD 973

Query: 603  TQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQLMKTK 661
              +G +G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     +L+   
Sbjct: 974  AVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHG 1033

Query: 662  SMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFKE 698
               + +I H+ S I   E   +++L N G  +  G   E
Sbjct: 1034 QAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 38/207 (18%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y   P++ + K++N  ++  S + +VG +G GK+T+  +++    PT G +
Sbjct: 535 IQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTK--EEIRKVAKQCF 589
                      S++ R ++G   Q  V      +  + +  T  P K  EE R+      
Sbjct: 593 -----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYRR------ 635

Query: 590 CHNFITKFPHTYDTQIGPSG----TLLSGGQKQRIAIARALIKKPNILILDE-----ATS 640
               +  F  T     G  G     LLSGGQK R+A A   +  P+IL+LDE      TS
Sbjct: 636 ---HLGSFGIT-----GSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTS 687

Query: 641 ALDVESEGAINYTFGQLMKTKSMTIVS 667
            LD   +   N++ G LM +  ++I+ 
Sbjct: 688 GLDALEDSLKNFSGGVLMVSHDISIID 714

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 94/211 (44%), Gaps = 46/211 (21%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y   P   + K++N  I+  S + +VG +G GK+T+  ++L    P SG +
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R ++G   Q  V       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMSK 620

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVS 667
           LD     A+     N+T G LM +  +++++
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+ 
Sbjct: 359 EAQQQPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSY 413

Query: 662 SMTIVSIAH 670
             T+++++H
Sbjct: 414 PSTVLTVSH 422

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 103/238 (43%), Gaps = 55/238 (23%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y  +  N + K++N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R ++G   Q  V       D++           ++   A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
           LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 681 LDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT 
Sbjct: 359 EAQQKPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTY 413

Query: 662 SMTIVSIAH 670
             T++ ++H
Sbjct: 414 PATLLVVSH 422

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 97/234 (41%), Gaps = 55/234 (23%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++V+F Y     N + K++N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R +LG   Q  V                     ++   A +    
Sbjct: 590 -----------SRNPRLRLGYFAQHHV------------------DAMDLNASAVEWMSK 620

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            F  +    Y   +G  G           LLSGGQK R+A A   +  P++LILDE ++ 
Sbjct: 621 TFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNH 680

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
           LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 681 LDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
            SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   TI+ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSH 422

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 31/242 (12%)

Query: 472 IEFKNVSFSYP----TRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA--LLLLHYYN 525
           + F+N+S+  P    ++ + ++  ++   ++PG  + I+G SG GK+T+   L +     
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 526 PTSGQILIDGQDITKMNSKSLRRKLGIVQQ-----------EPVLMSGSIRDNITYGLTY 574
              G I ++G  I    +K   + +G V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSIL---NKLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 575 TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNIL 633
           T  ++ + +V ++        +     D  IG      +SGG+K+R++IA  L+  P IL
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 634 ILDEATSALDVESEGAINYTFGQLMKTKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVIE 692
            LDE TS LD  +   +     +L K  + T+V SI    S I    + +VL +DG +I 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 693 MG 694
            G
Sbjct: 624 SG 625

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 121/261 (46%), Gaps = 36/261 (13%)

Query: 460 TLGKTYLPGK--GEIEFKNVSFSYPT-RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTI 516
           TL +++L       + F+N++++  + +    I K ++  I+PG  + ++G SG GK+T+
Sbjct: 363 TLDESFLKSDNAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTL 422

Query: 517 A--LLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQ-----------EPVLMSGS 563
              L +       +G I ++G DI +   K   + +G V Q           E VL S  
Sbjct: 423 LDILAMKRKTGQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSAL 479

Query: 564 IRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL-LSGGQKQRIAI 622
           +R  +    ++   +  + +V ++        +     D  IG      +SGG+K+R++I
Sbjct: 480 LR--LPRSFSFAAKQTRVYQVLEE-------LRILDIKDRVIGNDFERGISGGEKRRVSI 530

