Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021806.8ON51551525280.0
NDAI0G00860singletonON52352511831e-157
KNAG0E027706.8ON5085239241e-119
TDEL0G046306.8ON5035248901e-113
KAFR0B065106.8ON5085288601e-109
CAGL0A01089g6.8ON5355498601e-109
Smik_6.4806.8ON5165268351e-105
Skud_16.56.8ON5155298351e-105
YPL272C6.8ON5175258151e-102
Kpol_1045.796.8ON5085198121e-102
Suva_16.336.8ON5185298031e-100
SAKL0E00792g6.8ON5115227971e-99
TPHA0J002606.8ON5155327491e-92
TPHA0M001806.8ON5035237124e-87
KLTH0C11572g6.8ON5185266645e-80
TBLA0A072206.8ON5095315617e-65
Kwal_56.223416.8ON5195265354e-61
Ecym_30116.8ON5095265135e-58
ACR018C6.8ON4784664461e-48
Kpol_1032.1singletonON2462302915e-29
Ecym_24835.119ON4611191322e-07
TDEL0E051105.119ON4692791278e-07
Kpol_191.16.8ON1391381171e-06
KLTH0C02178g5.119ON4641261054e-04
CAGL0K00737g5.119ON457108960.003
TPHA0H009605.119ON47654950.006
Kwal_27.98985.119ON46095940.006
NCAS0A073905.119ON47877920.012
CAGL0K12628g8.28ON1326146820.27
Skud_7.5485.119ON47584800.31
KNAG0G007005.119ON456135800.32
ZYRO0F01540g5.119ON47092800.35
NDAI0D023605.119ON47088761.0
YGR212W (SLI1)5.119ON46852751.2
ACL138C5.119ON45554732.6
Smik_16.945.119ON46652722.9
Kpol_1032.594.104ON508130713.7
Kpol_1010.495.119ON48188705.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02180
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      978   0.0  
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              460   e-157
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   360   e-119
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   347   e-113
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   335   e-109
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   335   e-109
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   326   e-105
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   326   e-105
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   318   e-102
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   317   e-102
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   313   e-100
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   311   1e-99
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   293   1e-92
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   278   4e-87
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   260   5e-80
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   220   7e-65
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   210   4e-61
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   202   5e-58
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   176   1e-48
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   116   5e-29
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    55   2e-07
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    54   8e-07
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    50   1e-06
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    45   4e-04
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    42   0.003
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    41   0.006
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    41   0.006
NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON} Anc_5...    40   0.012
CAGL0K12628g Chr11 complement(1246877..1250857) [3981 bp, 1326 a...    36   0.27 
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    35   0.31 
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    35   0.32 
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    35   0.35 
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    34   1.0  
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    33   1.2  
ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON} S...    33   2.6  
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    32   2.9  
Kpol_1032.59 s1032 (135795..137321) [1527 bp, 508 aa] {ON} (1357...    32   3.7  
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    32   5.0  

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/515 (93%), Positives = 479/515 (93%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSV 60
           MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNY                KDRRLTLSV
Sbjct: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSV 60

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120
           ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL
Sbjct: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180
           LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS
Sbjct: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240
           IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL
Sbjct: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240

Query: 241 YLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNEL 300
           YLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNEL
Sbjct: 241 YLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNEL 300

Query: 301 TEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDII 360
           TEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDII
Sbjct: 301 TEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDII 360

Query: 361 IECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYWXX 420
           IECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYW  
Sbjct: 361 IECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYWKT 420

Query: 421 XXXXXXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLSKKEMFSV 480
                             EIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLSKKEMFSV
Sbjct: 421 DNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLSKKEMFSV 480

Query: 481 SYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
           SYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE
Sbjct: 481 SYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  460 bits (1183), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 236/525 (44%), Positives = 335/525 (63%), Gaps = 12/525 (2%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKY-GRNYXXXXXXXXXXXXXXXXKDRRLTLS 59
           M  R LS +E K+L QTL  KRNG+++ A+Y  +                  KD RL + 
Sbjct: 1   MSIRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIG 60

Query: 60  VITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPY 119
           ++TRVL+ LI KHIELY+ I+E++ + ++T+I+ +DVI +ITFD+ KDE+INCH G PPY
Sbjct: 61  IVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPY 120

Query: 120 LLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY-M 178
           LLRHIFNK  F+L   KPLWKLYIIDET IIFHGFDMLFD FSAA FHK F  E+N Y +
Sbjct: 121 LLRHIFNKEKFEL--NKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFL 178

Query: 179 SSIVSSKQKKPLDYLFQLS-SSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFF 237
           ++  S    KPLD +F+++ S  + +  ++E PRSI+D        +T  +FN QTKSFF
Sbjct: 179 TNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFF 238

Query: 238 KSLYLNAVKKPIEFITNTSSQVKT--YQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSC 295
           K++Y N +KKPI+    ++S  K     Q+KE +T  YL+ +GI  SLCG T+FGT+S  
Sbjct: 239 KTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPT 298

Query: 296 RFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLY 355
           R+N L     +++I L+S ICG++M+ LKP++ ++S N++FSI +NLR+ +  +K FGL+
Sbjct: 299 RYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLF 358

Query: 356 YRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKI 415
           Y+D+ I+CPLSLIDDR  +++GY+D       +LE  EK+ E QFK VT +I+NV+ E++
Sbjct: 359 YKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLEYQFKQVTEFIENVILERL 418

Query: 416 GYWXXXXXXXXXXXXXX-----XXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVT 470
             W                         +IIQIND TEI + EN + N  + + + +   
Sbjct: 419 KIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLGENDNNNKAFTLTNPNFTR 478

Query: 471 SLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
           +LS  E  SVS+  CE +GL + IH P   SME+FVE FQ F++E
Sbjct: 479 TLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIEE 523

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  360 bits (924), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/523 (39%), Positives = 299/523 (57%), Gaps = 32/523 (6%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R LS +E KLL Q++ G +NG  F A+Y                    KD RL L ++T+
Sbjct: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEYS---TFKEGWSDEEATLLTVKDSRLCLGLLTK 61

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            L+ LI KHIEL+  I+E   + ++ +I+  DVI  I FDS KDE+INC LG PPYLLRH
Sbjct: 62  ALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRH 121

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           IFN   F  G  KPLWKLY++D++   FHG D LFD FS A FH+  L EVN     ++S
Sbjct: 122 IFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVN-----LLS 176

Query: 184 SKQK--KPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLY 241
           S+ +  K LDY+F+     D +    ++P+SIYD        L   +FN QT+SFFKS+Y
Sbjct: 177 SRPQKWKKLDYVFKF--GPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIY 234

