Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021906.10ON64559526800.0
TPHA0M002006.10ON63459320930.0
NDAI0I027506.10ON66361320930.0
Kpol_1045.776.10ON65060320230.0
CAGL0A01067g6.10ON64159720180.0
KAFR0B065006.10ON63659620040.0
TBLA0G011106.10ON63859319780.0
SAKL0E00880g6.10ON63659319770.0
ZYRO0F00484g6.10ON64359519510.0
Kwal_56.223506.10ON65859519300.0
TDEL0G046106.10ON63359619250.0
ACR016W6.10ON64059919230.0
KLTH0C11528g6.10ON64259618770.0
KLLA0D00836g6.10ON64059418690.0
KNAG0E027806.10ON65060017300.0
YPL263C (KEL3)6.10ON65160615030.0
Suva_16.426.10ON65460815010.0
Skud_16.146.10ON65260814990.0
Smik_6.4716.10ON65160514660.0
Kpol_1050.695.88ON10842581762e-12
ZYRO0B08228g5.88ON12932571637e-11
Skud_8.2225.88ON11692511602e-10
Suva_15.3575.88ON11722531592e-10
Smik_8.2425.88ON11682511574e-10
YHR158C (KEL1)5.88ON11642511565e-10
SAKL0H02618g5.88ON10852651512e-09
NCAS0F005205.88ON10862571502e-09
KNAG0K005605.88ON11042611494e-09
Kwal_14.10195.88ON9782661476e-09
TPHA0H010805.88ON8282741476e-09
TDEL0G011205.88ON10092601451e-08
CAGL0I02090g5.88ON11363011423e-08
KAFR0B043205.88ON9862571413e-08
KLTH0C01474g5.88ON10562701386e-08
KLLA0E15511g5.88ON9052491361e-07
NDAI0D026005.88ON11672561352e-07
Smik_16.685.88ON8942431306e-07
TPHA0A051705.88ON10163051299e-07
Ecym_20615.88ON13622571217e-06
Suva_7.5305.88ON8942421201e-05
Kpol_1010.625.88ON9732621191e-05
CAGL0F07997g5.88ON9362571172e-05
TBLA0C065305.88ON11721781163e-05
YGR238C (KEL2)5.88ON8822571145e-05
Skud_7.5725.88ON8832571111e-04
ADL149W5.88ON12112551065e-04
KAFR0I029103.15ON691142890.039
ZYRO0C03344g3.15ON658128890.046
Kwal_55.207568.157ON157551810.47
NCAS0B044608.157ON1552167761.8
Kpol_1014.253.15ON62986752.2
TBLA0A043207.9ON83899716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02190
         (645 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...  1036   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   810   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   810   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   783   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   781   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   776   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   766   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   766   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   756   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   748   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   746   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   745   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   727   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   724   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   671   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   583   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   582   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   582   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   569   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    72   2e-12
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    67   7e-11
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    66   2e-10
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    66   2e-10
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    65   4e-10
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    65   5e-10
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    63   2e-09
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    62   2e-09
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    62   4e-09
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    61   6e-09
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    61   6e-09
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    60   1e-08
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    59   3e-08
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    59   3e-08
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    58   6e-08
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    57   1e-07
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    57   2e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    55   6e-07
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    54   9e-07
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    51   7e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    51   1e-05
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    50   1e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   2e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    49   3e-05
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    49   5e-05
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    47   1e-04
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    45   5e-04
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    39   0.039
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    39   0.046
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    36   0.47 
NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8....    34   1.8  
Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {O...    33   2.2  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    32   6.6  

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score = 1036 bits (2680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/595 (85%), Positives = 507/595 (85%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230
           WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 351 NVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXX 410
           NVESNRWFSLSLRKAQ                    LQDLLNQILEKNNLK         
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIS 410

Query: 411 XXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470
                            NKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE
Sbjct: 411 TGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470

Query: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXX 530
           KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIG                        
Sbjct: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIED 530

Query: 531 KKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK 590
           KKLVA                  IPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK
Sbjct: 531 KKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK 590

Query: 591 HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
           HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR
Sbjct: 591 HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/593 (65%), Positives = 445/593 (75%), Gaps = 10/593 (1%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           VLANFK +QEQFE +NVES+ KP +R+NSCMI  PNH KKELL+FGGE T+ E  +THFY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L T++PDN  W+KITSQNSPMPRSSAAM AHPSGIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231
           LLD  T+EWTK++   GP  RSGHRIT+WKNYFIL GGF+DLG +TSY ND W FDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS 291
           KW+QIEFPPNHP+PDARSGHS IPT+EG +LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 292 DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYN 351
           D S VRWERRKKQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+SIFYNDLFSY 
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 352 VESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXX 411
           +ESNRW++L LR  +                    LQ++LN+ILEK NLK          
Sbjct: 352 IESNRWYALQLRSQR---KKVVRLNNKSSKEKELELQNILNEILEKANLKDDDEDANELS 408

Query: 412 XXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEK 471
                           +K+     +  V +QLPH RFNA+TTVVDD+LFIYGG+WE+GEK
Sbjct: 409 NGLGSDSDSDDESEKVSKK-----EYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEK 463

Query: 472 DYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXXK 531
           DY+IDS+YSIDLNKLDGV+ YWE+L +IEKAKE+G                        +
Sbjct: 464 DYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQ 523

Query: 532 KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591
           KLVA                  IPD RPWLPHPK FESLR FY+R GA+FLEWAISNNKH
Sbjct: 524 KLVA--EEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKH 581

Query: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
            RGKHLK KSF+LC+DRWWERRDQVRIEEDKLEELG VG VIEKDT+  T +R
Sbjct: 582 TRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/613 (65%), Positives = 453/613 (73%), Gaps = 21/613 (3%)

Query: 52  VLANFKLQQEQFEHVNVESISKP-----AQRLNSCMITTP---NHSKKELLIFGGEFTNP 103
           VLANFK++QE+FE +NVE + +      + R NS MIT     N   KELL+FGGE+T+P
Sbjct: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112

Query: 104 ETSMTHFYNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNT 163
           ET MTHFYN+L++Y+PD  QWRKITSQNSPMPRSSAAMC HPSGIA+LHGGEFSSPKQNT
Sbjct: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172

Query: 164 FYHYSDTWLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFND 222
           FYHYSDTW+LDT TKEWTK+D  K P  RSGHRI  WKNYF+L GGFKD+G++ T+YFND
Sbjct: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232

Query: 223 CWCFDITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKA--GKGLQKGKI 280
            WCFDI  YKW Q+EFP NHP+PD RSGHSWIP EEGCILWGGY KVK+    G QKGKI
Sbjct: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKI 292

Query: 281 LNDCWYLKMKSDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
           LNDCWYLKMKSDLS +RWERRKK GFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLE
Sbjct: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352

Query: 341 SIFYNDLFSYNVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNL 400
           S+FYNDLFSYNVE+NRWF+L+LRK Q                    LQDLLNQILEKNNL
Sbjct: 353 SLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNL 412

Query: 401 KXXXXXXXXXXXXXXXXXXXXXXXXXXNKEHS-----KSAQVTVMSQLPHPRFNAATTVV 455
           K                          + E +     ++  VT+M+QLPHPR+N A TVV
Sbjct: 413 KDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVV 472

Query: 456 DDSLFIYGGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXX 515
           DD LFIYGG WE+GEKDY I+S YSIDLN++DGV+CYWEDL+EIEKAKE+G         
Sbjct: 473 DDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDD 532

Query: 516 XXXXXXXXXXXXX---XXKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRA 572
                             +KLVA                  IPDLRPWLPHPKPFESLRA
Sbjct: 533 EDDEEDDDEDDDEEEIKDQKLVA--DDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRA 590

Query: 573 FYIREGAAFLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNV 632
           FYIREG AFLEWAISNNKHVRGKHLKKKSF+LCEDRWWERRDQ+RIEEDKLEELGVVG+V
Sbjct: 591 FYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDV 650

Query: 633 IEKDTSVPTSKRR 645
           IEKDTS   SKRR
Sbjct: 651 IEKDTSKGASKRR 663

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/603 (62%), Positives = 436/603 (72%), Gaps = 13/603 (2%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           VLANFK +QE FE +N+ES+ +P++R+N CMI  PNH K EL++FGGE TN +TS T F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L +Y+P+N QWR+ TS+NSPMPRSSAAM AHPSG+AL+HGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231
           LLD  TKEWTK++   GP  RSGHRI+IWKNYF+L GGF+DLG ST+Y NDCW FDIT Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS 291
           KWKQIEFPPNHPIPDARSGHS+IPT+EG +LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 292 DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYN 351
           D + +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S+FYNDLFSY 
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 352 VESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXX 411
           +E NRWF+L LR  +                    LQDLLNQILEK NL           
Sbjct: 351 IEINRWFALQLRPQR---KKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDE 407

Query: 412 XXXXXXXXXXXXXXXXN-------KEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGG 464
                           +       ++  +  +  V++QLPHPRFNA  TVV+D+LFIYGG
Sbjct: 408 DAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGG 467

Query: 465 IWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXX 524
           +WE+GEKDY IDS YSIDLN+ DGV+  WEDL EIE AKE G                  
Sbjct: 468 VWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDED 527

Query: 525 XXXX--XXKKLVA-XXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAF 581
                   +KLVA                   IPD  PWLPHPKPFESLR FY+R GA F
Sbjct: 528 DGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATF 587

Query: 582 LEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPT 641
           LEWAISNN+  RGKHLKKKSFDLC+DRWW+RRDQVRIEEDK+EELG +G VIEKDTS  T
Sbjct: 588 LEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKST 647

Query: 642 SKR 644
            +R
Sbjct: 648 KRR 650

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/597 (63%), Positives = 446/597 (74%), Gaps = 7/597 (1%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPN--HSKKELLIFGGEFTNPETSMTH 109
           VLANFK +QEQFE V V+S+ K  +RLN CM+  P+   SKKEL++FGGEFTNP+TS T 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 110 FYNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSD 169
           FYN+L T++P+N QW++ TSQN+PMPRSSAAM AHPSGIALLHGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 170 TWLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDIT 229
           TW+LD +TKEW K+D+  GP  RSGHRIT+WKN+FIL GGF+DLG ST+Y +DCW FDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 230 TYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAG-KGLQKGKILNDCWYLK 288
           TYKWKQ+EFP NH +PDARSGHS+IPT EG ILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 289 MKSDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLF 348
           MKSD+S +RWERR+KQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLES F+NDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 349 SYNVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXX 408
           SY++ESNRW+SLS+R  +                    L+ LL+ ILEK NL+       
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 409 XXXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEM 468
                               +    + Q T+++QLPHPRFNA TTV+DD+LFI+GGIWE+
Sbjct: 409 DDEEINTALAKVDLEDEEEEQ---LAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWEL 465

Query: 469 GEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXX 528
           G+K++ IDSLYSIDLNKLDGV+ YWEDL+EIE+AKE+G                      
Sbjct: 466 GDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEED 525

Query: 529 XXKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN 588
             +K                      PD RPWLPHPKPFE+LRAFYIREGAAFLEWAISN
Sbjct: 526 DNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISN 585

Query: 589 NKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
           NK+ +GKHLKK SFDLC++RWWERRDQ+RIEEDKLEE+G VG++IE+D S  +SKRR
Sbjct: 586 NKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSA-SSKRR 641

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/596 (62%), Positives = 437/596 (73%), Gaps = 10/596 (1%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           ++L NFK +QE +E +N+ES+ KP+ R N  +I++   +KKELL+FGGE T+ E   T F
Sbjct: 50  EILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTTKF 107

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YN+L T+SPDN QW++ITSQNSPMPRSSAAM AHPSGIALL+GGEFSSPKQ+TFYHYSDT
Sbjct: 108 YNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDT 167