Query: 623 ARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH--RLSTIRRSEN 680
           A  L+  P IL LDE TS LD  +   +     +L KT + T+V   H  R +  +  + 
Sbjct: 531 ACELVTSPLILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDK 590

Query: 681 VIVLGN-----DGSVIEMGKF 696
           +++L N      G  I +G+F
Sbjct: 591 LVLLSNGEMVYSGDAIRVGEF 611

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 88/174 (50%), Gaps = 19/174 (10%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           + F ++SFSY    +N ++++L+F ++  S + +VGP+G GKST+  ++       SG++
Sbjct: 390 LAFDDISFSYDGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRV 449

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQC-FC 590
                      S+    KLG+  Q     S    D     L +   +++   V++   + 
Sbjct: 450 -----------SRHSHVKLGVYSQH----SQDQLDLTKSALEF--VRDKYPHVSQDFQYW 492

Query: 591 HNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDV 644
              + ++  T + Q    GT LS GQ+ R+  A   +++PN+L+LDE T+ LD+
Sbjct: 493 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 96/199 (48%), Gaps = 21/199 (10%)

Query: 499 PGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV 558
           PGS++ I+GP+G GK++I  ++   +   +   L+         S    R+L  + Q+P 
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLL---------SVPAERELICIPQKPY 650

Query: 559 LMSG-SIRDNITYGLTYTP------TKEEIRKVAKQCFCHNFITKFP-HTYDTQIGPSGT 610
            + G + R+ I Y ++           +E+  V K+      + +     Y   +     
Sbjct: 651 FIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKD 710

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +LSGG++QR+  AR +  KP  ++LDEAT+A+  + E   +Y F  ++K      ++I+ 
Sbjct: 711 VLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQ 766

Query: 671 RLSTIRRSENVIVLGNDGS 689
           R S I+  +  + +G D S
Sbjct: 767 RPSLIKYHDLALEIGADES 785

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 107/222 (48%), Gaps = 18/222 (8%)

Query: 484  RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP--TSGQILIDGQDITKM 541
            R   +I  N++  ++PG+   ++G SG GK+T+   L         +G I +DG    K+
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 542  NSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTK----EEIRKVAKQCFCHNFITK 596
              +S  R +G  QQ+ + L + ++R+++ +       K     E RK  ++    N +  
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI--NVLEM 979

Query: 597  FPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFG 655
             P+  D  +G +G  L+  Q++R+ I   L+ KP +LI LDE TS LD ++  +I     
Sbjct: 980  EPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIR 1038

Query: 656  QLMKTKSMTIVSIAHRLST--IRRSENVIVLGNDGSVIEMGK 695
            +L   +   I+   H+ S   I+  + ++ L   G  +  G+
Sbjct: 1039 KL-ANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 112/241 (46%), Gaps = 29/241 (12%)

Query: 472 IEFKNVSFSYPTRPQNQ--IFKNLNFKIEPGSNVCIVGPSGKGKSTIA--LLLLHYYNPT 527
           + FK++ +  P    N   +   ++  ++PG  + ++G SG GK+T+   L +       
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 528 SGQILIDGQDITKMNSKSLRRKLGIVQQ-----------EPVLMSGSIRDNITYGLTYTP 576
           SGQI ++G+ I+K   K   + +G V Q           E VL S  +R  +   L +  
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 577 TKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNILIL 635
            +  + KV ++        +     D  IG      +SGG+K+R++IA  L+  P IL L
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFL 563

Query: 636 DEATSALDVESEGAINYTFGQLMKTKSMTIV-SIAHRLSTIRRSENVIVLGNDGSVIEMG 694
           DE TS LD  +   +     +L +    T+V SI    S I +  + +VL ++G ++  G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 695 K 695
           +
Sbjct: 624 E 624

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 97/199 (48%), Gaps = 27/199 (13%)