Query: 242 LNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELT 301
           +N VKKPIEF+TNT     +           Y + + I+  LCGNT+FG +S+ RF  L 
Sbjct: 235 VNTVKKPIEFLTNTDVSFLSLNS-----NMKYNDILDINSKLCGNTVFGCVSNERFKYLN 289

Query: 302 EKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIII 361
               +E + LKS I G+ M+ LKP + + S  + FSI V+LR  V + + FGLYY+DI +
Sbjct: 290 TIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRV 349

Query: 362 ECPLSLIDDRAIQFSGYRDHV-GITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYWXX 420
           ECPLSLIDD        +D + G +  E +  EK+ E QFK++T +++N + +++  +  
Sbjct: 350 ECPLSLIDDDK-----SKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTRFSK 404

Query: 421 X--------XXXXXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSL 472
                                       IQI D + I++NE   + + + +++ ++  SL
Sbjct: 405 TGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNE-FGEPNSFMIRACNLTKSL 463

Query: 473 SKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
           + +E+ S+SYT+CE +GL I IH P+   MESFVE FQ+FL+E
Sbjct: 464 NSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLEE 506

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/524 (37%), Positives = 295/524 (56%), Gaps = 31/524 (5%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSV 60
           M  R L  +E K+L Q+L+G RNGV F A Y                    KD RL LS+
Sbjct: 1   MSFRSLGGFEKKILSQSLEGHRNGVVFGAMYS----TTPEEWSDDATLLTYKDSRLNLSL 56

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120
           ++R L  +I  H+EL+T I+E   ++ V EI+A++VI+ +TF S KDE +NC  G PPYL
Sbjct: 57  LSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYL 116

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180
           LRHIFN++ F+ G    LW++Y++DET ++FHG D+LFD FSAA FHK FL  +NS    
Sbjct: 117 LRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSI--- 173

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240
              SK    L  +F+L  +     +    P+SIYD          A +FN QT+SFFKSL
Sbjct: 174 ---SKSGSKLSTIFKLEKA-----VLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSL 225

Query: 241 YLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNEL 300
           Y NAVKKP+++I +        QQ+KE  T  Y + +    +LCG TIFG I   R   L
Sbjct: 226 YFNAVKKPLDYINSNPP-----QQLKEYRTR-YADILRTDNNLCGTTIFGRILPKRLESL 279

Query: 301 TEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDII 360
                ++ I LKS +CG+ M+ LKP + +++ ++ F + V+LR  +  S  FG++Y+DI 
Sbjct: 280 DCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIR 339

Query: 361 IECPLSLIDDRAIQ----FSGY-RDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKI 415
           +ECPLSLIDD+       ++GY    V +  ++    E++ E QFK VT ++   + +++
Sbjct: 340 VECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRM 399

Query: 416 GYWXXXXXX----XXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVTS 471
             W                        ++IQIND+++I ++ +   +  + ++  +M  S
Sbjct: 400 KAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQS 459

Query: 472 LSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
           L   ++ S+SYTH E  GL I IH P   +MESFVE FQ+F+++
Sbjct: 460 LKPGQLMSLSYTHSE-KGLDICIHYPDGYNMESFVECFQSFIED 502

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  335 bits (860), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/528 (36%), Positives = 302/528 (57%), Gaps = 34/528 (6%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSV 60
           M  R LS YE K+L++T++ +RNGV F A Y                    KD R T+++
Sbjct: 1   MTLRTLSSYERKILDETIRRERNGVIFTASYS----ASSEEWGDDTTLLTLKDSRPTIAI 56

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120
           +T+ +Q LI +H+EL+T I+E++ + ++  I+  D+++I+ FDS KDE+INCH G PPYL
Sbjct: 57  LTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYL 116

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180
           LRHIF+ + F  G +KPLW L+IIDE+ +IFHG DMLFD FSAA FHK  L E N   + 
Sbjct: 117 LRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANE 176

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240
            + S +    D +F L +S   I    ++ +SIYD         +  +FN QT+SFFKS+
Sbjct: 177 PLDSSES---DIIFSLENSIKKINNL-KLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSV 232

Query: 241 YLNAVKKPIEFIT-----------NTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIF 289
           + + VKKPI ++            NT S+V T Q+        Y +    + +L   T+F
Sbjct: 233 FHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQK--------YTDIFDYNTTLNNTTVF 284

Query: 290 GTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKS 349
           G I+  R+  L    T ++I  KS + G+IM+ LKP++ +F  +M FSI +NLR  + +S
Sbjct: 285 GKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKES 344

Query: 350 KT-FGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQ 408
              FGL+Y+D++I+ PLSLIDD A+  SGYRD    +  + +  EK+ E QFK VT+ ++
Sbjct: 345 NIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRD---FSDNDPDLTEKILEFQFKRVTSLVK 401

Query: 409 NVMNEKIGYWXXXXXXXXXXXXXX--XXXXXXEIIQINDLTEIDINENLSQNDPYCVKSS 466
           +++  +I  +                      +II++ D +E+ +     ++  Y + ++
Sbjct: 402 DLIERRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSG-KRDGKYILHNT 460

Query: 467 SMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           +   SL K + FSVSYT C+ SGL + +  P    ME+FVE FQ+F++
Sbjct: 461 NFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  335 bits (860), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/549 (36%), Positives = 300/549 (54%), Gaps = 52/549 (9%)

Query: 3   SRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRR------- 55
           SR LS YE KLL + L+  +NG  F A Y  +                    R       
Sbjct: 2   SRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTK 61

Query: 56  -----LTLSVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERI 110
                LTL ++TR L+ LI K+ E+YT +++   ++ + EIR  DVI ++TFD+EKDE++
Sbjct: 62  KPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKV 121

Query: 111 NCHLG-PPPYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKC 169
           NCH G PPPYL+RHI     F+ G  KPLW LY+IDE+ ++FH  D+LFD FSAA FHK 
Sbjct: 122 NCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKL 181

Query: 170 FLAEVNSYMSSIVSSKQ--KKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV 227
           FL E    + ++   +Q  +KPL+YLF+L  S +    Y  +P+SIYD            
Sbjct: 182 FLKE----LIAVCRPQQSYEKPLEYLFKLQKSFE--NNY-SVPKSIYDNLKLHLPATRPE 234

Query: 228 MFNDQTKSFFKSLYLNAVKKPIEFITNTSSQV---------------KTYQQIKEAETEG 272
           + N QT+SFFKS++ NAVKKP++FI    + +               +   Q+K   T  
Sbjct: 235 LLNLQTQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTR- 293

Query: 273 YLNPMGIHRSLCGNTIFGTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSK 332
           Y N +    S CG+TIFG++S+ RFN L      E+I L+S I  + M+ LKP +  F+ 
Sbjct: 294 YTNILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNG 353