Query: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230
           W+LD  TKEWTK++    P GRSGHRIT WKNYFIL GGFKDLGHST+Y+ND W FDITT
Sbjct: 168 WILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITT 227

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           YKWKQ+EFP NH +PDARSGHS IPT EGCI++GGYCK+KA KGLQKGK+L+ CW LKMK
Sbjct: 228 YKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMK 287

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           +D+  +RWERR+KQGFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLESIFYNDLF+Y
Sbjct: 288 ADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTY 347

Query: 351 NVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXX 410
           N+ESNRWF+++L+K                      LQDLLNQILEKNNLK         
Sbjct: 348 NIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLK-------PD 400

Query: 411 XXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470
                            ++E      +  ++QLPHPRFNA TTV+DD L+IYGG WE GE
Sbjct: 401 DEEEEESSDIFGSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGE 460

Query: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXX-XXXXXXXXXXXXXXXXXXXXX 529
            DY+IDS YSIDLNKLDGV+ YWEDL EIE AKE+G                        
Sbjct: 461 IDYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEEVE 520

Query: 530 XKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589
             KL+A                  IPD RPWLPHPK FESLRAFY+REG AFLEWAISNN
Sbjct: 521 DTKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNN 580

Query: 590 KHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
           +H RGK LK+KSF+LC+DRWWERRDQ+ IEEDKLEE+GVVG+V+E+DTS   SKRR
Sbjct: 581 RHTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/593 (60%), Positives = 433/593 (73%), Gaps = 6/593 (1%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           +L NFK QQEQFE +N+E++SKP +R+NSCMI+ P H K EL++FGGE T   ++ T FY
Sbjct: 52  ILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENT---STTTTFY 108

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L TY+P+N QW+K TSQNSPMPRSS+AM +HP+GIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 109 NDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTW 168

Query: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231
           LLD  TKEW+K+++  GP  RSGHR+T+WKN+ IL GGF+DLG ST+Y  D W FD+T Y
Sbjct: 169 LLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKY 228

Query: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS 291
           KW Q+EFPPNH IPDARSGHS IPT++G +LWGGYCKVKAGKGLQKGKIL+DCWYLKMKS
Sbjct: 229 KWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKS 288

Query: 292 DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYN 351
           D+S +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESL+S+FYNDLF+Y 
Sbjct: 289 DVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQ 348

Query: 352 VESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXX 411
           +E NRWFSLS+R  +                    LQD+LN IL+KNNL           
Sbjct: 349 IEINRWFSLSMRSQR---KKTIKIGPKTTKDKEKELQDILNSILKKNNLTDDDSEDPNAI 405

Query: 412 XXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEK 471
                           +K+   + Q  VM+QLPH RFNA T VV+D+L+I+GG WE+GEK
Sbjct: 406 EEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEK 465

Query: 472 DYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXXK 531
           DY+IDS YSIDLNKLDGV+ YWED++EIE AKE+G                         
Sbjct: 466 DYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEIVD 525

Query: 532 KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591
           + +                   IPD RPWLPHPKPFE+LRAFY+R GA FLEWAISNN+ 
Sbjct: 526 QKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRD 585

Query: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
            +GKHLKKKSF+L EDRWWERRDQVRIEEDK+EELG + N++E+DT+    +R
Sbjct: 586 SKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/593 (61%), Positives = 432/593 (72%), Gaps = 9/593 (1%)

Query: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112
           LANFK +QE+FE V V ++ +P +R+NS M+  P H K+ELL+FGGE TN   S T FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 113 ELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172
           +L TYS D  QWRKI+SQNSPMPRSSAA+ AHPSG+ L+HGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 173 LDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYK 232
           LD +TKEWTK++   GP  RSGHR+T+WKNYFIL GGF+DLG  T+Y +DCW FDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 233 WKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSD 292
           WKQ++FPPNHPIPDARSGHS +PT +G +LWGGYCKVKAGKGLQKGKIL DCWYLKMKSD
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 293 LSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNV 352
           +  +RWERRKKQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESLES+FYNDLF++ +
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 353 ESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXXX 412
           E+NRW+S SLR  +                    L+D+LNQILEK NL            
Sbjct: 352 ETNRWYSASLRPQR----KAAKATSKNNRNKDKELEDILNQILEKANLN--DDENEKETI 405

Query: 413 XXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKD 472
                           + +S+  +  +  QLPHPRFNA+T VVDD+LFI+GG+WE+GEKD
Sbjct: 406 GDVLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKD 465

Query: 473 YAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXX-XXK 531
           Y+IDS Y+IDLN+LDG+  YWEDL++IE AKE+G                         +
Sbjct: 466 YSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQ 525

Query: 532 KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591
           KLVA                  IPD RPWLPHPKPFE+LR FY+R GA FLEWAIS+N+ 
Sbjct: 526 KLVA--EDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRD 583

Query: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
            RGKHLKKKSFDLC+DRWWERRDQVRIEEDKLEELG +G V+EKDTS    +R
Sbjct: 584 ARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/595 (60%), Positives = 429/595 (72%), Gaps = 6/595 (1%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           VLA+FK +QEQFE V VES+ KP+ R+N C+++ P H KKEL++FGGE+TN   S THFY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           NEL T++PDN QWRKI+SQN+PMPRSSAAM AHPSGIALLHGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231
           LLD  TKEWTK+D   GP  RSGHR+T+WKN+FI+ GGF+DLG ST+Y NDCW FDITT+
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS 291
           KW Q+EFP NH IPDARSGHS+IP +EG ILWGGYCKVKAGKGLQKGKIL DCWYLKM S
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 292 DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYN 351
             S +RWERRKKQGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESL+S FYNDLF++ 
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 352 VESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXX 411
           +++NRW+SLSLR  +                    LQD LN+IL++  L           
Sbjct: 353 IKTNRWYSLSLRPQR---KKQVKISKSSTKDQEKELQDHLNRILQQAQL-YDQDEDKEDD 408

Query: 412 XXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEK 471
                           ++E S   Q T+ +QLPHPRFN +  VV+D+LFIYGG+WE+G+K
Sbjct: 409 KAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDK 468

Query: 472 DYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXX--XXXXXXXXXXXXXXXXXXX 529
           DY IDS Y IDLNK+DGV+ YWE+L EIEKAK++                          
Sbjct: 469 DYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEV 528

Query: 530 XKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589
             +++                   IPD RPWLPHPK FESLRAFY+R G  FLEWAISNN
Sbjct: 529 RDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNN 588

Query: 590 KHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
           +  RGKHLK+KSFDLC+DRWWERRDQVRIEEDK+EELG VG+++E++ +  T +R
Sbjct: 589 RDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/595 (62%), Positives = 428/595 (71%), Gaps = 12/595 (2%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           +VLANFK +QE F+ V V  + +P+QR+NSCM+  P H K+ELLIFGGE TN   S+T F
Sbjct: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YNEL TYS D+ QWRKITS+NSPMPRSSAA  AH SG+AL+HGGEFSSPKQNTFYHYSDT
Sbjct: 136 YNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDT 195

Query: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230
           WLLD  TKEWTKM+   GP  RSGHR+TIWKN+FIL GGF+DLG ST+Y ND W FDITT
Sbjct: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           YKWKQ+EFPPNHPIPDARSGHS IPT++G +LWGGYCKVKAGKGLQKGK L DCWYLKMK
Sbjct: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           SD+S +RWERRKKQGFQPSPRVGCSM +HKGRG+LFGGVYDFEETEE L S F+NDLFSY
Sbjct: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375

Query: 351 NVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXX 410
            VE+NRW+S+ +R  +                    L+++LN IL++ NL          
Sbjct: 376 QVEANRWYSVKMRPQK----KKTVAISRNNRNKDEELENILNDILQQANLADDTDDDDNE 431

Query: 411 XXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470
                             K      Q  V+ QLPHPRFNA T VVDD LFI+GG+WE GE
Sbjct: 432 IKRELQRIDEEEALENSRK------QYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGE 485

Query: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXX 530
           +D++IDS YSIDLNKLDGV  YWE+L E+EKAK +G                        
Sbjct: 486 RDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEETAD 545

Query: 531 KKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNK 590
           +KLVA                  IPDLRPWLPHPKPFE+LRAFYIR GA FL+WAISNN+
Sbjct: 546 QKLVA-EDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNR 604

Query: 591 HVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
             +GKHLKK+SFDLC+DRWWERR+Q+RIEEDKLEELG V NV+E+D +  T KRR
Sbjct: 605 DAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPA-QTMKRR 658

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/596 (60%), Positives = 423/596 (70%), Gaps = 14/596 (2%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           QVLANFK +QEQFE V VE+I +P++R+N  MI  P H K EL++FGGE T   TS THF
Sbjct: 51  QVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHF 110

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           +N+L+ +SPDN QW++I+SQNSPMPRSSAAM  HPSG+ALLHGGEFSSPKQNTFYHYSDT
Sbjct: 111 FNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDT 170

Query: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230
           WLLD  TKEWTK++   GP  RSGHR+ +WKN+ IL GGF+DLG ST+Y NDCW FDITT
Sbjct: 171 WLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITT 230

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           YKWKQ+EFP NHP+PDARSGHS I  +EG ILWGGYCKVKAGKGLQKGKIL DCWYLKM 
Sbjct: 231 YKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMS 290

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           S+ S +RW+R+K+QGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESLES FYND+F+Y
Sbjct: 291 SNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTY 350

Query: 351 NVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXX-XXXXXX 409
            +  NRW+SLSLR  +                    L+DLLN+IL    L          
Sbjct: 351 QINMNRWYSLSLRPQR---KKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEID 407

Query: 410 XXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMG 469
                             +KEH       +M++LPHPRFNAAT VVDD+LFI+GG+WE G
Sbjct: 408 AAEESTAVEEDSDESESLDKEH------VIMNELPHPRFNAATAVVDDTLFIFGGVWEFG 461

Query: 470 EKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXX 529
           EKDY+IDS Y IDLNK DGV+ YWEDL  +E AK+                         
Sbjct: 462 EKDYSIDSFYGIDLNKADGVTVYWEDLTALENAKDE-DDSDEDEGEEDDDDEEDSEEEQV 520

Query: 530 XKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589
            +KLVA                  IPD RPWLPHPK FESLR+FY+R GA FLEWAISNN
Sbjct: 521 DQKLVA--EDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNN 578

Query: 590 KHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
           +HV+GKHLK KSF++CE RWWERRDQVR+EEDKLEELG VG +IE+DT+  T KRR
Sbjct: 579 RHVKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTT-KTKKRR 633

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/599 (59%), Positives = 428/599 (71%), Gaps = 13/599 (2%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           +VLANFK QQ +FE VNVE++ +P QR +S ++  P H+K+EL++FGGE+TN  T MTHF
Sbjct: 50  EVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHF 109

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YN+L  YS D  QW+K TSQNSPMPRSSAA+ AHPSG+ L+HGGEFSSPKQNTFYHYSDT
Sbjct: 110 YNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169

Query: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230
           WL D  T EWTK++   GP  RSGHR+T+WKNY IL GGF+DLG ST+Y NDCW FDITT
Sbjct: 170 WLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITT 229

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           YKW+Q++FP NHPIPDARSGHS +PT EG ILWGGYCKVKAGKGLQKGKIL DCWYLKMK
Sbjct: 230 YKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMK 289

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           SD++ +RWERRKKQGFQPS R GCSM +HKGRGILFGGVYD+EETEE L+S+FYNDLF+Y
Sbjct: 290 SDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTY 349

Query: 351 NVESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXX 410
           ++E+NRW+S+SLR  +                    L+D+LN IL+K NL          
Sbjct: 350 HIETNRWYSVSLRAQR---HSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGK 406

Query: 411 XXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470
                              E +K +   VM +LPHPRFNA+T +VDD+LFI+GG+WE GE
Sbjct: 407 TIEEELNKLENDGITET--EETKKSYPIVM-KLPHPRFNASTAIVDDTLFIFGGVWEQGE 463