Query: 500 GSNVCIVGPSGKGKSTIALLLLH---YYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQE 556
           GS++ I+GP+G GKS+I  ++      YN  +G + I  ++            +  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNK-NGLLSIPSEN-----------NIFFIPQK 685

Query: 557 PVL-MSGSIRDNITYGLTYTP-------TKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608
           P     G++RD I Y ++           KE ++ + +    +        TY   I   
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADW 745

Query: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668
             LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI
Sbjct: 746 KDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISI 801

Query: 669 AHRLSTIRRSENVIVLGND 687
           + R + I+  E ++ +G +
Sbjct: 802 SQRPTLIKYHEMLLEIGEN 820

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 95/199 (47%), Gaps = 27/199 (13%)

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMN---SKSLRRKLGIVQQE 556
           GS++ I+GP+G GKS+I             +I+ D   +   N   S      +  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQ------------RIIADVWPVYNKNGLLSIPSENNIFCIPQK 685

Query: 557 PVL-MSGSIRDNITYGLTYT-------PTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPS 608
           P     G++RD I Y ++           KE ++ +A+    +        TY   +   
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADW 745

Query: 609 GTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSI 668
             LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI
Sbjct: 746 KDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISI 801

Query: 669 AHRLSTIRRSENVIVLGND 687
           + R + I+  E ++ +G +
Sbjct: 802 SQRPTLIKYHEMLLEIGEN 820

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 110/239 (46%), Gaps = 21/239 (8%)

Query: 472  IEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTS 528
              ++N+ +    + +  +I  N++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 893  FHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 952

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G + IDG    K   +S  R +G  QQ+ + L + ++R+++ +   Y     E+    K 
Sbjct: 953  GDVFIDG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKN 1007

Query: 588  CFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDV 644
             +  + I   +     D  +G +G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 1008 AYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1067

Query: 645  ESEGAINYTFGQLMK---TKSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFKE 698
            ++  AI     QLM+    +   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1068 QTAWAI----CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 104/233 (44%), Gaps = 46/233 (19%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y  +  N + K++N  ++  S + +VG +G GK+T+  ++++   P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP--TKEEIRKVAKQCF 589
             +G           R ++G   Q  V      +  + +     P  T EE R+      
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYRR------ 631

Query: 590 CHNFITKFPHTYDTQIGPSGT-------LLSGGQKQRIAIARALIKKPNILILDEATSAL 642
                      +    G +GT       LLSGGQK R+A A   +  P+IL+LDE ++ L
Sbjct: 632 -----------HLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHL 680

Query: 643 DVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
           D     A+     N++ G LM +  ++++        I  SEN  V   DG++
Sbjct: 681 DNTGLDALVESLKNFSGGVLMVSHDISVIDSV--CKEIWVSENGTVRRFDGTI 731

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 44/69 (63%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT 
Sbjct: 358 EAQNKPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTY 412

Query: 662 SMTIVSIAH 670
             T++ ++H
Sbjct: 413 PSTLLVVSH 421

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/236 (23%), Positives = 110/236 (46%), Gaps = 20/236 (8%)

Query: 469  KGEIEFKNVSFSYPTRPQNQ-IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YN 525
            K    ++N+ +    + +++ I  N++  ++PG+   ++G SG GK+T+   L       
Sbjct: 860  KAIFHWRNLCYDIKIKKEDRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMG 919

Query: 526  PTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITY-GLTYTPTKEEIRK 583
              +G+I ++G    ++  +S  R +G  QQ+ + L + ++R+++ +      P K  I +
Sbjct: 920  VITGEIFVNG----RLRDESFPRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIEE 975

Query: 584  VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSAL 642
              K       I +  H  D  +G +G  L+  Q++R+ I   L+ KP +L+ LDE TS L
Sbjct: 976  KNKYVEEVIKILEMEHYADAVVGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDEPTSGL 1035