Query: 333 NMVFSIRVNLRDDVSKSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETY 392
            ++FS+ +NLRD +++ + FGL Y+DI +ECPLS+IDD+           G+   + E  
Sbjct: 354 TLIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVP------GLNESDPEYN 407

Query: 393 EKVYEQQFKDVTTYIQNVMNEKIGYWXX------XXXXXXXXXXXXXXXXXXEIIQINDL 446
           EK+ E QF+ + TY+   + +++  W                           +I+IND+
Sbjct: 408 EKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDV 467

Query: 447 TEIDINENLSQNDPYCVKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFV 506
           +E+  ++N     P+ +KS    TSLS+  + S+SYTHCE  GL I IH P   +ME+FV
Sbjct: 468 SEVSFDDN-DIRFPH-IKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFV 525

Query: 507 ENFQAFLDE 515
           + F++F++E
Sbjct: 526 DCFESFMEE 534

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/526 (34%), Positives = 297/526 (56%), Gaps = 29/526 (5%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYXXXXXXXXXXXXXXXXKDRRLTL 58
           R LS +E KLL Q+L  +RNG  F++ Y +     N                  D RLTL
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLTL 64

Query: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117
            +I   L+ LI     L+  I+E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 65  PLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVPP 124

Query: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177
           PYLLRH FNK+ F  G  +PLW LY+IDET ++FHG D+LFD FSAA FHK FL E+N+ 
Sbjct: 125 PYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNN- 183

Query: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSPFAPLTAVMFNDQTKSF 236
           +SS+   + +     LF +++    + I D   P+SIYD        +T  +F+ QT+SF
Sbjct: 184 ISSVTHYEDR----ILFDINN----VSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSF 235

Query: 237 FKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCR 296
           FKS++ N +K+P  ++TN   Q          + + Y + +  H SLCG T+FG +S+ R
Sbjct: 236 FKSIFYNTLKRPFGYLTN---QTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQR 292

Query: 297 FNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYY 356
           FN L     +E I L+S ICG+ M+ LKP + DFS  +VFSI ++LR  +   ++ GL++
Sbjct: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFF 352

Query: 357 RDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIG 416
           +++ I CPLSLIDD  +  + +  +     ++ E  EK+ E QF +VT ++ + +  K+ 
Sbjct: 353 KELRIACPLSLIDDE-LSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKHVSSFIMAKLK 411

Query: 417 YWXXXXXXXXXXXXXX--------XXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSM 468
            W                            +++QIND+++I ++ N + +  + + SS  
Sbjct: 412 SWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMN-NDDKSFKIVSSGF 470

Query: 469 VTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
            +S+++  + S+SYT+C+  GL I IH P   ++ESFVE F++F++
Sbjct: 471 TSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/529 (35%), Positives = 291/529 (55%), Gaps = 36/529 (6%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYXXXXXXXXXXXXXXXXKDRRLTL 58
           R LS +E KLL Q+L  +RNG  F++ Y +     N                  D RLTL
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLTL 64

Query: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117
             I   L+ LI     L+  ++E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 65  PSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPP 124

Query: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177
           PYLLRH FNK+ F  G  KPLW LY+IDE  ++FHG D+LFD FSAA FHK FL E+N+ 
Sbjct: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNN- 183

Query: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSPFAPLTAVMFNDQTKSF 236
               +S +       LF +S     + I +   P+SIYD        +T  +F+ QT+SF
Sbjct: 184 ----ISLEAHSDDRVLFDISD----VNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSF 235

Query: 237 FKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCR 296
           FKS++ N +K+P  ++TN   Q          + + Y + +  H SLCG T+FG +++ R
Sbjct: 236 FKSIFYNTLKRPFGYLTN---QTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQR 292

Query: 297 FNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYY 356
           FN L     +E I L+S ICG+ M+ LKP + DF+  +VFSI ++LR ++   ++ GL++
Sbjct: 293 FNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFF 352

Query: 357 RDIIIECPLSLIDDR--AIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEK 414
           +++ IECPLSLIDD   A +F   R+       + E  EK+ E QF  VT ++ + +  K
Sbjct: 353 KELRIECPLSLIDDELSADEFLANRND---KEDDDEFNEKLMEYQFNKVTKHVSDFIMAK 409

Query: 415 IGYWXXXXXXXXXXXXXX-------XXXXXXEIIQINDLTEIDINENLSQNDPYCVK--S 465
           +  W                           ++IQIND+++I ++ N   ND    K  S
Sbjct: 410 LKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMN---NDEKAFKIIS 466

Query: 466 SSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           S   +S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 467 SGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/525 (34%), Positives = 290/525 (55%), Gaps = 26/525 (4%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGR-----NYXXXXXXXXXXXXXXXXKDRRLTL 58
           R LS +E K+L Q+L  +RNG  F++ Y +     N                  D RLTL
Sbjct: 5   RPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLTL 64

Query: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117
            +I   L+ LI     L+  ++E+  +  + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 65  PLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPP 124

Query: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177
           PYLLRH FNK+ F  G  KPLW LY+IDE  ++FHG D+LFD FSAA FHK FL E+N  
Sbjct: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNE- 183

Query: 178 MSSIVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFF 237
           +S++  S+ +   D      +  +L ++  + P+SIYD        +T  +F+ QT+SFF
Sbjct: 184 ISTVTHSEDRILFDV-----NDINLSEL--KFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236

Query: 238 KSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRF 297
           KS+Y N +K+P  ++TN   Q      +   + + Y + +  H SLCG T+FG +++ RF
Sbjct: 237 KSIYYNTLKRPFGYLTN---QTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRF 293

Query: 298 NELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYR 357
           N L     +E I L+S ICG+ M+ LKP + DFS  +VF+I +NLR+ +    + GL+++
Sbjct: 294 NYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFK 353

Query: 358 DIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGY 417
           ++ +ECPLSLIDD         +       + E  E++ E QF  VT ++   +  K+  
Sbjct: 354 ELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTKHVSGFIMAKLRS 413

Query: 418 WXXXXXXXXXXXXXX--------XXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMV 469
           W                            ++IQIND+++I ++ N   +  + + S+   
Sbjct: 414 WEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMN-GDDKSFKIVSTGFT 472

Query: 470 TSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           +S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 284/519 (54%), Gaps = 28/519 (5%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           RQL  YE KL+ Q L G+ NG+ F+AKY  N                  +  L  S +  
Sbjct: 5   RQLGTYEKKLVGQALAGQSNGIIFSAKYISN---AQDGLTDDATLLTNSEPLLLDSRLVN 61