Query: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXX-X 529
           KDY IDS YSID+NK+DGV  YWED+  +E+AKE+G                        
Sbjct: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHS 523

Query: 530 XKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589
            +KLVA                  IPD RPWLPHPK FESLRAFY+R GA+FLEWAI+N 
Sbjct: 524 DRKLVA--EEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNK 581

Query: 590 KHVR----GKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
            + R    GKHLKK SFDLC++RWWERR+QVRIEEDKLEELG VG VIEKD + PT +R
Sbjct: 582 HNTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/596 (58%), Positives = 419/596 (70%), Gaps = 13/596 (2%)

Query: 55  NFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNEL 114
           NF+ +QE F+ V V  + +P+ R N CM+  P+H K+ELLIFGGE+TN  +S T FYNEL
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 115 ITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174
            TYS D  QW+KITS+N+PMPRSSAA   HPSG+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 175 THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWK 234
             +KEWTK+D   GP  RSGHR+T+WKN+F++ GGF+DLG ST+Y NDCW FDITTYKWK
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 235 QIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLS 294
           Q+EFPPNHP+PDARSGHS IPT+EG I+WGGYCK+KA KGLQKGKIL DCWYL+MKSD++
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 295 QVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVES 354
            +RWERRKKQGFQPSPRVGCSMA+HKGRGILFGGVYD+EETEE L S F+NDL SY VE+
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 355 NRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXXXXX 414
           NRW+S+ +R  +                    L  +LN IL+K NL              
Sbjct: 354 NRWYSIKMRPQK----KKIVAASKSAKSKDDELVGILNDILQKANLADEENEENESDSEI 409

Query: 415 XXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYA 474
                          +     Q  V++QLPH RFNAATTVVDD+LFI+GG WE GE+D++
Sbjct: 410 EKELHRLDEEELLGHQQK---QYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFS 466

Query: 475 IDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXXKKLV 534
           IDS YSIDLN+ DGV  +WEDL+EIEKAK+ G                        ++L+
Sbjct: 467 IDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELI 526

Query: 535 AXXXXXXXXXXXXXXXXX------XIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN 588
           A                        IPD RPWLPHPK FE+LRAFYIR GA FL+WAISN
Sbjct: 527 AEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISN 586

Query: 589 NKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644
           N+  +GKHLKK+SFDL +DRWWERR+QVRIEEDKLEE+G V N+IE+D+S  T +R
Sbjct: 587 NRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/594 (58%), Positives = 417/594 (70%), Gaps = 5/594 (0%)

Query: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112
           LANFK +QE FE +NVE++ +P QR+N CM   P H K+EL++FGGE T  ET  THFYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 113 ELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172
           +L  YS D   W++ TSQNSPMPRSSAA+ +HP+G+AL+HGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 173 LDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYK 232
            D  +KEWTK++   GP  RSGHR+ IWKN+ IL GGF+DLG ST+Y ND W FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 233 WKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSD 292
           WKQ+E P NHPIPDARSGHS I T EG +L+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 293 LSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNV 352
           L  +RWERRKKQG QPSPRVGCSM +HKGRG+LFGGVYDFEETEESL SIFYN+L++Y +
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 353 ESNRWFSLSLRKAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXXXXXXXX 412
           E+NRW+++SLR  +                    L+D+LNQIL+K NL+           
Sbjct: 351 ENNRWYAMSLRPQR---KKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVI 407

Query: 413 XXXXXXXXXXXXXXXNKEHSKSAQ-VTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEK 471
                          ++   KSA+    MS LPH RFNAAT VVDD+LFI+GG  E+GEK
Sbjct: 408 EEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEK 467

Query: 472 DYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXXXXXXK 531
           DY IDS YSID+NKLDGV  YWE+L+E+E+A+++G                         
Sbjct: 468 DYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVD 527

Query: 532 KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKH 591
             +                   IPDLRPWLPHPK FE+LRAFY+R G  FLE AIS+N+ 
Sbjct: 528 SKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRD 587

Query: 592 VRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
            +GKHLK KSF+LC+DRWWERR+QVRIEEDKLEELG V +VIEKDTS  T +RR
Sbjct: 588 SKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTS-KTQRRR 640

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/600 (55%), Positives = 402/600 (67%), Gaps = 9/600 (1%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           +L NFKL+QEQFE V VE +  P  R N+C++T  N SK ELL+FGGE TN ET+MT FY
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVT--NASKPELLLFGGERTNNETNMTKFY 110

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L  Y+P N QW+K TSQNSPMPRSSAAMC+H SG+ +L GGEFSSPKQNTFYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 172 LLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTY 231
           LLD  T+EW+K+D   GP  RSGHRIT WKNYFIL GGFKDL   TSYFND W F++  +
Sbjct: 171 LLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230

Query: 232 KWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKA--GKGLQKGKILNDCWYLKM 289
           KW + E   N   PD RSGHSWI + EG I++GGYCKVKA   K L KGK L DCW LKM
Sbjct: 231 KWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289

Query: 290 KSDLSQVRWERRKKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFEETEESLESIFYNDLF 348
             ++++++WERR K+G QPSPRVGCSMA H+  RGILFGGVYD EETEE L SI+YNDL+
Sbjct: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349

Query: 349 SYNVESNRWFSLSLRKA--QXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLKXXXXX 406
           SYN+ESNRW+ L LRK                        LQDLLN+ILE+N+LK     
Sbjct: 350 SYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETN 409

Query: 407 XXXXXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIW 466
                                 +E      +  ++QLPH RFNA TTV++D+ +IYGG+W
Sbjct: 410 SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMW 469

Query: 467 EMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXXXXXX 526
           E  + DY IDS YSIDLNKLDG++ Y+E+LQEIE+ K +G                    
Sbjct: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGE 529

Query: 527 XX-XXKKLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAAFLEWA 585
                ++L A                  IPD RPWLPHPK FESLR FYIREG  FLEWA
Sbjct: 530 AEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWA 589

Query: 586 ISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645
           ISNNKH +GKHLK+KSF+LC+DRWWERRDQ++IEEDKL+ELGV G++IE+D   P + RR
Sbjct: 590 ISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/606 (49%), Positives = 382/606 (63%), Gaps = 18/606 (2%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           ++L++F  +Q + EHV++ S+ KP+ R +  M   P H+K EL IFGGEFT+PET +THF
Sbjct: 53  EILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YN+L +YS  N  W+K  SQN+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 171 WLLDTHTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGH-STSYFNDCWCF 226
           WL D   +++TK++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCF
Sbjct: 173 WLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCF 232

Query: 227 DITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDC 284
           DI+TYKW ++E    +  PDARSGH +IPT+   IL GGYCK+  K  K L KGKILND 
Sbjct: 233 DISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDA 289

Query: 285 WYLKMKSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIF 343
           W L +  D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+F
Sbjct: 290 WKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349

Query: 344 YNDLFSYNVESNRWFSLSLR--KAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLK 401
           YNDL+ +++E N+W  L ++  +                      LQDLLN IL K+NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 402 XXXXXXXXXXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFI 461
                                     +   ++   +T+ +QLPHPRFNAAT VV DSLFI
Sbjct: 410 DDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQE-DITISNQLPHPRFNAATCVVGDSLFI 468

Query: 462 YGGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXX 521
           Y G+WE+GEKDY I+S YSIDLNKLDGV  YWEDL  IE+AK +G               
Sbjct: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDE 528

Query: 522 XXXXXXXXXKKL--VAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGA 579
                    +    +                   IPD R WLPHPKPFE+LRAFY+REGA
Sbjct: 529 EDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588

Query: 580 AFLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSV 639
            FL W+ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+DT+ 
Sbjct: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDTTT 645

Query: 640 PTSKRR 645
             SKRR
Sbjct: 646 KPSKRR 651

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/608 (48%), Positives = 381/608 (62%), Gaps = 19/608 (3%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           ++L++F  +Q + EHV++ ++ +P+ R++  M   P H+K EL IFGGEFT+PET +THF
Sbjct: 53  EILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YN+L +YS  N  W+K  SQN+P+PRSS A+  H SGIALLHGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 171 WLLDTHTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGH-STSYFNDCWCF 226
           WL D H K++TK++       P  RSGHRI  WKNYFIL GGF+DLG   TSY ND WCF
Sbjct: 173 WLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCF 232

Query: 227 DITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCK--VKAGKGLQKGKILNDC 284
           DI+ YKW ++E    +  PDARSGH ++PT+   IL GGYCK   K  K L KGKILND 
Sbjct: 233 DISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS 289

Query: 285 WYLKMKSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIF 343
           W L +  D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESL+SIF
Sbjct: 290 WKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349

Query: 344 YNDLFSYNVESNRWFSLSLR--KAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLK 401
           YNDL+ +++E N+W  L ++  +                      LQDLLN IL K+NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 402 XXXXXXXXXXXXXXXXXXXXXXXXXXNKEHSKSAQ-VTVMSQLPHPRFNAATTVVDDSLF 460
                                     +    ++ + +T+ +QLPHPRFNAAT VVDDSLF
Sbjct: 410 DEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLF 469

Query: 461 IYGGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXX 520
           IY G+WE+GEKDY I+S YSIDLNKLDGV  YWEDL  +E+AK +G              
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 521 XXXXXXXXXXK---KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIRE 577
                         +L+                   IPD R WLPHPKPFE+LRAFY+RE
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 578 GAAFLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDT 637
           GA FL W+ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+D 
Sbjct: 590 GANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDA 646

Query: 638 SVPTSKRR 645
           +   SKRR
Sbjct: 647 TAKPSKRR 654

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/608 (48%), Positives = 386/608 (63%), Gaps = 21/608 (3%)

Query: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110
           ++L++F  +Q + EHV++ ++ + + R +  M   P H+K+EL IFGGEFT+PET +THF
Sbjct: 53  EILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHF 112

Query: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170
           YN+L +YS  N  W+K  S+N+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 171 WLLDTHTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGH-STSYFNDCWCF 226
           WL D   +++TK++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCF
Sbjct: 173 WLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCF 232

Query: 227 DITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKV--KAGKGLQKGKILNDC 284
           DI+ YKW ++E    +  P+ARSGH +IPT+   IL GGYCK+  K  K L KGKILND 
Sbjct: 233 DISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDA 289

Query: 285 WYLKMKSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIF 343
           W L +  D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+F
Sbjct: 290 WKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVF 349

Query: 344 YNDLFSYNVESNRWFSLSLR--KAQXXXXXXXXXXXXXXXXXXXXLQDLLNQILEKNNLK 401
           YNDL+ +++E N+W  L ++  +                      LQDLLN IL K+NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 402 XXXXXXXXXXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFI 461
                                     + ++ ++  +T+ +QLPHPRFNAAT VVDDSLFI
Sbjct: 410 DDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPEN--ITISNQLPHPRFNAATCVVDDSLFI 467

Query: 462 YGGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXX 521
           Y G+WE+GEKDY I+S YSIDLNKLDGV+ YWEDL  IE+AK +G               
Sbjct: 468 YSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDD 527

Query: 522 XXXXXXXXXK----KLVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIRE 577
                    +     L+                   IPD R WLPHPKPFE+LRAFY+RE
Sbjct: 528 DDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLRE 587

Query: 578 GAAFLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDT 637
           GA FL W+ISNNK ++GKHLK KSF++CEDRWWERRDQV +EE++LE+    G +IE+DT
Sbjct: 588 GANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLED---TGGIIERDT 644

Query: 638 SVPTSKRR 645
           +   SKRR
Sbjct: 645 TTKISKRR 652

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/605 (48%), Positives = 377/605 (62%), Gaps = 18/605 (2%)