Query: 643  DVESEGAINYTFGQLMKTKSMTIVSIAH----------RLSTIRRSENVIVLGNDG 688
            D ++  +I     +L       + +I            RL  +RR    +  G+ G
Sbjct: 1036 DSQTAWSICQLMRKLANHGQAILCTIHQPSAMLMQEFDRLLFMRRGGETVYFGDLG 1091

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 25/193 (12%)

Query: 494 NFKIEPGSNVCIVGPSGKGKSTIALLLLHY---YNPTSGQILIDGQDITKMNSKSLRRKL 550
           N  + PGS++ I+GP+  GKS+I  ++      YN T    +    D+           +
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDM-----------M 640

Query: 551 GIVQQEPVLMSGSIRDNITYGLTYTPTKE------EIRKVAKQCFCHNFITKFPH-TYDT 603
            I Q+   +  G+ RD I Y +      E      E+ +V K+      + +     Y  
Sbjct: 641 CIAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKLDYLLKRADALNYLD 700

Query: 604 QIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSM 663
            +     +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L K +  
Sbjct: 701 HVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFNMLKKFR-F 756

Query: 664 TIVSIAHRLSTIR 676
             +SI+ R S I+
Sbjct: 757 NFISISQRPSLIK 769

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 110/239 (46%), Gaps = 21/239 (8%)

Query: 472  IEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTS 528
              ++N+ +    + +  +I  N++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 951  FHWRNLCYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 1010

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G + IDG    K   +S  R +G  QQ+ + L + ++R+++ +   Y     E+    K 
Sbjct: 1011 GDVFIDG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKN 1065

Query: 588  CFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDV 644
             +  + I   +     D  +G +G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 1066 AYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1125

Query: 645  ESEGAINYTFGQLMK---TKSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFKE 698
            ++  AI     QLM+    +   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1126 QTAWAI----CQLMRKLCNQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 29/221 (13%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y  +  N +  ++N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYNEK--NLLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYV 589

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTP--TKEEIRKVAKQCF 589
             +G           R ++G   Q  V      +  + +  T  P  T EE R+      
Sbjct: 590 SQNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTDEEYRR------ 632

Query: 590 CHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGA 649
               +  F  T    +     LLSGGQK R+A A   +  P+ILILDE ++ LD     A
Sbjct: 633 ---HLGAFGITGSLSL-QKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTSGIDA 688

Query: 650 INYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690
           +       MK  +  I+ ++H +S I    N I +  +G+V
Sbjct: 689 L----VDAMKKFTGGILMVSHDISVISNVCNEIWVSENGTV 725

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 45/69 (65%), Gaps = 5/69 (7%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE T+ LDV S   I Y   + +KT 
Sbjct: 359 EAQQQPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTY 413

Query: 662 SMTIVSIAH 670
             T+++++H
Sbjct: 414 PSTVLTVSH 422

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 114/248 (45%), Gaps = 21/248 (8%)

Query: 460  TLGKTYLPGKGEIEFKNVSFSYPTRP-QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIAL 518
            T G   L  +    ++N+ +  P +    ++  N++  ++PG+   ++G SG GK+T+  
Sbjct: 839  TNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLLD 898

Query: 519  LLLHY--YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYT 575
             L         +G +L+DG    +   +S  R +G  QQ+ + L + ++R+++ +   Y 
Sbjct: 899  CLAERVTMGVITGDVLVDG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYL 953

Query: 576  PTKEEIRKVAKQCFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNIL 633
                E+    K  +    I   +     D  +G +G  L+  Q++R+ I   L  KP +L
Sbjct: 954  RQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLL 1013

Query: 634  I-LDEATSALDVESEGAINYTFGQLMK---TKSMTIVSIAHRLSTIRRSE--NVIVLGND 687
            + LDE TS LD ++  +I     QLM+   +    I+   H+ S I   E   ++ L + 
Sbjct: 1014 VFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQDG 1069