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            LQ ++ KH EL T ++E   +  V EI+  D+I  + FDS KDE +NCHLG PPYLLRH
Sbjct: 62  ALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRH 121

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           IFN++ F  G  KPLW+L +ID++ ++FHG D+LFD F+AA FHK FL  +NS     + 
Sbjct: 122 IFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNS-----MD 176

Query: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243
            +    L+Y+++  ++     I    PR+IY+         T  + N QT+SFFKS Y+N
Sbjct: 177 DEHITDLEYIYRYDATKSNRSI--SFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVN 234

Query: 244 AVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTEK 303
           A+KKP++ IT  S  +K    IK  E    ++ M    +LCG T+FG I++ RF  L   
Sbjct: 235 AIKKPLDIITFNSEPMK---YIKPNE----IDFMNEASALCGTTVFGHITTDRFEYLNSI 287

Query: 304 ATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIEC 363
           A  E + ++S ICG+ ++ LK  + DF+ ++ FSI VNLR+ +     FGL+Y+ I++EC
Sbjct: 288 ARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVEC 347

Query: 364 PLSLIDDRAIQ----FSGYRD-HVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYW 418
           PLSLIDD+       ++GY + +V +   +    EK  E QFK ++  +   M E++  W
Sbjct: 348 PLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTTMKERMRAW 407

Query: 419 XXXXXX----XXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLSK 474
                                   +IIQIND++E  IN + S      +K  +   S+S 
Sbjct: 408 RRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFKINSSKSSK--VSIKELNFTHSISN 465

Query: 475 KEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFL 513
            +  S+SYT+C+ +G  I IH P    ME FVE FQ+F+
Sbjct: 466 SDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/529 (35%), Positives = 296/529 (55%), Gaps = 33/529 (6%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXX-----XXXXXXXXXXKDRRLTL 58
           R LS +E KLL Q+L  +RNG  F++ Y ++                       D RLTL
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRLTL 64

Query: 59  SVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLG-PP 117
            +I   L+ LI     L+  ++ED  Y+ + +++  D++++I F++ KD+ +NCH G PP
Sbjct: 65  PLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVPP 124

Query: 118 PYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSY 177
           PYLLRH FNK+ F  G  KPLW LY+IDET ++FHG D+LFD FSAA FHK FL E+NS 
Sbjct: 125 PYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNS- 183

Query: 178 MSSIVSSKQKKPLDYLFQLS--SSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKS 235
           ++S+  S  +     LF ++  + A+L       P+SIYD        +T  + + QT+S
Sbjct: 184 ITSVSRSDDR----VLFDINDVNFAEL-----SFPKSIYDSAKLRLPAMTPQILHKQTQS 234

Query: 236 FFKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSC 295
           FFKS++ N +K+P  ++TN   Q         ++ + Y + +  + SLCG T+FG +++ 
Sbjct: 235 FFKSIFYNTLKRPFGYLTN---QTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQ 291

Query: 296 RFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLY 355
           RF+ L     +E I L+S ICG+ M+ LKP + DFS  +VFSI ++LR  ++  ++ GL+
Sbjct: 292 RFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLF 351

Query: 356 YRDIIIECPLSLIDDR-AIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEK 414
           ++++ IECPLSLIDD  +I       +        E  EK+ E QF  VT ++ N +  K
Sbjct: 352 FKELRIECPLSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTK 411

Query: 415 IGYWXXXXXXXXXXXXXX--------XXXXXXEIIQINDLTEIDINENLSQND-PYCVKS 465
           +  W                            ++IQIND++  DI+ ++S +D  + + S
Sbjct: 412 LKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVS--DISLSMSNDDKSFKIVS 469

Query: 466 SSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           S    S+++  + S+SYT+CE  GL I IH P   ++ESFVE F++F++
Sbjct: 470 SGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  311 bits (797), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 183/522 (35%), Positives = 281/522 (53%), Gaps = 32/522 (6%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R LS  E KL  Q L  KRNG+ FAA Y   +                KD+RL+ S+++R
Sbjct: 8   RSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTV-KDQRLSNSLVSR 66

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            L+ +I  ++ELYT I+++  +  V  I   DV+  + FDS KDE +NCH G PPYLLRH
Sbjct: 67  ALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLRH 126

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           IF+K+ F+  + KPLW++ I+DET +IFHG D+LFD F+AA FHK F   +N        
Sbjct: 127 IFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQL------ 180

Query: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243
            K    L+ LF+  S A         P+SIY+        +   +F  QT+SFFKS+Y  
Sbjct: 181 PKDGPTLECLFKNDSKASF------FPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNW 234

Query: 244 AVKKPIEFI-TNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTE 302
            +KKP++FI TN +S +K YQ         Y + +    +LCG T+FG IS+ R   L +
Sbjct: 235 TIKKPLDFINTNPNSGLKYYQSC-------YTDILLGANNLCGTTVFGNISAERVCALKK 287

Query: 303 KATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIE 362
              +E I L S +C + ++ LKP +N+F  ++ FSI V+LR  + ++  FGL Y+++++E
Sbjct: 288 IMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVE 347

Query: 363 CPLSLIDDRAIQ----FSGYR-DHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGY 417
           CPL+LIDD+  Q    ++GY   +   T ++    E + E QF++  T++ N + ++   
Sbjct: 348 CPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRA 407

Query: 418 WXXXXXX----XXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMVTSLS 473
           W                         II++N++TE     ++  N  + +K      S +
Sbjct: 408 WERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQF--HVDDNATFNIKDVCFTKSQN 465

Query: 474 KKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
            +   S+S    E SGL + IH P   +M+ FVE FQ+F++E
Sbjct: 466 LETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFMEE 507

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  293 bits (749), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 186/532 (34%), Positives = 273/532 (51%), Gaps = 39/532 (7%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSV 60
           M  R L+ YE  +L ++ + + NG  F+AKY                    ++  +  S 
Sbjct: 1   MPFRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNM-FSR 59

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120
               L  +I ++ ELYT I+    +  +TEI+  DVI  I F+S KDE +NC  G PPYL
Sbjct: 60  FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYL 119

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180
           LRHIFNK  F  G  KPLW LYI+D++ +IFHG D+LFD +SAA FH+ F A +      
Sbjct: 120 LRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEG---- 175

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV---MFNDQTKSFF 237
             ++   + L  +F+LS  +     Y   P+SIYD   SP   L A    + + QT+ F 
Sbjct: 176 --ATPTSEKLTTIFRLSDLSKSALTY-PFPKSIYD---SPLLMLPAKTIDLVSLQTRFFL 229