Query: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFY 111
           +L++F  +Q + EHV++ ++ +P+ R +  M   P H+K EL IFGGEFT+ ET +THFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 112 NELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           N+L +YS  N  W+K  SQN+P+PRSSAA+  HPSGIALLHGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 172 LLDTHTKEWTKMDSA---KGPPGRSGHRITIWKNYFILSGGFKDLGHS-TSYFNDCWCFD 227
           L D   +++ K++       P  RSGHRI  WKNYFIL GGF+DLG+  TSY ND WCFD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 228 ITTYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCK--VKAGKGLQKGKILNDCW 285
           I+ YKW +IE    +  PDARSGH +IPT+   IL GGYCK   K  K L KGKILND W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 286 YLKMKSDLSQVRWERRKKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESIFY 344
            L +  D  + +WE+ K    QPSPRVG S   + + + + FGGVYD +ETEESLES+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 345 NDLFSYNVESNRWFSLSLRKAQXXXXXX--XXXXXXXXXXXXXXLQDLLNQILEKNNLKX 402
           NDL+ +++E N+W  L ++  +                      LQDLLN IL K+NL  
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 403 XXXXXXXXXXXXXXXXXXXXXXXXXNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIY 462
                                    +   ++   +T+ +QLPHPRFNAAT VV DSLFIY
Sbjct: 411 DDDENDDYTATGSNSIDGDEDEEDDSDLDNQE-DITISNQLPHPRFNAATCVVGDSLFIY 469

Query: 463 GGIWEMGEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGXXXXXXXXXXXXXXXX 522
            G+WE+GEKDY I+S YSIDLNKLDGV  YWE+L  IE+AK +G                
Sbjct: 470 SGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEED 529

Query: 523 XXXXXXXXKK--LVAXXXXXXXXXXXXXXXXXXIPDLRPWLPHPKPFESLRAFYIREGAA 580
                   +   L+                   IPD R WLPHPKPFE+LRAFY+REGA 
Sbjct: 530 DEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589

Query: 581 FLEWAISNNKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVP 640
           FL W+ISNN++++GK LK KSF+LCEDRWWERRDQV +EE++LE+    G +IE+D +  
Sbjct: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLED---TGGIIERDVTTK 646

Query: 641 TSKRR 645
            SKRR
Sbjct: 647 PSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 107/258 (41%), Gaps = 50/258 (19%)

Query: 117 YSPDNGQWRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL 173
           Y+P    W +I  QNSP PR    S+A     + I +L G    S        Y DTW++
Sbjct: 136 YTP----WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWII 184

Query: 174 DTHTKEWTKMDSA------KGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCF 226
             +  + T+  S         PP R GH  T+  N FI+ GG    +       +D + F
Sbjct: 185 SCN-PDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLF 243

Query: 227 DITTYKWKQIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCW 285
           +I +YKW     P P  P P  R GH        CIL     K K       G   +D +
Sbjct: 244 NINSYKWT---IPNPIGPRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTY 291

Query: 286 YLKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESL 339
           +  +   DLS  R     WE  K +GF P P    +M  +     ++GG     +T++ L
Sbjct: 292 FNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL 346

Query: 340 ESIFYNDLFSYNVESNRW 357
                ND+F ++  +N W
Sbjct: 347 ----INDIFKFSPNTNTW 360

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 70/163 (42%), Gaps = 21/163 (12%)

Query: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112
           L++F+ Q   +E +  +    P    N  M+T       +L I+GG+      +     N
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPP-LTNHTMVTY----GSDLWIYGGD------TQQGLIN 348

Query: 113 ELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171
           ++  +SP+   W K+ T+   P P    A   + + + ++ G +     +N  Y  S  +
Sbjct: 349 DIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGKD-----ENDMYLNS-VY 402

Query: 172 LLDTHTKEWTKMDSAKGP--PGRSGHRITIWKN-YFILSGGFK 211
           L +  + +W      K     GRSGH +T+  N   ++ GG K
Sbjct: 403 LFNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGGDK 445

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 107/257 (41%), Gaps = 48/257 (18%)

Query: 117 YSPDNGQWRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL 173
           Y+P    W ++  QNSP PR    +++ C+  + + ++ G    S        Y DTW++
Sbjct: 138 YTP----WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWII 186

Query: 174 DTHT-----KEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFD 227
            T+      +  T   S   PP R GH  T+  N F+L GG     +S     +D + F+
Sbjct: 187 STNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFN 246

Query: 228 ITTYKWKQIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWY 286
           + +YKW     P P  P P  R GH         I+     K K       G   +D ++
Sbjct: 247 VNSYKWT---IPHPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDTYF 294

Query: 287 LKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
             +   DLS  R     WE  K   F P P    +M  +     +FGG        ++L+
Sbjct: 295 NDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG--------DTLQ 346

Query: 341 SIFYNDLFSYNVESNRW 357
            +  N +F Y+V +N W
Sbjct: 347 GLI-NQVFKYDVANNDW 362

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 67/162 (41%), Gaps = 19/162 (11%)

Query: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112
           L++F+     +E +   + S P    N  MI+  NH    L +FGG+      ++    N
Sbjct: 302 LSSFRRPDSHWEFLKPTTFSPPP-LTNHTMISYDNH----LWVFGGD------TLQGLIN 350

Query: 113 ELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL 172
           ++  Y   N  W    +  +  P            + ++ GG     K     + +  + 
Sbjct: 351 QVFKYDVANNDWSIAETTGTKPPPMQEHAAVVYKHVMVVVGG-----KDEHDTYLNSVYF 405

Query: 173 LDTHTKEWTKMDSAKG--PPGRSGHRITIWKN-YFILSGGFK 211
           L+  T EW K+ + K   P GRSGH +T+  N   ++ GG K
Sbjct: 406 LNLKTHEWFKLPTFKAGIPQGRSGHSLTLLNNDKLLIMGGDK 447

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 84/193 (43%), Gaps = 29/193 (15%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYS------PDNGQWRKITSQN-SPMP 135
           I   N  K +L +FGG+F +       ++N+L  +       PD+  W  +     SP P
Sbjct: 272 IMAANQMKTKLYLFGGQFDD------TYFNDLAVFDLSSFRRPDS-HWEFLKPTTFSPPP 324

Query: 136 RSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD-SAKGPPGRSG 194
            ++  M ++ + + +  GG+      N  + Y      D    +W+  + +   PP    
Sbjct: 325 LTNHTMISYDNHLWVF-GGDTLQGLINQVFKY------DVANNDWSIAETTGTKPPPMQE 377

Query: 195 HRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP-NHPIPDARSGHSW 253
           H   ++K+  ++ GG  +  H T Y N  +  ++ T++W   + P     IP  RSGHS 
Sbjct: 378 HAAVVYKHVMVVVGGKDE--HDT-YLNSVYFLNLKTHEW--FKLPTFKAGIPQGRSGHSL 432

Query: 254 -IPTEEGCILWGG 265
            +   +  ++ GG
Sbjct: 433 TLLNNDKLLIMGG 445

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 103/251 (41%), Gaps = 44/251 (17%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL---DTHT 177
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 178 K-EWTKMD-SAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWK 234
           K   T +D S   PP R GH   +  N F++ GG    +       +D +  +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 235 QIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-D 292
               P P  P P  R GH         I+     K K       G   +D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 293 LSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDL 347
           LS  R     WE  K + F P P    +M  +  +  +FGG        ++L+ +  ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG--------DTLQGLI-NDV 324

Query: 348 FSYNVESNRWF 358
           F Y+   N WF
Sbjct: 325 FMYDPAINDWF 335

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 15/121 (12%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L +FGG+      ++    N++  Y P    W  I T+   P P    A   +   + +
Sbjct: 308 KLWVFGGD------TLQGLINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCV 361

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD--SAKGPPGRSGHRITIWKNYFILSG 208
           + G +      N+ Y       L+  + +W K+   +A  P GRSGH +T+ K+  IL  
Sbjct: 362 VGGKDEHDAYLNSVY------FLNLKSHKWFKLPVFTAGIPQGRSGHSLTLLKDDKILIM 415

Query: 209 G 209
           G
Sbjct: 416 G 416

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 104/253 (41%), Gaps = 44/253 (17%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL---DTHT 177
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 178 K-EWTKMD-SAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWK 234
           K   T +D S   PP R GH   +  N F++ GG    +       +D +  ++ +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT 225

Query: 235 QIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-D 292
               P P  P P  R GH         I+     K K       G   +D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 293 LSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDL 347
           LS  R     W+  K   F P P    +M  +  +  +FGG        ++L+ +  ND+
Sbjct: 274 LSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG--------DTLQGLI-NDV 324

Query: 348 FSYNVESNRWFSL 360
           F Y+   N WF++
Sbjct: 325 FMYDPAKNDWFTI 337

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 15/139 (10%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L +FGG+      ++    N++  Y P    W  I TS   P P    A   +   + +
Sbjct: 308 KLWVFGGD------TLQGLINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCV 361

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD--SAKGPPGRSGHRITIWKNYFILSG 208
           + G +      NT Y       L+  T +W K+   +A  P GRSGH +T+ KN  +L  
Sbjct: 362 VGGKDEHDAYLNTVY------FLNLKTHKWFKLPIFAAGIPQGRSGHSLTLLKNDKVLIM 415

Query: 209 GFKDLGHSTSYFNDCWCFD 227
           G     ++ +  +D    D
Sbjct: 416 GGDKFDYARAEESDLHTSD 434

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 71/251 (28%), Positives = 103/251 (41%), Gaps = 44/251 (17%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL---DTHT 177
           W +I  Q+SP PR    S+A     + I ++ G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 178 K-EWTKMD-SAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWK 234
           K   T +D S   PP R GH   +  N F++ GG    +       +D +  +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 235 QIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-D 292
               P P  P P  R GH         I+     K K       G   +D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 293 LSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDL 347
           LS  R     WE  K + F P P    +M  +  +  +FGG        ++L+ +  ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG--------DTLQGLV-NDV 324

Query: 348 FSYNVESNRWF 358
           F Y+   N WF
Sbjct: 325 FMYDPALNDWF 335

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 89/219 (40%), Gaps = 39/219 (17%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYS------PDNGQWRKITSQN-SPMP 135
           I   N  K +L +FGG+F +       ++N+L  Y       PD   W  +  +  SP P
Sbjct: 244 IIATNQMKTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPD-SHWEFLKPKTFSPPP 296

Query: 136 RSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSA-KGPPGRSG 194
            ++  M ++ S + +  G              +D ++ D    +W  +++  + PP    
Sbjct: 297 ITNFTMISYDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQE 349

Query: 195 HRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP-NHPIPDARSGHSW 253
           H   ++ +   + GG KD     +Y N  +  ++ + KW   + P     IP  RSGHS 
Sbjct: 350 HATVVYNDLMCVVGG-KD--EHDAYLNSVYFLNLKSNKW--FKLPVFTAGIPQGRSGHSL 404

Query: 254 IPTEEGCILWGG-----YCKVKAGK------GLQKGKIL 281
              +   IL  G     Y +V+          +QKG I+
Sbjct: 405 TLLKNDKILIMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/251 (27%), Positives = 103/251 (41%), Gaps = 44/251 (17%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL---DTHT 177
           W +I  QNSP PR    ++A     + I ++ G    S        Y DTW+L   D  T
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 178 K-EWTKMD-SAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWK 234
           +   T +D S   PP R GH   +  N F++ GG    +       +D +  +I +YKW 
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 235 QIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-D 292
               P P  P P  R GH         I+     K K       G   +D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 293 LSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDL 347
           LS  R     WE  K + F P P    +M  +  +  +FGG        ++L+ +  ND+
Sbjct: 274 LSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG--------DTLQGLV-NDV 324

Query: 348 FSYNVESNRWF 358
           F Y+   N WF
Sbjct: 325 FMYDPAINDWF 335

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 15/121 (12%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L +FGG+      ++    N++  Y P    W  I T+   P P    A   +   + +
Sbjct: 308 KLWVFGGD------TLQGLVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLMCV 361