Query: 688  GSVIEMGK 695
            G     G+
Sbjct: 1070 GQTTYFGE 1077

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 95/241 (39%), Gaps = 34/241 (14%)

Query: 482 PTRPQN--QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDIT 539
           P R  N  QI K +   ++PG  + ++G  G G +T    LL   +  +    +D   + 
Sbjct: 151 PARDSNSFQILKPMEGYLDPGELLVVLGRPGSGCTT----LLKTISSNTHGFRVDKDSVI 206

Query: 540 KMNSKSLRRKLGIVQQEPVLMSGS---------IRDNITYGLTYTPTKEEIRKVAKQCFC 590
             N  + R      + E V  + S              T     TPT   I+ V +  + 
Sbjct: 207 SYNGLTPREMRKHFRGEVVYNAESDVHLPHLTVFETLYTVARLKTPTN-RIKGVDRDTYA 265

Query: 591 HNFITK-------FPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNILILDEATSAL 642
            + IT          HT +T++G +    +SGG+++R++IA   I        D AT  L
Sbjct: 266 RH-ITDVAIATYGLSHTKNTKVGNALVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGL 324

Query: 643 DVESEGAINY-----TFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFK 697
           D  S  A+ +     T   L+KT +  +V+I     T     N + + N G  I  G   
Sbjct: 325 D--SANALEFIRALDTESSLLKTAA--VVAIYQCSQTAYDLFNKVCVLNKGYQIYFGPID 380

Query: 698 E 698
           E
Sbjct: 381 E 381

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 114/239 (47%), Gaps = 18/239 (7%)

Query: 466  LPGKGEIEFKNVSFSYPTRP-QNQIFKNLNFKIEPGSNVCIVGPSGKGKST-IALLLLHY 523
            L  KG   ++NV ++ P      Q+  N++   +PG+   ++G SG GK+T +  L    
Sbjct: 851  LESKGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRN 910

Query: 524  YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG-SIRDNITYGLTY-----TPT 577
                +G +L++G+ I      S  R+ G VQQ+ + +S  ++R+++ +          P 
Sbjct: 911  VGIITGDMLVNGKPI----DISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPE 966

Query: 578  KEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LD 636
            +E++  V +       +       D  +G  G  L+  Q+++++I   L+ KP++L+ LD
Sbjct: 967  EEKMEHVERII----KVLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLD 1022

Query: 637  EATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI-RRSENVIVLGNDGSVIEMG 694
            E TS LD +S  AI     +L K     + +I    +T+    + +++L   G  +  G
Sbjct: 1023 EPTSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1081

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 81/181 (44%), Gaps = 15/181 (8%)

Query: 500 GSNVCIVGPSGKGKSTI----ALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQ 555
           G  V ++G  G G S++    A  +  +     G+I+ DG    +M  +     +   +Q
Sbjct: 188 GEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKRYKPDVIYNGEQ 247

Query: 556 EPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCF------CHNFITKFPHTYDTQIGPSG 609
           +      +++  + + +      + +  V+++ +       H  I    HTY T++G   
Sbjct: 248 DVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLRHTYHTKVGNDF 307

Query: 610 TL-LSGGQKQRIAIARALIKKPNILILDEATSALD----VESEGAINYTFGQLMKTKSMT 664
              +SGG+++R++IA AL+ K +I   D AT  LD    +E   AI  T   L  T  +T
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNLLGSTAFVT 367

Query: 665 I 665
           I
Sbjct: 368 I 368

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 94/196 (47%), Gaps = 21/196 (10%)

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559
           GS++ I+GP+G GKS+I  ++   +   +   L+         S      +  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNKNGLL---------SIPPENNIFFIPQKPYF 688

Query: 560 -MSGSIRDNITYGLTYT-------PTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL 611
              G++RD I Y ++           KE ++ + +    +        TY   +     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKDL 748

Query: 612 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 671
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 672 LSTIRRSENVIVLGND 687
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 104/240 (43%), Gaps = 48/240 (20%)