Query: 238 KSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGI---HRSLCGNTIFGTISS 294
           KS+    + KP+  I      +K++            +PM I     SLCG T+FG IS+
Sbjct: 230 KSVVSKTIVKPLNIIMFNDEPMKSFTNS---------DPMDILEKTSSLCGTTVFGNISN 280

Query: 295 CRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGL 354
            RF+ L   A  E +  KSL+CG+ M+ LKP + DFS N+ FSI +NLRD + +S  FGL
Sbjct: 281 ERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGL 340

Query: 355 YYRDIIIECPLSLIDDRAIQF-SGYRDHVGITAQELETYEKVYEQ----QFKDVTTYIQN 409
           +Y+++ IE PLS IDD   +  + Y  +    +   ET     EQ    QF  + T+I  
Sbjct: 341 FYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFISR 400

Query: 410 VMNEKIGYWXXXXXX----XXXXXXXXXXXXXXEIIQINDLTEID---INENLSQNDPYC 462
            + +++  W                        +IIQIND++++    +N+N   N    
Sbjct: 401 NLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELNS-VS 459

Query: 463 VKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           +K  S   SL   +  S+SYTHC+++G  I IH P++  +E FVE FQ F+D
Sbjct: 460 LKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  278 bits (712), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 184/523 (35%), Positives = 280/523 (53%), Gaps = 30/523 (5%)

Query: 1   MCSRQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTL-S 59
           M  R L  YE K+L QT++G+RNGV F+++   N                     ++L S
Sbjct: 1   MPFRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKS 60

Query: 60  VITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPY 119
           V+   LQ +I  H+ELYT I++   ++ V +I   DVI  I++D  KD+ +         
Sbjct: 61  VLCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDK 119

Query: 120 LLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMS 179
           LLRHIFNK DFK    KPLW+  I +++T+IFHG D+LFD FS A F K  L E    M+
Sbjct: 120 LLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKE----MN 175

Query: 180 SIVSSKQK-KPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFK 238
            +++S QK K +  LF+  +   L       PRSIY+        LT+ + N QT+SFFK
Sbjct: 176 DVLNSNQKLKTVKTLFKFDAERSLTNY----PRSIYENPKLHLPALTSDLLNLQTQSFFK 231

Query: 239 SLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFN 298
           ++Y N +KKPI+ IT+ +S      Q+ E  T    + +    SLCG T+ G IS  R+ 
Sbjct: 232 TIYQNTLKKPIDLITSANSN--NNNQLSEYRTRN-TDILSGANSLCGRTVLGEISLERYQ 288

Query: 299 ELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRD 358
            L     +E ISL+S I  + M+ LKP + +F  +++FSI VNLR  ++ S  FGL+Y++
Sbjct: 289 HLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKN 348

Query: 359 IIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYIQNVMNEKIGYW 418
           I +ECPL LI+D       Y +   + + +  +   + E QF+ ++ ++ +V+++++  W
Sbjct: 349 IKVECPLELINDEKY----YTNPEVLHSMQNNS---LLEIQFERISRHVSDVISQRMKAW 401

Query: 419 X----XXXXXXXXXXXXXXXXXXXEIIQINDLTEIDI---NENLSQNDPYCVKSSSMVTS 471
                                    IIQIND+TEI     N+N+S +  + V + +   S
Sbjct: 402 EKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYS--FSVNNLNFTKS 459

Query: 472 LSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           LS  E  S+ Y+H    GL I IH P   +ME+FVE FQ+F++
Sbjct: 460 LSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  260 bits (664), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 170/526 (32%), Positives = 263/526 (50%), Gaps = 38/526 (7%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R L+  E  +L +T  G +NGV F+A Y +N+                 ++RL+ S+I +
Sbjct: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDM--NQRLSDSMIWK 66

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            L  +I +H EL  A+S +  +  V +I  +DV+  I FD   DE++NC+ G PPYLLRH
Sbjct: 67  ALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRH 126

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           IF+K  F LGQ++PLW+L++ID T ++FHG D+LFD+F+AA FHK FL  +NS   S  S
Sbjct: 127 IFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESCTS 186

Query: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243
            +       +F+        KI   +PR+++       A      F  Q+++  +SLY  
Sbjct: 187 PRP------VFKGG------KILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNL 234

Query: 244 AVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTEK 303
           A+KKP+ FI +   +  T Q        G   P+     LCG  +FGTIS+ RF  L   
Sbjct: 235 AIKKPLRFIESGRIEHSTEQH------SGTPEPLNYPNHLCGTVVFGTISTPRFKILKGI 288

Query: 304 ATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIEC 363
               +IS+K+ I    +  L+P L+     + FS+ +NLRD +  S   G+Y+R+++IEC
Sbjct: 289 LNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIEC 348

Query: 364 PLSLIDDRAIQFSG-YRDHV----GIT---AQELETYEKVYEQQFKDVTTYIQNVMNEKI 415
           PL      +   +G Y  +     G+T   A +    +   E  F+   T++ N + + +
Sbjct: 349 PLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKAL 408

Query: 416 ------GYWXXXXXXXXXXXXXXXXXXXXEIIQINDLTEIDI-NENLSQNDPYCVKSSSM 468
                  +                     +II+INDL+EID+ N N SQ   Y V+    
Sbjct: 409 QDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQ---YVVEDICA 465

Query: 469 VTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
             S       S+SY+     GL + IH  +   M  FVE+F+AFL+
Sbjct: 466 TKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  220 bits (561), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 155/531 (29%), Positives = 266/531 (50%), Gaps = 55/531 (10%)

Query: 4   RQLSEYEVKLLEQTLQGK-RNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVIT 62
           R LS  E + L  +L+ + R+G   + K+  N                 KD+ LT+S+++
Sbjct: 13  RPLSSVEKRFLGNSLESETRHGSVCSGKWVSN----SLDISDDATLLSSKDKPLTISLVS 68

Query: 63  RVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLR 122
           R L+ILI  HIE++T I+++  + L+ +I   DV+  I F+++KDE +NCH G PPYL+ 
Sbjct: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128

Query: 123 HIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIV 182
           +IF+   F+   +KPLW+L+I++ + ++F+G D LFD F+ A F K     +N    S+ 
Sbjct: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIIN----SLP 184

Query: 183 SSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV---MFNDQTKSFFKS 239
              ++   D +F+L +  ++ KI    P+SIYD   +P   L A    +FN QT+SFFKS
Sbjct: 185 YENKEIQDDIIFKLPNIRNISKI--NFPKSIYD---NPMLHLPATKPELFNLQTQSFFKS 239

Query: 240 LYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNE 299
           +YLN  KK  +++ N + Q           ++ Y   + ++  +    + G +S  R+ +
Sbjct: 240 IYLNTFKKSFDYL-NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQ 298