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD--SAKGPPGRSGHRITIWKNYFILSG 208
           + G +      N+ Y       L+  +++W K+   +A  P GRSGH +T+ KN  IL  
Sbjct: 362 VGGKDEHDAYLNSVY------FLNLKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIM 415

Query: 209 G 209
           G
Sbjct: 416 G 416

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 101/265 (38%), Gaps = 64/265 (24%)

Query: 117 YSPDNGQWRKITSQNSPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDT 170
           YSP    W +I   +SP PR      A+ S       I  LH              Y DT
Sbjct: 70  YSP----WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV----------YGDT 115

Query: 171 WLLDTHTKEW-----TKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCW 224
           W+L  H         T   S   PP R GH  T+  N F++ GG    + +     +D +
Sbjct: 116 WILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVY 175

Query: 225 CFDITTYKWKQIEFP-PNHPIPDARSGH--SWIPTEE---GCILWGGYCKVKAGKGLQKG 278
            F+I +YKW     P P  P P  R GH  S I T +      ++GG             
Sbjct: 176 LFNINSYKWT---IPHPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQF---------DD 223

Query: 279 KILND-CWYLKMKSDLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
              ND C Y     DLS  R     WE  K Q F P P    +M  +  +  +FGG    
Sbjct: 224 TYFNDLCVY-----DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG---- 274

Query: 333 EETEESLESIFYNDLFSYNVESNRW 357
            +T + L     N++F Y+   N W
Sbjct: 275 -DTAQGL----INEVFMYDPTVNDW 294

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 79/170 (46%), Gaps = 26/170 (15%)

Query: 90  KKELLIFGGEFTNPETSMTHFYNELITYS------PDNGQWRKITSQN-SPMPRSSAAMC 142
           K +L +FGG+F +       ++N+L  Y       PD   W  +  Q+  P P ++  M 
Sbjct: 211 KTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPD-SHWEFLKPQSFVPPPLTNHTMV 263

Query: 143 AHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSA-KGPPGRSGHRITIWK 201
           ++   + +  GG+ +    N  + Y      D    +WT +++    PP    H   ++K
Sbjct: 264 SYDYKLWIF-GGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVVYK 316

Query: 202 NYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGH 251
           +   ++GG KD     SY ND +  ++ ++KW ++ F  N  +P  RSGH
Sbjct: 317 DLMCVTGG-KD--EQDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 105/257 (40%), Gaps = 56/257 (21%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEW 180
           W +I  QNSP PR    ++++ +  + + ++ G    S        Y DTW+L     + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 181 TKMDSAKG-------PPGRSGHRITIWKNYFILSGGFKDLGHSTSYFND-CWCFDITTYK 232
           + M S++        PP R GH  T+  N F++ GG     +     +D  + F+I +YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 233 WKQIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQK-----GKILNDCWY 286
           W     P P  P P  R GH                 + A K +Q      G   +D ++
Sbjct: 244 WT---IPHPIGPRPKGRYGHK--------------ISIIARKQMQTKLYLFGGQFDDNYF 286

Query: 287 LKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
             +   DLS  R     WE  K + F P P    +M  +  +  +FGG        ++LE
Sbjct: 287 NDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--------DTLE 338

Query: 341 SIFYNDLFSYNVESNRW 357
            +  N +F Y+   N W
Sbjct: 339 GLL-NQVFMYDPAVNDW 354

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 26/132 (19%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITS-------QNSPMPRSSAAMCAH 144
           +L +FGG+      ++    N++  Y P    W  + +       +N P P    A   +
Sbjct: 328 KLWVFGGD------TLEGLLNQVFMYDPAVNDWCVVETTCQDDDLENMPPPMQEHATLIY 381

Query: 145 PSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTK----MDSAKGPPGRSGHRITIW 200
             G+  + GG     K    ++ +D + L+  + +W +    MD    P GRSGH +T+ 
Sbjct: 382 -KGLMCIVGG-----KDEQDHYLNDVYFLNLKSLKWFRLPRFMDGI--PQGRSGHSVTLL 433

Query: 201 KN-YFILSGGFK 211
           KN   ++ GG K
Sbjct: 434 KNDKLLIMGGDK 445

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 107/261 (40%), Gaps = 60/261 (22%)

Query: 121 NGQWRKITSQNSPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDTWL-- 172
           N  W +I  ++SP PR      ++ +       I  LH        Q+ F    D W+  
Sbjct: 194 NVVWNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLH-------DQSVF---GDVWIIK 243

Query: 173 -LDTHTK-EWTKMD-SAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDI 228
            L+  TK   T +D +   PP R GH  T+  N F++ GG    +       +D + F+I
Sbjct: 244 SLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNI 303

Query: 229 TTYKWKQIEFP-PNHPIPDARSGH-----SWIPTEEGCILWGGYCKVKAGKGLQKGKILN 282
            +YKW     P P  P P  R GH     +  P +    L+GG                +
Sbjct: 304 NSYKWT---IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FD 346

Query: 283 DCWYLKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETE 336
           D ++  +   DLSQ R     WE  K + F P P    +M  ++ +  +FGG        
Sbjct: 347 DTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG-------- 398

Query: 337 ESLESIFYNDLFSYNVESNRW 357
           ++L+ +  N +F Y+ E N W
Sbjct: 399 DTLQGLI-NKIFMYDPEVNDW 418

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 26/148 (17%)

Query: 74  PAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITS---- 129
           P    N  M++  N    +L IFGG+      ++    N++  Y P+   W  + +    
Sbjct: 378 PPPLTNHTMVSYQN----KLWIFGGD------TLQGLINKIFMYDPEVNDWTVVETFPAN 427

Query: 130 ---QNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD-- 184
              +N P P    A   +   + ++ G +      NT Y       L  +T EW K+   
Sbjct: 428 NDQENFPPPMQEHASVMYGDLMVVMGGKDEQDNYLNTVY------FLKINTLEWYKLPFL 481

Query: 185 SAKGPPGRSGHRITIWK-NYFILSGGFK 211
           S   P GRSGH IT+ K N  ++ GG K
Sbjct: 482 SVGIPQGRSGHSITLLKGNKLLIMGGDK 509

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 105/266 (39%), Gaps = 66/266 (24%)

Query: 117 YSPDNGQWRKITSQNSPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDT 170
           Y+P    WR+I   NSP PR      A+ S       I  LH              Y DT
Sbjct: 73  YTP----WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQSV----------YGDT 118

Query: 171 WLLDTH------TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDC 223
           W++ +H      T +  ++  A  PP R GH  T+  N F++ GG     +S     +D 
Sbjct: 119 WIVTSHENGARFTSKTVEISDATPPP-RVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDV 177

Query: 224 WCFDITTYKWKQIEFP-PNHPIPDARSGH-----SWIPTEEGCILWGGYCKVKAGKGLQK 277
           + F+I +YKW     P P  P P  R GH     +  P +    ++GG            
Sbjct: 178 YLFNINSYKWT---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQ----------- 223

Query: 278 GKILNDCWYLKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYD 331
               +D ++  +   DLS  R     W+      F P P    +M  +  +  +FGG   
Sbjct: 224 ---FDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG--- 277

Query: 332 FEETEESLESIFYNDLFSYNVESNRW 357
             +T + L     +D+F ++ + N W
Sbjct: 278 --DTPQGL----IDDVFVFDPQVNDW 297

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 74/274 (27%), Positives = 102/274 (37%), Gaps = 57/274 (20%)

Query: 105 TSMTHFYNELITYSPDNGQWRKITSQNSPMPRSSAAMCAH--PSGIALLHGGEFSSPKQN 162
           +S+ H   E   YSP    W KI  + +P PR      ++  PS    ++GG F S    
Sbjct: 9   SSLNHSIEE--DYSP----WSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV-- 60

Query: 163 TFYHYSDTWLLDTHTKEWTKMDSAK-------------GPPGRSGHRITIWKNYFILSGG 209
               Y DTW L+   + + + D  +              PP R GH  T+  N  I+ GG
Sbjct: 61  ----YGDTWKLNIK-ENYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGG 115

Query: 210 FKDLGHSTSYFN-----DCWCFDITTYKWKQIEFP-PNHPIPDARSGHSWIPTEEGCILW 263
                H  +  N     D +  ++ T KW     P P    P  R GH          L+
Sbjct: 116 DT---HKVNVSNGLMDDDLYFLNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLF 169

Query: 264 GGYCKVKAGKGLQKGKILNDCWYLKMKSDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRG 323
           GG         L K  +LN       K   SQ  WE  K +GF P P    SM   + + 
Sbjct: 170 GGQFDETYFNDLVKFDLLN------FKDANSQ--WEFIKPKGFIPPPLSNFSMCTFENKL 221

Query: 324 ILFGGVYDFEETEESLESIFYNDLFSYNVESNRW 357
            +FGG             +  N+ F Y+ E N W
Sbjct: 222 YVFGG---------DTYQVLTNETFVYDPELNEW 246

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/260 (26%), Positives = 102/260 (39%), Gaps = 54/260 (20%)

Query: 117 YSPDNGQWRKITSQNSPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDT 170
           Y+P    W ++  Q+SP PR      ++ S       I  LH              Y DT
Sbjct: 91  YTP----WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV----------YGDT 136

Query: 171 WLLD-----THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCW 224
           W+++     T     T   S   PP R GH  T+  N F++ GG     +S     +D +
Sbjct: 137 WIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLY 196

Query: 225 CFDITTYKWKQIEFP-PNHPIPDARSGH--SWIPTEE---GCILWGGYCKVKAGKGLQKG 278
            F+I ++KW     P P  P P  R GH  S I T +      L+GG             
Sbjct: 197 LFNINSFKWT---IPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQF---------DD 244

Query: 279 KILNDCWYLKMKS-DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEE 337
              ND     + S   S   WE  K + F P P    +M  +  +  +FGG        +
Sbjct: 245 TFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG--------D 296

Query: 338 SLESIFYNDLFSYNVESNRW 357
           +++ +  N +F Y++ SN W
Sbjct: 297 TMQGLI-NKVFVYDIMSNDW 315

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 50/121 (41%), Gaps = 15/121 (12%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L IFGG+      +M    N++  Y   +  W  + T+   P P    A   +   + +
Sbjct: 289 KLWIFGGD------TMQGLINKVFVYDIMSNDWSLVETTGARPPPLQEHAALIYKDLMCV 342

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAKG--PPGRSGHRITIWKNYFILSG 208
           + G +      N+ Y       L+  +  W K    K   P GRSGH IT+ KN  IL  
Sbjct: 343 VGGKDEQDIYLNSIY------FLNLKSCRWFKFPVFKAGIPQGRSGHSITLLKNNKILIM 396

Query: 209 G 209
           G
Sbjct: 397 G 397

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 115/301 (38%), Gaps = 60/301 (19%)

Query: 80  SCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQNSPMPRSSA 139
           S   T+  H  K+  +   + +NP T        ++   PD   W +I   NSP PR   
Sbjct: 109 SASSTSNPHEMKQRNVSNLQQSNPHT------RRILPSEPDYTPWGRIRLSNSPFPRYRH 162

Query: 140 AMCAHPS--GIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWT-KMDSAKG-------- 188
              +H +  G   + GG            Y DTW+L     + T  ++S K         
Sbjct: 163 VSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASDIDKTGAINSFKSTTIEITES 216

Query: 189 -PPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFDITTYKWKQIEFP-PNHPIP 245
            PP R GH  T+  N F++ GG     +S     +D +  +I +YKW     P P    P
Sbjct: 217 TPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINSYKWT---IPKPVGQRP 273

Query: 246 DARSGHSWIPT---EEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-DLSQVR---- 297
             R GH  +     +    L+GG                +D ++  +   DLS  R    
Sbjct: 274 LGRYGHKIVTISAEQTKLYLFGGQ--------------FDDTYFGDLAVFDLSSFRRPDS 319