Query: 472 IEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQI 531
           I+ ++VSF Y       + K++N  ++  S + +VG +G GK+T+  +++    P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 532 LIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCH 591
                      S++ R ++G   Q  +       D++           ++   A      
Sbjct: 591 -----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMSK 621

Query: 592 NFITKFPHTYDTQIGPSG----------TLLSGGQKQRIAIARALIKKPNILILDEATSA 641
            F  K    Y   +G  G           LLSGGQK R+A A   +  P+ILILDE ++ 
Sbjct: 622 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNH 681

Query: 642 LDVESEGAI-----NYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKF 696
           LD     A+     N++ G LM +  ++++        I  SE+  V   DG++ +  K+
Sbjct: 682 LDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 45/72 (62%), Gaps = 5/72 (6%)

Query: 602 DTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTK 661
           + Q  P+ +  SGG + R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KT 
Sbjct: 360 EAQQKPTNSF-SGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTY 414

Query: 662 SMTIVSIAHRLS 673
             T++ ++H  S
Sbjct: 415 PATVLVVSHDRS 426

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 111/240 (46%), Gaps = 12/240 (5%)

Query: 466  LPGKGEIEFKNVSFSYPTRP-QNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA-LLLLHY 523
            L  +G   +K+V ++ P +  Q Q+  N++    PG+   ++G SG GK+T+   L    
Sbjct: 831  LQSEGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRN 890

Query: 524  YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIR 582
                +G +L++G  I      S  R+ G VQQ+ + +   ++R+++ +        E I 
Sbjct: 891  VGIITGDMLVNGSPI----DASFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIP 945

Query: 583  KVAKQCFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEAT 639
               K  +    I         D  +G  G  L+  Q+++++I   L  KPN+L+ LDE T
Sbjct: 946  DSEKMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPT 1005

Query: 640  SALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI-RRSENVIVLGNDGSVIEMGKFKE 698
            S LD ++  AI     +L +     + +I    +T+  + + +++L   G  +  G   E
Sbjct: 1006 SGLDSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGE 1065

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 96/227 (42%), Gaps = 21/227 (9%)

Query: 484 RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLL---LHYYNPTSGQILIDG---QD 537
           +   +I + +N    PG  + ++G  G G S+    +   +  +   +G I  DG   +D
Sbjct: 155 KKMRKIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKD 214

Query: 538 ITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNF---- 593
           + K     +     +    P L   +++  + + L        +   +++ +  +     
Sbjct: 215 MMKKYKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRKQYIASMRELY 271

Query: 594 --ITKFPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAI 650
             I    HTY+T++G      +SGG+++R++IA AL  + +I   D AT  LD  +  A+
Sbjct: 272 ATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--AL 329

Query: 651 NYTFGQLMKT---KSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMG 694
            Y     + T   KS  +V+I      I  + + + +  DG  I  G
Sbjct: 330 EYAQAIRIMTNLLKSTALVTIYQASENIYETFDKVTVLYDGRQIYFG 376

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 115/242 (47%), Gaps = 28/242 (11%)

Query: 469 KGEIEFKNVSFSYPT-RPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIA--LLLLHYYN 525
           K  + F+N+ ++  + + +  I   ++  ++PG  + ++G SG GK+T+   L +     
Sbjct: 363 KSTLTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAG 422

Query: 526 PTSGQILIDGQDITKMNSKSLRRKLGIVQQE-----------PVLMSGSIRDNITYGLTY 574
             SG I I+G +ITK N   L +  G V QE            VL S  +R  +   L++
Sbjct: 423 KASGSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLR--LPRKLSF 477

Query: 575 TPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTL-LSGGQKQRIAIARALIKKPNIL 633
              ++ + +V ++        +     D  IG      +SGG+K+R++IA  L+  P++L
Sbjct: 478 VQKQKRVYQVLEE-------LRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVL 530