Query: 300 LTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRD--------------- 344
           L +    E+I LKS  C +I+M LK  +  F  +++F I  NLR                
Sbjct: 299 LLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSG 358

Query: 345 DVSKSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVT 404
               +   G+ Y+DI +E PL LI           + +G         E V E+QFK V 
Sbjct: 359 PEDSANELGIIYKDIYVEVPLKLI-----------EKIG--------NEDVVEEQFKIVC 399

Query: 405 TYIQNVMNEKIGYWXXXXXXXXXXXXXXXX-XXXXEIIQINDLTEIDINENLSQNDPYCV 463
            YI   + ++I  W                      II++NDLT +D+  + S++  + +
Sbjct: 400 NYINESIQKRIKAWEKNGFNDDDIKRMKFGYEQVGNIIEVNDLTSLDL--SCSKDSLFHI 457

Query: 464 KSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
           +  S+  +L K ++ S+S+     +GL + I+      M+ F++ FQ+F++
Sbjct: 458 EDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  210 bits (535), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 149/526 (28%), Positives = 251/526 (47%), Gaps = 37/526 (7%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R L+  E  ++ +T  G +NGV F++ Y                    K   L  +++ +
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKG--LPDAIMWQ 66

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            L  +I ++ EL ++I++  ++  +  I   DV+  I FD+  DE+++C+ G PPYLLRH
Sbjct: 67  ALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRH 126

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           IF+K  F +GQQKPLW++++ID++ ++FHG D+LFD F+AA FHK FL  +NS+     +
Sbjct: 127 IFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSFR----N 182

Query: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLT-AVMFNDQTKSFFKSLYL 242
            K +K  D +F+  +  DLI +   +     +++ S  + +   V+   QT    K+LY 
Sbjct: 183 VKGQKS-DLIFK--TREDLIPLCQSLAA---EHNVSLISSVKDQVLTYSQTA--LKNLYS 234

Query: 243 NAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTE 302
            A+KKP+ FI +   +          +   Y         LCG  +FG ++  R   L  
Sbjct: 235 LAIKKPLRFIESGRLEHSGIPASNPYDLASYAG------DLCGTVVFGNVNPERVRGLRA 288

Query: 303 KATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIE 362
                +IS +S I  + M  L P L    + ++FS+ +NLR+ +  +   G++  +++ E
Sbjct: 289 LMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFE 348

Query: 363 CPLSLIDDRAIQFSGYR------------DHVGITAQELETYEKVYEQQFKDVTTYIQ-- 408
           CPL LI       SG                VG   ++    + V+ +    VTT ++  
Sbjct: 349 CPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELA 408

Query: 409 NVMNEKIGYWXXXXXXXXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSM 468
            +  EK                        +I++INDL E+D++  +     Y +     
Sbjct: 409 AMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSR--YKIGDVCS 466

Query: 469 VTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
            +S       S+SY   E SGL + IH  +  +ME FVE+F+ FLD
Sbjct: 467 TSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  202 bits (513), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 145/526 (27%), Positives = 251/526 (47%), Gaps = 43/526 (8%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R LS  E    ++    +RNG+ FA  Y  N                 +D RL    I+ 
Sbjct: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNYSSN-KCESERWSDDITLSNLRDSRLFDGQISN 67

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
            L+ +I +++EL   I++D +++    IR  DV+  I F + KDE I C  G PPY+LR+
Sbjct: 68  ALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRN 127

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183
           I   + F+ G  +PLW+L I+D T +I H  +++FD F+AA FH  F   ++ +      
Sbjct: 128 ILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQF------ 179

Query: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSS---PFAPLTAVMFNDQTKSFFKSL 240
            K    LD LF            +E+  S  ++D       +P+ ++    Q  S  K  
Sbjct: 180 PKDTHALDILFVYEG--------NELQLSKTNFDGMSQISVSPVQSLPL--QCISVLKGA 229

Query: 241 YLNAVKKPIEFITN---TSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRF 297
           Y   VKK +  I      ++Q+ TY+  K    +   NP     +LCG T+ G++++ R 
Sbjct: 230 YRTTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNP----NTLCGTTVSGSLNAERL 285

Query: 298 NELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYR 357
             L E  + E + + S++C + ++SLKP +  F+ ++ F + +++R+ + +    G+ Y 
Sbjct: 286 ASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKL-EIFDLGVSYT 344

Query: 358 DIIIECPLSLIDDRAIQFSGYRDHV----GITAQELETYEKVYEQQFKDVTTYIQNVMNE 413
           ++++ECPLS I+D+  Q +    ++     I     +  E + E QFK +T+++ N + E
Sbjct: 345 NLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMNSLKE 404

Query: 414 KIGYWXXXXXXXXXXXXXXXXXXXXEI----IQINDLTEIDINENLSQNDPYCVKSSSMV 469
           K   W                     I    I+IN    +D+ E  +Q+  +  K+ +  
Sbjct: 405 KKQAWQKRRFDMSSLKGKKLRRSNKIIRGKFIEIN---LVDMGE--AQDGQFHTKNVNFT 459

Query: 470 TSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
           +SL  K + SVS       G+ I +H P+   M++FVE FQ  L++
Sbjct: 460 SSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  176 bits (446), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/466 (28%), Positives = 223/466 (47%), Gaps = 47/466 (10%)

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYL 120
           I+  L+ +I +++E+   +++  +++ V+ I   DV+ +I F + KDE I CH G PPY+
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYV 106

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCF-----LAEVN 175
            RHI NKS F+ G  KPLW++YI D + +IFH  ++LFD F+A  FH  F       E N
Sbjct: 107 ARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKN 164

Query: 176 SYMSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSPFAPLTAVMFNDQTK 234
              +  +   +  PL    QL    D   +   ++P       SSPF      +     K
Sbjct: 165 EPHNETLFVYEGGPL----QLPIDPDACSLPGVDVPYPA----SSPFVSFVKNVCRYALK 216

Query: 235 SFFKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISS 294
            F     L +   P   +  +S   K +    + E            SL G T+ G ++S
Sbjct: 217 PFGA---LASAVTPSLRLNRSSLGRKPFLLTLDKE------------SLYGTTVSGYLNS 261

Query: 295 CRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGL 354
            + + L +  ++E++ ++S +C + ++SLKP + +F  ++ FSI ++LR +  K+  FG 
Sbjct: 262 KKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGF 321

Query: 355 YYRDIIIECPLSLIDDRAIQFSGYRD----HVGITAQELETYEKVYEQQFKDVTTYIQNV 410
             + I+++CPL+LIDDR  +    R        +     +  E + E QFK VTT++   
Sbjct: 322 QSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKS 381