Query: 298 -WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNR 356
            W   K  GF P P    +M  ++ +  +FGG        ++LE    N ++ Y+  +N 
Sbjct: 320 HWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG--------DTLEEGLINRVYLYSPTNNS 371

Query: 357 W 357
           W
Sbjct: 372 W 372

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 64/151 (42%), Gaps = 18/151 (11%)

Query: 74  PAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNS 132
           P    N  M+T     + ++ +FGG+     T      N +  YSP N  W  + T+ + 
Sbjct: 331 PPPLTNHTMVTY----QDKIWVFGGD-----TLEEGLINRVYLYSPTNNSWEIVETTGDI 381

Query: 133 PMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAKG--PP 190
           P P    A   +   + ++ G +      NT Y       L+  + +W K+   K   P 
Sbjct: 382 PPPMQEHAAIVYKDLMCVVGGKDAEDNYLNTLY------FLNLQSLKWFKLPFYKNNIPQ 435

Query: 191 GRSGHRITIWKNYFILSGGFKDLGHSTSYFN 221
           GRSGH +T+ KN  IL  G     +S+S  N
Sbjct: 436 GRSGHSVTLLKNDQILIMGGDKYDYSSSTEN 466

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 98/257 (38%), Gaps = 44/257 (17%)

Query: 120 DNGQWRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTH 176
           D   W +I   NSP PR    ++A       I ++ G    S        Y DTW+L + 
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 177 TK-----EWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITT 230
                    T   S   PP R GH  T+  N FI+ GG    +       +D + F+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 231 YKWKQIEFP-PNHPIPDARSGH--SWIPTEEG---CILWGGYCKVKAGKGLQKGKILNDC 284
           +KW     P P  P P  R GH  S I T        L+GG                ND 
Sbjct: 243 HKWT---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQF---------DDAYFNDL 290

Query: 285 WYLKMKS-DLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIF 343
               + S      RWE  K + F P P    +M  +  +  +FGG        ++L+ + 
Sbjct: 291 VVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG--------DTLQGL- 341

Query: 344 YNDLFSYNVESNRWFSL 360
            N +F Y+   N W ++
Sbjct: 342 TNRVFMYDPMINDWTTI 358

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 76/167 (45%), Gaps = 25/167 (14%)

Query: 53  LANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYN 112
           L++F+    ++E V  +S   P    N  M++  N    +L +FGG+      ++    N
Sbjct: 295 LSSFRRPDSRWEFVKPKSFVPPP-LTNHTMVSYDN----KLWVFGGD------TLQGLTN 343

Query: 113 ELITYSPDNGQWRKI-TSQNSPM----PRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHY 167
            +  Y P    W  I TS ++P     P    A   +   + +  G +    +Q+T+ + 
Sbjct: 344 RVFMYDPMINDWTTIETSSDNPNNIAPPMQEHAAIVYKDLMCIFGGKD----EQDTYLN- 398

Query: 168 SDTWLLDTHTKEWTKMDS-AKG-PPGRSGHRITIWKN-YFILSGGFK 211
              + L+  T +W K+   A G P GRSGH IT+ KN   ++ GG K
Sbjct: 399 -GVYFLNLRTLKWYKLPIFAPGIPQGRSGHSITLLKNDKLLIMGGDK 444

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 105/270 (38%), Gaps = 74/270 (27%)

Query: 117 YSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYH---------Y 167
           Y+P    W ++   NSP PR      A+ S             +QN  Y          Y
Sbjct: 75  YTP----WSRVKLANSPFPRYRHVASAYAS-------------EQNQVYVIGGLHDQSVY 117

Query: 168 SDTWLLDTH-------TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF 220
            DTW++  H       +K     D+   PP R GH  T+  N F++ GG     +S    
Sbjct: 118 GDTWIISAHDNGSKFSSKTVDITDTT--PPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 175

Query: 221 -NDCWCFDITTYKWKQIEFP-PNHPIPDARSGH--SWIPTEE---GCILWGGYCKVKAGK 273
            +D + F+I +YKW     P P  P P  R GH  S I T +      ++GG        
Sbjct: 176 DDDVYLFNINSYKWT---IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQ------- 225

Query: 274 GLQKGKILNDCWYLKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFG 327
                   +D ++  +   DLS  R     W+  K   F P P    +M  +  +  +FG
Sbjct: 226 -------FDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFG 278

Query: 328 GVYDFEETEESLESIFYNDLFSYNVESNRW 357
           G     +T + L     ND+F ++ + N W
Sbjct: 279 G-----DTPQGL----INDVFMFDPQINDW 299

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 59/140 (42%), Gaps = 15/140 (10%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L +FGG+      +     N++  + P    W+ + T+ + P P    A   +   + +
Sbjct: 273 KLWVFGGD------TPQGLINDVFMFDPQINDWKVMQTTGDKPPPLQEHAAVLYGDLMCV 326

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAKG--PPGRSGHRITIWKNYFILSG 208
           + G      K     + +  + L+  + +W K+ S +   P GRSGH +T+  N+ +L  
Sbjct: 327 VGG------KDEQDVYSNSVFFLNLISLKWFKLPSYRSGIPQGRSGHSLTLLPNHKLLIM 380

Query: 209 GFKDLGHSTSYFNDCWCFDI 228
           G     ++     D    D+
Sbjct: 381 GGDKFDYARGGEGDVHTSDV 400

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 99/249 (39%), Gaps = 42/249 (16%)

Query: 124 WRKITSQNSPMPR--SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWL---LDTHT- 177
           W +I  + SP PR    A+  A  SG   + GG            Y DTW+   LD  T 
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWIIKSLDNATS 146

Query: 178 -KEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWKQ 235
            K  T   +   PP R GH  T+  N F++ GG    +  +    +D + F+I ++KW  
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKWT- 205

Query: 236 IEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKS-DL 293
              P P  P P  R GH         I+     K K       G   +D ++  +   DL
Sbjct: 206 --IPTPQGPRPLGRYGHKI------SIIAANQMKTKL---YVFGGQFDDTYFNDLAEFDL 254

Query: 294 SQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLF 348
           S  R     WE  K   F P P    +M     +  +FGG     +T + L     N++F
Sbjct: 255 SSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DTPQGLT----NEVF 305

Query: 349 SYNVESNRW 357
            ++  +N W
Sbjct: 306 MFDPAANDW 314

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 83/191 (43%), Gaps = 25/191 (13%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYN----ELITYSPDNGQWRKITSQN-SPMPRS 137
           I   N  K +L +FGG+F +     T+F +    +L ++   +  W  I      P P +
Sbjct: 224 IIAANQMKTKLYVFGGQFDD-----TYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLA 278

Query: 138 SAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAKG-PPGRSGHR 196
           +  M +    + +  G    +P+  T    ++ ++ D    +W  + +    PP    H 
Sbjct: 279 NHTMISFDHKLWVFGG---DTPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHA 331

Query: 197 ITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP-NHPIPDARSGHSW-I 254
             I+++   + GG KD     +Y N  +  +  + KW   + P  N+ IP ARSGHS  +
Sbjct: 332 AIIYRDLMCVFGG-KDA--QDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARSGHSLTL 386

Query: 255 PTEEGCILWGG 265
            +    ++ GG
Sbjct: 387 LSNNKLLIMGG 397

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 100/256 (39%), Gaps = 54/256 (21%)

Query: 124 WRKITSQNSPMPRSSAAMCAHPS--GIALLHGGEFSSPKQNTFYHYSDTWLLD------- 174
           W +I  QNSP PR      ++ S  G   + GG            Y DTW+L        
Sbjct: 160 WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENNGLS 213

Query: 175 THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKW 233
           T     T   S   PP R GH  T+  N F++ GG    +    S  +D + F+I +YKW
Sbjct: 214 TTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSYKW 273

Query: 234 KQIEFP-PNHPIPDARSGH--SWIPTEE---GCILWGGYCKVKAGKGLQKGKILNDCWYL 287
                P P    P  R GH  S I T +      L+GG                +D ++ 
Sbjct: 274 T---IPKPVGQRPLGRYGHKISIIATSQMKTKLYLFGGQ--------------FDDTYFN 316

Query: 288 KMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLES 341
            +   DLS  R     WE  + + F P P    +M  +  +  +FGG        ++L+ 
Sbjct: 317 DLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG--------DTLQG 368

Query: 342 IFYNDLFSYNVESNRW 357
           +  N +F Y+   N W
Sbjct: 369 L-TNQVFMYDPVDNDW 383

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 86/194 (44%), Gaps = 26/194 (13%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYS------PDNGQWRKITSQN-SPMP 135
           I   +  K +L +FGG+F +       ++N+L+ +       PD   W  I  ++  P P
Sbjct: 293 IIATSQMKTKLYLFGGQFDDT------YFNDLVVFDLSSFRRPD-SHWEFIRPKSFIPPP 345

Query: 136 RSSAAMCAHPSGIALLHGGEFSSPKQNTFYHY----SDTWLLDTHTKEWTKMDSAKGPPG 191
            ++  MC++   + +  GG+      N  + Y    +D  +++T        D +  PP 
Sbjct: 346 LTNHTMCSYDHKLWVF-GGDTLQGLTNQVFMYDPVDNDWCVVETFA---NNNDVSNIPPP 401

Query: 192 RSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGH 251
              H   ++K+   + GG KD   S +Y ND +  ++ T KW ++ F     +P  RSGH
Sbjct: 402 IQEHAAVLYKDLMCVIGG-KD--ESDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGH 457

Query: 252 SWIPTEEGCILWGG 265
           S    +   IL  G
Sbjct: 458 SVTLLKNDKILIMG 471

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 103/243 (42%), Gaps = 44/243 (18%)

Query: 131 NSPMPR--SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWT-KMDSAK 187
           N+P PR   ++ MC +     ++ GG+     +N      D +L + ++ +WT       
Sbjct: 137 NTPPPRVGHASTMCGNA---YVVFGGDTHKLNKNRLLD-DDLYLFNINSYKWTIPHPIGS 192

Query: 188 GPPGRSGHRITIWKNY-----FILSGGFKDLGHSTSYFNDCWCFDITTYK-----WKQIE 237
            P GR GH+I+I  +        L GG  D     +YFND   FD+++++     W+ +E
Sbjct: 193 RPLGRYGHKISIIASKQMHTELYLFGGQID----ETYFNDLAVFDLSSFRRPNSHWEFLE 248

Query: 238 FPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLSQVR 297
             P   +P   + H+ +  +    ++GG              I ND +      D  Q  
Sbjct: 249 --PISALPPPLTNHTMVTFDNKLWVFGGETP---------KTISNDTYCY----DPIQNA 293

Query: 298 WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRW 357
           W + +  G +P P    +   +K    +FGG        + + + + ND++  N+ S +W
Sbjct: 294 WSKVETTGEKPPPVQEHASVVYKHLMCVFGG--------KDIHNTYSNDVYFLNLLSLKW 345

Query: 358 FSL 360
           F L
Sbjct: 346 FKL 348

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 102/257 (39%), Gaps = 58/257 (22%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTH---- 176
           W +I  ++SP PR   SS+ +  + + I  + GG +          Y D W +  +    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRI-FVTGGLYDQSV------YGDVWEITANANGT 125

Query: 177 --TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKW 233
             T +  ++D    PP R GH  T+  N +++ GG    L  +    +D + F+I +YKW
Sbjct: 126 SFTSKRIQIDH-NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKW 184

Query: 234 KQIEFPPNHPI---PDARSGH--SWIPTEE---GCILWGGYCKVKAGKGLQKGKILNDCW 285
                P  HPI   P  R GH  S I +++      L+GG                ND  
Sbjct: 185 T---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGGQI---------DETYFNDLA 230

Query: 286 YLKMKSDLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
                 DLS  R     WE  +     P P    +M     +  +FGG     ET +++ 
Sbjct: 231 VF----DLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG-----ETPKTIS 281