Query: 634 ILDEATSALDVESEGAINYTFGQL-MKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIE 692
            LDE TS LD  +   +     +L +      I+SI    S I +S + +VL + G ++ 
Sbjct: 531 FLDEPTSGLDSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVF 590

Query: 693 MG 694
            G
Sbjct: 591 SG 592

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 111/239 (46%), Gaps = 21/239 (8%)

Query: 472  IEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTS 528
              ++N+ +    + +  +I  N++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 853  FHWRNLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 912

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G +L+DG    +   +S  R +G  QQ+ + L + ++R+++ +   Y     E+    K 
Sbjct: 913  GDVLVDG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKD 967

Query: 588  CFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDV 644
             +    I   +     D  +G +G  L+  Q++R+ I   L  KP +L+ LDE TS LD 
Sbjct: 968  AYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1027

Query: 645  ESEGAINYTFGQLMK---TKSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFKE 698
            ++  +I     QLM+   +    I+   H+ S I   E   ++ L   G  +  G+  E
Sbjct: 1028 QTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 103/219 (47%), Gaps = 14/219 (6%)

Query: 488  QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTSGQILIDGQDITKMNSKS 545
            +I  N++  ++PG+   ++G SG GK+T+   L         +G I +DG       ++S
Sbjct: 886  RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----RNES 941

Query: 546  LRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT--KFPHTYD 602
              R +G  QQ+ + L + ++R+++ +   Y    +E+    K  +    I   +     D
Sbjct: 942  FPRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVEEKNAYVEEIIKILEMEKYAD 1000

Query: 603  TQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDVESEGAINYTFGQLMKTK 661
              +G +G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  AI     +L K  
Sbjct: 1001 AIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCKHG 1060

Query: 662  SMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFKE 698
               + +I H+ S I   E   ++ +   G  +  G+  E
Sbjct: 1061 QAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 100/213 (46%), Gaps = 25/213 (11%)

Query: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559
           GS++ I+GP+  GKS+I  +L   +   +   L+         S      L  V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPIYNKNGLL---------STPPSHDLFCVPQRPYF 665

Query: 560 MSG-SIRDNITYGLTYTPTKEEIRK------VAKQCFCHNFITKFPH--TYDTQIGPSGT 610
           + G + RD I Y +TY    E   K      + ++    +++ K      Y   I     
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRL-DYLLKRDRGLNYFDAIADWKD 724

Query: 611 LLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAH 670
           +LSGG+KQR+   R +  +P  ++LDEAT+A+ V+ E  + +T   ++K      +SI+ 
Sbjct: 725 VLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISISQ 780

Query: 671 RLSTIRRSENVIVL--GNDGSVIEMGKFKELFS 701
           R S I+  + ++ L  G D S+  +G  + + S
Sbjct: 781 RPSLIKYHDYLLELTNGTDWSLQALGSDEAILS 813

>Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR326WABR125C/AGL142C/ABR126W
          Length = 1517

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 112/235 (47%), Gaps = 21/235 (8%)

Query: 472  IEFKNVSFSYPTRPQNQ-IFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNP--TS 528
              ++NV +S   + +N+ I  +++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 868  FHWRNVCYSVKIKDENRLILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVLT 927

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPVLMS-GSIRDNITYGLTYTPTKEEIRKVAKQ 587
            G + ++G     +  KS  R +G  QQ+ + +S  ++++++ +   Y     +I K  K 
Sbjct: 928  GSMFVNG----NLRDKSFPRSIGYCQQQDLHLSTATVKESLRFS-AYLRQSADIPKEEKD 982

Query: 588  CFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSALDV 644
             +    I         D  +G +G  L+  Q++R+ I   L+ KP +L+ LDE TS LD 
Sbjct: 983  RYVDEVIKILDMEQYVDAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDS 1042