Query: 411 MNEKI-GYWXXXXXXXXXXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVKSSSMV 469
           +  +  G W                    +II+IN    +D+  + S    + +K+ +  
Sbjct: 382 LTAQTSGDW------TGKRKYSKCQLRKKKIIEIN---VVDMGTSPSAR--FQIKNMNFT 430

Query: 470 TSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515
            SL  +   S+S       G+ + +H  +  SM+ FV+ FQ FLDE
Sbjct: 431 DSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  116 bits (291), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 117/230 (50%), Gaps = 12/230 (5%)

Query: 288 IFGTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVS 347
           +FGTI++ RFN L     + +I L+S+ICG++M+  KP + +F  N+ FSI V+++  V 
Sbjct: 25  LFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIVD 84

Query: 348 KSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVTTYI 407
            S  FG+  ++II++CPL LIDD+      Y+D    T  E      + E QF+ VT ++
Sbjct: 85  DSSQFGILKKNIIVDCPLKLIDDKH-----YKD----TDSESIKNGDILEIQFRKVTDFV 135

Query: 408 QNVMNEKIGYWXXXXXXXX---XXXXXXXXXXXXEIIQINDLTEIDINENLSQNDPYCVK 464
              ++ K+                          ++IQINDLT+I         + Y   
Sbjct: 136 TEELSNKLQSMAKHFKRNNCPFNFSSINSQISDSKVIQINDLTDIPFTTTEQNPNGYSFH 195

Query: 465 SSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514
              +   LS  E  S+SY     S ++ISIH  + + M+SFVE F+ F++
Sbjct: 196 DLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTFIE 245

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 55/119 (46%), Gaps = 17/119 (14%)

Query: 64  VLQILIPKHIELYTAI-SEDHRYSLV----TEIRAKDVIDIITFDSEKDERINCHLGPPP 118
           VL+ LIPKH  LY  I ++D    LV     EIR  DV++   FDS  +   N       
Sbjct: 41  VLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEETGFDSLDESAANS------ 94

Query: 119 YLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEVNS 176
                I   S F+  QQ+PLWKL  +   T     FD   FD  SA  F   F++ +NS
Sbjct: 95  -----ILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDGMSAVIFWNDFISALNS 148

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 120/279 (43%), Gaps = 46/279 (16%)

Query: 61  ITRVLQILIPKHIELYTAISEDHRYSL-----VTEIRAKDVIDIITFDSEKDERINCHLG 115
           I   L+  I  H +L+  ++ D   ++     V  I+  DV++ +++D   D  I CH  
Sbjct: 41  IAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTI-CH-- 97

Query: 116 PPPYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEV 174
                   IF   +F    +KPLWK+ +  +   +    D  LFD  SA  F K      
Sbjct: 98  --------IFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWK------ 143

Query: 175 NSYMSSIVSSKQKKPLDYLFQLSSSADLIK---IYDEIPRSIYDYDSSPFAPLTAVMFND 231
            S+MSS+ SS  +   D L++L+    + +   +Y+  P S   + S+    +  V+F  
Sbjct: 144 -SFMSSL-SSDARDDFDLLYELTGDPMVQEDSHVYENWPTS---WSSTLTKAIAGVIF-- 196

Query: 232 QTKSFFKSLYLNAVKKPIEFITNT-SSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFG 290
               F  S+  +  K  + F   +    + T++   ++  E   N   ++  +  + + G
Sbjct: 197 ---KFMPSVITSVGKDQLRFNGYSFPDSLLTHKPDDDSSYEIRNNNRQLNLQVQPDHLNG 253

Query: 291 TISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLND 329
            IS+C+           Q+SL S I  LI MSL+  + D
Sbjct: 254 IISACK---------SHQVSLTSFITALISMSLQLKIED 283

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 3/138 (2%)

Query: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYXXXXXXXXXXXXXXXXKDRRLTLSVITR 63
           R L+E E   L+QT +G  NG+ F+ K  +                   + +L L    +
Sbjct: 3   RILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKSLK 62

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123
           +L   IPK+ EL T + E+  +  + E++  DV+ II +   K +      GP   L+  
Sbjct: 63  LL---IPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119

Query: 124 IFNKSDFKLGQQKPLWKL 141
           I+  S+F+ G  KP  KL
Sbjct: 120 IYYHSNFQPGSGKPYGKL 137

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 18/126 (14%)

Query: 57  TLSVITRVLQILIPKHIELYTAISEDHRYSLVTE-----IRAKDVIDIITFDSEKDERIN 111
           T S I + ++ ++P++ +LY+ +   +  SLV E     +   DV++    +S  +E  N
Sbjct: 34  TRSEIVQAVRAVVPEYPQLYSDVVTRNG-SLVLEPLQSTLVLSDVVEFTEMESLDEEHSN 92

Query: 112 CHLGPPPYLLRHIFNKSDFKLGQQKPLWKLYII-DETTIIFHGFDMLFDSFSAAYFHKCF 170
                       IF +  F  G +KPLWK+ I+ D+ T +     ++ D  SA  F   F
Sbjct: 93  -----------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSF 141

Query: 171 LAEVNS 176
           +  +N+
Sbjct: 142 MRSLNA 147

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 16/108 (14%)

Query: 64  VLQILIPKHIELYTAISEDHRYSLVTEI----RAKDVIDIITFDSEKDERINCHLGPPPY 119
            L+ ++  H +LY    + +   +V  I    +  DV+D + +D+  +E IN        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 120 LLRHIFNKSDFKLGQQKPLWKLYIIDETT-IIFHGFDMLFDSFSAAYF 166
               +F K +F+ G  KPLWK+ ++ +   +IF    + FD  +   F
Sbjct: 95  ----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLF 138

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEVNS 176
           +F + +FK G+ KPLWKL I  +   I    D   FD  SA  F K  L E++S
Sbjct: 99  VFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKALLLELSS 152

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 124 IFNKSDFKLGQQKPLWKLYII-DETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIV 182
           IF + +F  G  KPLWK+ ++ D  T++     ++ D  S   F K FL  +N+  S+ +
Sbjct: 94  IFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNATASTSL 153

Query: 183 SSKQKKPLDYLFQLSSSADLIK--IYDEIPRSIYD 215
            S      + +F+ S    ++    YD IP + ++
Sbjct: 154 VS------EVVFEPSVHNSVVPQHPYDRIPVTFFE 182

>NCAS0A07390 Chr1 (1463090..1464526) [1437 bp, 478 aa] {ON}
           Anc_5.119 YGR212W
          Length = 478

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 121 LRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEVNSYMS 179
           +  IF   +F+  Q  PLWK+ +I    I+    D +LFD  SA  F +CF   V S   
Sbjct: 95  INSIFQSYNFQYDQDTPLWKILLIPSKRIMVLLIDHVLFDGMSAVKFWECF---VGSLSM 151