Query: 341 SIFYNDLFSYNVESNRW 357
               ND + Y+   N W
Sbjct: 282 ----NDTYCYDPIQNAW 294

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 13/127 (10%)

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           Y W +I+   + P P  R   S+I T +  I   G        GL    +  D W +   
Sbjct: 71  YIWNRIKLK-DSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITAN 121

Query: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350
           ++ +    +R +     P PRVG +        ++FGG    +  + +   +  +DL+ +
Sbjct: 122 ANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG----DTHKLNKNRLLDDDLYLF 177

Query: 351 NVESNRW 357
           N+ S +W
Sbjct: 178 NINSYKW 184

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 116/305 (38%), Gaps = 91/305 (29%)

Query: 73  KPAQRLN-SCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQN 131
           +P Q+ N S  +TT +H++KE                        Y+P    W +I   N
Sbjct: 118 QPVQQRNVSGAVTTLHHNQKE------------------------YTP----WNRIKLTN 149

Query: 132 SPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDS 185
           SP PR      ++ S       I  LH              Y DTW + T T   T+  S
Sbjct: 150 SPFPRYRHVASSYESVDNEIFVIGGLHDQSV----------YGDTWSI-TSTNNGTQFIS 198

Query: 186 AK------GPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWKQIEF 238
                    PP R GH  T+  N F++ GG    +       +D + F+I ++KW     
Sbjct: 199 KALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKWT---I 255

Query: 239 P-PNHPIPDARSGH--SWIPTEEG---CILWGGYCKVKAGKGLQKGKILNDCWYLKMKS- 291
           P P  P P  R GH  S I T        L+GG                +D ++  +   
Sbjct: 256 PSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQ--------------FDDTYFNDIAVF 301

Query: 292 DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYND 346
           DLS  R     WE  K +G  P P    +M  +  +  +FGG     +T++ L     ND
Sbjct: 302 DLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGL----IND 352

Query: 347 LFSYN 351
           +++++
Sbjct: 353 IYAFD 357

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 22/190 (11%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYN----ELITYSPDNGQWRKITSQN-SPMPRS 137
           I   + SK +L +FGG+F +     T+F +    +L ++   +  W  I  +   P P +
Sbjct: 273 IIATSSSKTKLYLFGGQFDD-----TYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMT 327

Query: 138 SAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMD-SAKGPPGRSGHR 196
           +  M  + + + +  GG+      N  Y +     ++T    WTK+D +   P     H 
Sbjct: 328 NHTMVTYDNKLWVF-GGDTKDGLINDIYAFDPADSINT----WTKIDVTGDIPCPVQEHS 382

Query: 197 ITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP-NHPIPDARSGHSWIP 255
             I+ N   + GG KD   +  Y N    F+    KW   +FP     I   RSGHS   
Sbjct: 383 ALIYDNLMCVIGG-KD--ENDMYLNSVHFFNFDKLKW--FKFPIFKSGIMQGRSGHSISL 437

Query: 256 TEEGCILWGG 265
                IL  G
Sbjct: 438 LNNNKILIMG 447

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 99/257 (38%), Gaps = 50/257 (19%)

Query: 120 DNGQWRKITSQNSPMPR--SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTH- 176
           D   W ++    SP PR    A+  A  S    + GG            Y DTW++ +H 
Sbjct: 154 DETPWNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIKSHE 207

Query: 177 --------TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFD 227
                   T E T+      PP R GH  T+  N F++ GG     ++     +D +  +
Sbjct: 208 NGNKFTSKTVEITETT----PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLN 263

Query: 228 ITTYKWKQIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWY 286
           I ++KW     P P  P P  R GH         I+     K K       G   +D ++
Sbjct: 264 INSHKWT---IPRPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYF 311

Query: 287 LKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
             +   DLS  R     W+  K   F P P    +M  +  +  +FGG     +T + L 
Sbjct: 312 NDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL- 365

Query: 341 SIFYNDLFSYNVESNRW 357
               N+LF Y+  +N W
Sbjct: 366 ---INELFMYDPTTNDW 379

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 100/242 (41%), Gaps = 40/242 (16%)

Query: 130 QNSPMPRS--SAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWT-KMDSA 186
           QN+P PR   ++ +C +     ++ GG+      N      D +L + ++ +WT      
Sbjct: 136 QNTPPPRVGHASTICGNA---YVVFGGDTHKLNMNRLLD-DDLYLFNINSYKWTIPQPVG 191

Query: 187 KGPPGRSGHRITIWKN-----YFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQ---IEF 238
             P GR GH+I+I  N        L GG  D     +YFND   FD+++++      +  
Sbjct: 192 TRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFNDLAMFDLSSFRRPNSHWVFL 247

Query: 239 PPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLSQVRW 298
            P   +P   + H+ +  +    ++GG    K    L        C+      D  Q  W
Sbjct: 248 KPVSIVPPPLTNHTMVTFDNKLWVFGG----KTPNTLSNETF---CY------DPVQNDW 294

Query: 299 ERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWF 358
            + +  G +P      +   +K    +FGG        + +++ + ND++  N+ + +W+
Sbjct: 295 SKIQTTGERPPAVQEHASVVYKHLMCIFGG--------KDIQNAYSNDVYFLNLITFKWY 346

Query: 359 SL 360
            L
Sbjct: 347 KL 348

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 90/252 (35%), Gaps = 48/252 (19%)

Query: 124 WRKITSQNSPMPR--SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTW-----LLDTH 176
           W +I  +NSP PR   SA+          + GG       +    Y DTW     L  T 
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG------LHDHLVYGDTWQITGNLDGTS 126

Query: 177 TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKWKQ 235
               T       PP R GH  TI  N +++ GG    L  +    +D + F+I +YKW  
Sbjct: 127 FVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWTI 186

Query: 236 IEFPPNHPIPDARSGH--SWI---PTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
            +  P    P  R GH  S I   P +    L+GG                ND       
Sbjct: 187 PQ--PVGTRPLGRYGHKISIIANNPMQTKLFLFGGQI---------DETYFNDLAMF--- 232

Query: 291 SDLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYN 345
            DLS  R     W   K     P P    +M     +  +FGG     +T  +L     N
Sbjct: 233 -DLSSFRRPNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG-----KTPNTLS----N 282

Query: 346 DLFSYNVESNRW 357
           + F Y+   N W
Sbjct: 283 ETFCYDPVQNDW 294

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 87/193 (45%), Gaps = 29/193 (15%)

Query: 83  ITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQ--------NSPM 134
           I   N  + +L +FGG+    ET    ++N+L  +  D   +R+  S           P 
Sbjct: 204 IIANNPMQTKLFLFGGQID--ET----YFNDLAMF--DLSSFRRPNSHWVFLKPVSIVPP 255

Query: 135 PRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDS-AKGPPGRS 193
           P ++  M    + + +  G    +P  NT  +  +T+  D    +W+K+ +  + PP   
Sbjct: 256 PLTNHTMVTFDNKLWVFGG---KTP--NTLSN--ETFCYDPVQNDWSKIQTTGERPPAVQ 308

Query: 194 GHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGHSW 253
            H   ++K+   + GG KD+    +Y ND +  ++ T+KW ++       +P  RSGHS 
Sbjct: 309 EHASVVYKHLMCIFGG-KDI--QNAYSNDVYFLNLITFKWYKLP-RIKEGLPKERSGHSL 364

Query: 254 -IPTEEGCILWGG 265
            +   +  ++ GG
Sbjct: 365 TLIKNDKLVIMGG 377

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 101/262 (38%), Gaps = 59/262 (22%)

Query: 117 YSPDNGQWRKITSQNSPMPRSSAAMCAHPS--GIALLHGGEFSSPKQNTFYHYSDTWLLD 174
           Y+P    W +     SP PR      +H S      + GG     ++ + Y   D W ++
Sbjct: 34  YTP----WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVY--GDVWSIN 83

Query: 175 THTKEWTKMDSAK----GPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDIT 229
               +     S +     PP R GH  TI  N  IL GG    +       +D + F++ 
Sbjct: 84  HKDDKSFSASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLN 143

Query: 230 TYKWKQIEFPPNHPI---PDARSGH-----SWIPTEEGCILWGGYCKVKAGKGLQKGKIL 281
           +YKW   E     PI   P  R GH     +  PT+    L+GG                
Sbjct: 144 SYKWTIPE-----PIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ--------------F 184

Query: 282 NDCWYLKMKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEET 335
           +D ++  +   DLS  R     WE  K + F P P    +M  +  +  +FGG       
Sbjct: 185 DDTYFNDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG------- 237

Query: 336 EESLESIFYNDLFSYNVESNRW 357
            E+L+ +  N++F Y+   N W
Sbjct: 238 -ETLQGLI-NEVFVYDPIVNDW 257

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 100/257 (38%), Gaps = 52/257 (20%)

Query: 124 WRKITSQNSPMPRSS--AAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLL--DTHTKE 179
           W +    +SP+PR    A+  A P     + GG            Y DTW+L  ++ +  
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 180 WTK--MD-SAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFDITTYKWKQ 235
           +T   +D +   PP R GH  T+  N  ++ GG     +S     +D + F++ +++W  
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWT- 274

Query: 236 IEFP-PNHPIPDARSGH-----SWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKM 289
              P P    P  R GH     +  P +    L+GG               L+D ++  +
Sbjct: 275 --IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQ--------------LDDNYFNDL 318

Query: 290 KS-DLSQV-----RWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIF 343
              DLS       RW+  K + F P P    +M  +  +  +FGG    E          
Sbjct: 319 AMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE---------L 369

Query: 344 YNDLFSYNVESNRWFSL 360
            N L+ Y  + N W  L
Sbjct: 370 QNQLYVYIPDLNEWRCL 386

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 17/141 (12%)

Query: 92  ELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIAL 150
           +L +FGG      +S     N+L  Y PD  +WR + T  + P P    +   + + + +
Sbjct: 357 KLWVFGG------SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCV 410

Query: 151 LHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSA--KGPPGRSGHRITIWKN--YFIL 206
             G       QNT Y       L+  T +W ++D++    P  RSG  +++ +N    I+
Sbjct: 411 FGGKNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIM 464

Query: 207 SGGFKDLGHSTSYFNDCWCFD 227
            G   D   + +  ND   +D
Sbjct: 465 GGDKNDYCVNGANLNDIDEYD 485

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 103/244 (42%), Gaps = 46/244 (18%)

Query: 131 NSPMPR--SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWT-KMDSAK 187
           N+P PR   +A +C    G AL+  G  +    +      D +L +  +  WT       
Sbjct: 226 NTPPPRVGHAATLC----GNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTIPTPIGT 281

Query: 188 GPPGRSGHRITIW-----KNYFILSGGFKDLGHSTSYFNDCWCFDITTYK-----WKQIE 237
            P GR GH++++      K    L GG  D     +YFND   +D++ ++     W+ ++
Sbjct: 282 RPLGRYGHQVSVIATTPKKAKLYLFGGQLD----DNYFNDLAMYDLSDFRNPHSRWQFLK 337

Query: 238 FPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCW-YLKMKSDLSQV 296
                P P   + H+ +  +    ++GG  +         G++ N  + Y+    DL++ 
Sbjct: 338 SKAFTPPP--LTNHTMVAYDYKLWVFGGSSR---------GELQNQLYVYI---PDLNE- 382

Query: 297 RWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNR 356
            W   + +G +P P    S   +K    +FGG    +E        + N ++  N+++ +
Sbjct: 383 -WRCLETEGDKPQPIQEHSATIYKNLMCVFGGKNKDDE--------YQNTMYFLNLQTLK 433

Query: 357 WFSL 360
           W+ L
Sbjct: 434 WYRL 437

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 71/178 (39%), Gaps = 31/178 (17%)

Query: 189 PPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFDITTYKWKQIEFPPNHPIPDA 247
           PP R GH  T+  N F++ GG     +      +D + F+I +YKW   +  P  P P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQ--PVGPRPLG 197