Query: 645  ESEGAINYTFGQLMKT---KSMTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMG 694
            ++  +I     QLM++       ++   H+ S +   E   +++L   G  +  G
Sbjct: 1043 QTAWSI----CQLMRSLADHGQAVLCTIHQPSALLMQEFDRLLLLQKHGQTVYFG 1093

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 114/241 (47%), Gaps = 25/241 (10%)

Query: 472  IEFKNVSFSYPTRPQ-NQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY--YNPTS 528
              ++N+ +    + +  +I  N++  ++PG+   ++G SG GK+T+   L         +
Sbjct: 848  FHWRNLCYDVQIKSETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 907

Query: 529  GQILIDGQDITKMNSKSLRRKLGIVQQEPV-LMSGSIRDNITYGLTYTPTK----EEIRK 583
            G I ++G    K+  +S  R +G  QQ+ + L + ++R+++ +       K     E RK
Sbjct: 908  GDIFVNG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRK 963

Query: 584  VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEATSAL 642
              ++      +   P+  D  +G +G  L+  Q++R+ I   L+ KP +L+ LDE TS L
Sbjct: 964  YVEEVI--KILEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGL 1020

Query: 643  DVESEGAINYTFGQLMKTKS---MTIVSIAHRLSTIRRSE--NVIVLGNDGSVIEMGKFK 697
            D ++  +I     QLMK  S     I+   H+ S +   E   ++ L   G  +  G+  
Sbjct: 1021 DSQTAWSI----CQLMKKLSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELG 1076

Query: 698  E 698
            E
Sbjct: 1077 E 1077

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 115/237 (48%), Gaps = 12/237 (5%)

Query: 466  LPGKGEIEFKNVSFSY-PTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYY 524
            L   G   ++NVSF+   +  Q ++  N++    PG+   ++G SG GK+T+   L    
Sbjct: 769  LESTGVFIWRNVSFTIRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRN 828

Query: 525  NPT-SGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSG-SIRDNITYGLTYTPTKEEIR 582
              T +G IL+DG  +      S  R+ G VQQ+ +  +  ++R+++ +        + I 
Sbjct: 829  VGTVTGDILVDGLPM----DASFERRTGYVQQQDLHTAELTVRESLQFS-ARMRRPQSIP 883

Query: 583  KVAKQCFCHNFIT--KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILI-LDEAT 639
             V K  +    I   +     +  +G  G  L+  Q+++++I   L+ KP++L+ LDE T
Sbjct: 884  DVEKMEYVEKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPT 943

Query: 640  SALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTI-RRSENVIVLGNDGSVIEMGK 695
            S LD +S  +I     +L +     + +I    +T+  + E +++LG  G  +  G+
Sbjct: 944  SGLDSQSAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE 1000

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 99/222 (44%), Gaps = 22/222 (9%)

Query: 488 QIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLL----HYYNPTSGQILIDGQDITKMNS 543
           +I K+++   +PG  V ++G  G G S++          +    +G I  DG    +M  
Sbjct: 91  KILKDVSLLAKPGEMVLVLGRPGAGCSSLLKCAAGETNQFAGDLTGDISYDGISQKEMMQ 150

Query: 544 KSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKV-------AKQCFCHNFITK 596
                 +   +Q+      +++  + + +      + +  V       A + F +  I  
Sbjct: 151 HYKADVIYNGEQDVHFPYLTVKQTLDFAIACKMPAKRVNNVTGAEYIAANRDF-YAQIFG 209

Query: 597 FPHTYDTQIGP---SGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 653
             HTYDT++G    SG  +SGG+++R++IA AL  + +I   D AT  LD  +       
Sbjct: 210 LAHTYDTRVGNDFVSG--VSGGERKRVSIAEALAARGSIYCWDNATRGLDASTA----LE 263

Query: 654 FGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGK 695
           F Q ++T +  + S A  ++  + SEN+    +  +V+  G+
Sbjct: 264 FAQAIRTMTELLGSTA-LITIYQASENIYETFDKVTVLYAGR 304

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}
           PD