Query: 180 SIVSSKQKKPLDY-LFQ 195
           S+ S++  K L+  LFQ
Sbjct: 152 SVESTEDDKILEMPLFQ 168

>CAGL0K12628g Chr11 complement(1246877..1250857) [3981 bp, 1326 aa]
           {ON} similar to uniprot|P13433 Saccharomyces cerevisiae
           YFL036w RPO41 DNA-directed RNA polymerase
          Length = 1326

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 19/146 (13%)

Query: 125 FNKS----DFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSS 180
           FNKS    +  + Q + + +L+ + E  +    FD  F    + Y       ++ S+ SS
Sbjct: 88  FNKSHAAANLSMSQARDVMQLWSLLEACLKSDYFDRAFSILESLY-------QIKSHRSS 140

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240
            +       L ++     S D  ++ D++ + I D           +MFND+T +     
Sbjct: 141 FIDDYNMYLLAFVRHQGGSMDCYRMSDKVLKDIRDV-------FPNIMFNDRTVAILMHH 193

Query: 241 YLNAVKKPIEFITNTSSQVKTYQQIK 266
            L+ V+ P E +T T +Q++ Y ++K
Sbjct: 194 ALSNVRTPQEHVT-TINQIQNYFKMK 218

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 6/84 (7%)

Query: 121 LRHIFNKSDFKLGQQKPLWKLYII-DETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMS 179
           + HIF + +F   + KPLWK+ II  +  ++     +L D  SA +  + F+  +     
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDHVLMDGMSAVHVWETFMEGLQKQGP 162

Query: 180 SIVSSKQKKPLDYLFQLSSSADLI 203
             V      PL       SSAD I
Sbjct: 163 VGVDETIYSPLS-----GSSADQI 181

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 54/135 (40%), Gaps = 34/135 (25%)

Query: 120 LLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEVNSYM 178
           L   IF + +F+   +KPLW++  + +++      D +LFD  S     +C L  +    
Sbjct: 92  LANEIFKEYNFQYTVEKPLWRILAMPKSSTFVLLVDHVLFDGMSTVNLWRCLLENLGPES 151

Query: 179 SSIVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSP-----------------F 221
           +S          D L++ S+ A      D++ +  + YDS P                 +
Sbjct: 152 TS----------DVLYEPSNEA------DQLGQRPHPYDSWPVGWSWRLKRALVPWIFYY 195

Query: 222 APLTAVMFNDQTKSF 236
           AP T    N+Q   F
Sbjct: 196 APRTVTGVNEQLVHF 210

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 91  IRAKDVIDIITFDSEKDERINCHLGPPPYLLRHIFNKSDFKLGQQKPLWKLYII-DETTI 149
           +  KDV++ + +    ++++N           ++F    F    +KPLWK+ +I +E  +
Sbjct: 78  LELKDVVEFVDWAKFDEDKMN-----------YVFQNYAFPYHTEKPLWKVLVIPNERKL 126

Query: 150 IFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSI 181
           +     +LFD  +     + FL  +N  M++I
Sbjct: 127 VLLMSHVLFDGMAGVIILQEFLKNLNQSMNAI 158

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 12/88 (13%)

Query: 89  TEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRHIFNKSDFKLGQQKPLWKLYIIDE-T 147
           T I  +DV++ + ++  +++ IN            IF   +F     +PLWK+ ++    
Sbjct: 76  TPIEFEDVVEFVAWEKFEEKEINS-----------IFQTYNFHYRNDRPLWKILVVPSLN 124

Query: 148 TIIFHGFDMLFDSFSAAYFHKCFLAEVN 175
           T I      LFD  SA    + F+ ++N
Sbjct: 125 TFILLLDHALFDGISAVKIWETFMEKLN 152

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 121 LRHIFNKSDFKLGQQKPLWKLYII-DETTIIFHGFDMLFDSFSAAYFHKCFL 171
           + HIF + +F   + KPLWK+ I+ ++  ++     +L D  SA +  + F+
Sbjct: 95  INHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDHVLMDGMSAIHVWETFM 146

>ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR212W
          Length = 455

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 1/54 (1%)

Query: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFD-MLFDSFSAAYFHKCFLAEVNS 176
           IF   +FK   Q PLWK+  +     +   FD ++ D  S A F +  L E+NS
Sbjct: 96  IFKNINFKYHCQCPLWKIVSMQAGQQLLFCFDHLILDGMSGALFWEDVLRELNS 149

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 121 LRHIFNKSDFKLGQQKPLWKLYII-DETTIIFHGFDMLFDSFSAAYFHKCFL 171
           + +IF   +F   + KPLWKL II ++  ++     +L D  SA +  + F+
Sbjct: 95  INYIFQNYNFSYSEHKPLWKLLIIPNQNQMLLLTDHVLMDGISAVHVWETFM 146

>Kpol_1032.59 s1032 (135795..137321) [1527 bp, 508 aa] {ON}
           (135795..137321) [1527 nt, 509 aa]
          Length = 508

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 6/130 (4%)

Query: 127 KSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYF------HKCFLAEVNSYMSS 180
           KSD  + +  P  + Y +D+  I F   D +    S+ YF       K  L +V++    
Sbjct: 218 KSDEYITRLGPTHECYYLDDKLIAFAVTDFMKTGISSVYFVWDPTFAKYSLGKVSALREL 277

Query: 181 IVSSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSL 240
            ++SK K    YL    S  D +    +    + D  S  + PL+ V    +T +FF + 
Sbjct: 278 AITSKIKDGFYYLGYYISDCDKMNYKGKYGGELLDICSGDYVPLSKVSKIIETGNFFMAK 337

Query: 241 YLNAVKKPIE 250
             N    P E
Sbjct: 338 NPNEQTNPDE 347

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 90  EIRAKDVIDIITFDSEKDERINCHLGPPPYLLRHIFNKSDFKLGQQKPLWKLYIIDETTI 149
           +I   D+++   +DS  +  IN            IF +  F+    KP+WK+ +++    
Sbjct: 77  KIYFADIVEYKNWDSVSESNINS-----------IFQEYSFEYFTDKPVWKILVLENQNQ 125

Query: 150 IFHGFD-MLFDSFSAAYFHKCFLAEVNS 176
           +    D +LFD  S   F   F++ + S
Sbjct: 126 LLMLLDHVLFDGMSGINFWNSFISSLPS 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,966,431
Number of extensions: 2080493
Number of successful extensions: 6419
Number of sequences better than 10.0: 56
Number of HSP's gapped: 6527
Number of HSP's successfully gapped: 61
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)