Query: 248 RSGHSWIPTEEGCILWGGYCKVK--AGKGLQKGKILND-CWYLKMKSDLSQVR-----WE 299
           R GH         I+     K K     G       ND C Y     DLS  R     WE
Sbjct: 198 RYGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVY-----DLSSFRKPESHWE 246

Query: 300 RRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRW 357
             K + F P P    +M  +  +  +FGG     +T++ L     N LF ++   N W
Sbjct: 247 FLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 16/121 (13%)

Query: 95  IFGGEFTNPETSMTHFYNELITYSPDNGQWRKI-TSQNSPMPRSSAAMCAHPSGIALLHG 153
           +FGG+      +     N+L  + P    WR + T+   P P    A       + ++ G
Sbjct: 272 VFGGD------TQQGLINQLFMFDPVINDWRVVETTGEKPPPVQEHAAVMFNDLMCIMGG 325

Query: 154 GEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAK--GPPGRSGHRITIWK-NYFILSGGF 210
            +    +Q+ + +    + L+  + +W K +  K   P GRSGH IT+ K N  ++ GG 
Sbjct: 326 KD----EQDVYLN--SVYFLNLKSLKWFKFNDYKLNIPQGRSGHSITLLKNNRLLIMGGD 379

Query: 211 K 211
           K
Sbjct: 380 K 380

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 100/257 (38%), Gaps = 58/257 (22%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTH---- 176
           W ++  +NSP PR   SS+ +  + + I +  G    S        Y D W +  +    
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 177 --TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKW 233
             T +   +D    PP R GH  TI  N +++ GG    L  +    +D + F+I +YKW
Sbjct: 126 SFTSKRIDIDQ-NTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKW 184

Query: 234 KQIEFPPNHPI---PDARSGH--SWI---PTEEGCILWGGYCKVKAGKGLQKGKILNDCW 285
                P   PI   P  R GH  S I   P +    L+GG                ND  
Sbjct: 185 T---IP--QPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQV---------DETYFNDLV 230

Query: 286 YLKMKSDLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
                 DLS  R     WE  +  G  P P    +M  +  +  +FGG     ET +++ 
Sbjct: 231 VF----DLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS 281

Query: 341 SIFYNDLFSYNVESNRW 357
               ND + Y+   + W
Sbjct: 282 ----NDTYRYDPAQSEW 294

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 54/132 (40%), Gaps = 23/132 (17%)

Query: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290
           Y W +++   N P P  R   S+I T +  I   G        GL    +  D W +   
Sbjct: 71  YIWNRVKLK-NSPFPRYRHSSSFIVTNDNRIFVTG--------GLHDQSVYGDVWQIAAN 121

Query: 291 SDLSQVRWERRKKQGFQPSPRVG-----CSMAYHKGRGILFGGVYDFEETEESLESIFYN 345
           +D +    +R       P PRVG     C  AY     ++FGG    +  + +   +  +
Sbjct: 122 ADGTSFTSKRIDIDQNTPPPRVGHASTICGNAY-----VVFGG----DTHKLNKNGLLDD 172

Query: 346 DLFSYNVESNRW 357
           DL+ +N+ S +W
Sbjct: 173 DLYLFNINSYKW 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 101/257 (39%), Gaps = 58/257 (22%)

Query: 124 WRKITSQNSPMPR---SSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTH---- 176
           W +I  ++SP PR   SS+ + +  + I  + GG ++         Y D W +  +    
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRI-FVTGGLYNQSV------YGDVWQITANADGT 123

Query: 177 --TKEWTKMDSAKGPPGRSGHRITIWKNYFILSGG-FKDLGHSTSYFNDCWCFDITTYKW 233
             T +  ++D    PP R GH  T+  N +++ GG    L       +D + F++ +YKW
Sbjct: 124 SFTPKAIQIDR-NTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 234 KQIEFPPNHPI---PDARSGH-----SWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCW 285
                P   PI   P  R GH     ++ P +    L+GG                ND  
Sbjct: 183 T---IP--QPIGSRPLGRYGHKISIIAYNPMQTKLYLFGGQL---------DKTYFNDLA 228

Query: 286 YLKMKSDLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
                 DLS  R     WE  +     P P    +M  +  +  +FGG     ET +++ 
Sbjct: 229 MF----DLSSFRRRNSHWEFLEPATTVPPPLANHTMVTYGNKLWVFGG-----ETPKTVS 279

Query: 341 SIFYNDLFSYNVESNRW 357
               N+ + Y+   N W
Sbjct: 280 ----NETYCYDPIQNDW 292

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 23/186 (12%)

Query: 87  NHSKKELLIFGGEFTNPETSMTHFYN----ELITYSPDNGQWRKITSQNS-PMPRSSAAM 141
           N  + +L +FGG+        T+F +    +L ++   N  W  +    + P P ++  M
Sbjct: 206 NPMQTKLYLFGGQLDK-----TYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPPLANHTM 260

Query: 142 CAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSA-KGPPGRSGHRITIW 200
             + + + +  GGE      N  Y Y      D    +W+K+++  + PP    H   ++
Sbjct: 261 VTYGNKLWVF-GGETPKTVSNETYCY------DPIQNDWSKIETTGEIPPPVQEHASVVY 313

Query: 201 KNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGHSW-IPTEEG 259
           K+   + GG     H+ +Y ND +  D+ ++KW ++       IP  RSGHS  +   E 
Sbjct: 314 KHIMCVFGG--KYTHN-AYSNDVYFLDLLSFKWYKLPH-IKEGIPRERSGHSLTLMKNEK 369

Query: 260 CILWGG 265
            ++ GG
Sbjct: 370 ILIMGG 375

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 95/255 (37%), Gaps = 54/255 (21%)

Query: 124 WRKITSQNSPMPRSSAAMCAHPSG------IALLHGGEFSSPKQNTFYHYSDTWLLDTHT 177
           W ++    +P PR      A+ S       I  LH              Y DTW+L    
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQSV----------YGDTWIL--RA 99

Query: 178 KEWTKMDSAKG-------PPGRSGHRITIWKNYFILSGGFKDLGHSTSYF-NDCWCFDIT 229
           ++  K  SA+        PP R GH  T+  N F++ GG     ++     +D +  ++ 
Sbjct: 100 QDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVN 159

Query: 230 TYKWKQIEFP-PNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLK 288
           ++KW     P P  P P  R GH         I+     K K       G   +D ++  
Sbjct: 160 SHKWT---IPHPVGPRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFND 207

Query: 289 MKS-DLSQVR-----WERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESI 342
           +   DLS  R     W   K   F P P    +M  +  +  +FGG     +T + L   
Sbjct: 208 LAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL--- 259

Query: 343 FYNDLFSYNVESNRW 357
             N+LF Y+   N W
Sbjct: 260 -INELFVYDPVVNDW 273

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 63/142 (44%), Gaps = 16/142 (11%)

Query: 126 KITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDS 185
           + TS    + R+  +   H  G  +  GG   +P +      SDT  +DT    + ++ +
Sbjct: 382 EFTSLEYDLKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQN 434

Query: 186 -AKGPPGRSGHRIT-IWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHP 243
            +  PP R+ H  T +      +  G ++  H     NDCW +++ T +W++        
Sbjct: 435 HSVLPPARACHTFTRLGDGETAMVIGGRNAPHRA--VNDCWFYNLNTNEWQK-----GPE 487

Query: 244 IPDARSGHSWIPTEEGCILWGG 265
           +P+ R  HS + T++  +L  G
Sbjct: 488 LPEPRFRHSCVATDKNTLLVCG 509

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 23/128 (17%)

Query: 56  FKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELI 115
             L  E FE  NV        R     +  PN  KK+LL FGG       S     NE+I
Sbjct: 348 LSLPVEYFEIANV--------RKFGASVLDPN--KKQLLYFGG-------SCPQRTNEII 390

Query: 116 TYSPD-NGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174
           +  PD + +        +P+ R+        +  A++ GG     ++N +   SDTW+ +
Sbjct: 391 SIGPDGDCEAVPFDKTTAPVARACHTFTLVNNDTAMVVGG-----RRNPWQPLSDTWMFN 445

Query: 175 THTKEWTK 182
             + EWT+
Sbjct: 446 LSSHEWTR 453

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 311 RVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWFSLS 361
           RV  SM +H GR  LFGG+    +++  L  I  N+L+S ++E+  W  LS
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYEL--IASNELWSLDLETKTWLQLS 186

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 39/102 (38%), Gaps = 12/102 (11%)

Query: 140 AMCAHPSGIALLHGGEFSSPKQN-TFYHYSDTWLLDTHTKEWTKMDSAKGPPGRSGHRIT 198
           +MC H  G   L GG   SP+ +      ++ W LD  TK W ++ S      R  H + 
Sbjct: 142 SMCFH-DGRLYLFGGLVVSPQSDYELIASNELWSLDLETKTWLQLSSDPAITRRFNHSMH 200

Query: 199 IWKN-------YFILSGGFKDLGHSTSYFNDCWCFDITTYKW 233
           I             + GG  +L       +   C+ IT  KW
Sbjct: 201 IVDGEDDDDDVRIYIVGGLNNLDRPVHIVD---CYSITQNKW 239

>NCAS0B04460 Chr2 (806663..811321) [4659 bp, 1552 aa] {ON} Anc_8.157
           YER132C
          Length = 1552

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 71/167 (42%), Gaps = 29/167 (17%)

Query: 90  KKELLIFGGEFTNPETSMTH---------FYNELITYSPDNGQWRKI---TSQNSPMPRS 137
           +KEL+++  +  +  +S  +         FY +LIT +     W++I   TS  +   R 
Sbjct: 73  QKELILYFAKIKDSSSSFKNLNDWISSEIFYLDLITRA-----WQRIEIETSSENFQERL 127

Query: 138 SAAMCAHPSGIALLHGGEFSSPKQN-TFYHYSDTWLLDTHTKEWTKMDSAKGPPGRSGHR 196
             +MC+  S I +  GG   SP+ +      ++ W LD  TK+WT M        R  H 
Sbjct: 128 FHSMCSDGSNIYIF-GGLMVSPQNDYELIATNELWKLDLLTKKWTLMSKDPLIARRFDHS 186

Query: 197 ITIW-------KNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQI 236
           I              ++ GG  ++    +Y +    ++++  +W+ +
Sbjct: 187 IFTLHTDEESKDTKLVVVGGLNNMDQPVNYID---IYNLSKNEWESL 230

>Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {ON}
           complement(42216..44105) [1890 nt, 630 aa]
          Length = 629

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 10/86 (11%)

Query: 182 KMDSAKGPPGRSGHRIT-IWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP 240
           K+D+   P GR  H ++ I ++  I  GG K  G     F++CW  D++T +W +     
Sbjct: 371 KIDTTDTPIGRMCHTLSRISESEIISIGGRKAPGQG---FDECWKLDLSTKQWSK----- 422

Query: 241 NHPIPDARSGHS-WIPTEEGCILWGG 265
              +   R  HS ++  +E  ++ GG
Sbjct: 423 GAQLNAKRYRHSAFMVDDENVLICGG 448

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

Query: 181 TKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPP 240
           TK +   GP  +     T   +  ++ GG     ++T  ++D W FD  T  W QIE   
Sbjct: 636 TKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETESWVQIETQA 691

Query: 241 NH------PIPDARSGHSWIPTEEGCILWGGYCKVKAGK 273
                   PI  A +GHS        I  GG  +    K
Sbjct: 692 QTEDKGLVPIEMALAGHSMATVGSASIFVGGMMQSDVDK 730

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,350,278
Number of extensions: 2506618
Number of successful extensions: 6063
Number of sequences better than 10.0: 55
Number of HSP's gapped: 5838
Number of HSP's successfully gapped: 109
Length of query: 645
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 529
Effective length of database: 40,180,143
Effective search space: 21255295647
Effective search space used: 21255295647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)