Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021706.23ON31031016690.0
NDAI0C026206.23ON31130913320.0
KAFR0A050806.23ON31130412221e-170
KNAG0M011906.23ON38030211971e-165
TDEL0G044606.23ON36930211521e-158
ZYRO0C07722g6.23ON37330611441e-157
CAGL0F01815gsingletonON31429911271e-155
KNAG0D02240singletonON35930211221e-154
KNAG0K01400singletonON30930411041e-152
SAKL0E01342g6.23ON34130011071e-152
Kpol_1061.27singletonON30630110781e-148
Kpol_385.5singletonON30630110631e-146
TPHA0M002806.23ON30329510501e-144
NCAS0H008406.23ON36029610511e-143
NDAI0D008306.23ON37430010511e-143
CAGL0I08151gsingletonON38229510381e-141
KLTH0C11154g6.23ON30529910261e-140
KLLA0D01243g6.23ON31129910231e-139
Kwal_56.224396.23ON32030110221e-139
KAFR0G026806.23ON3832989971e-134
TPHA0A030001.216ON410144770.54
TBLA0D056901.216ON426474685.3
KLLA0C18700gna 1ON128893686.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02170
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   647   0.0  
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      517   0.0  
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   475   e-170
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   465   e-165
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              448   e-158
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   445   e-157
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   438   e-155
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   436   e-154
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   429   e-152
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   431   e-152
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   419   e-148
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   414   e-146
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   409   e-144
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   409   e-143
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   409   e-143
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   404   e-141
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   399   e-140
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   398   e-139
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   398   e-139
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     388   e-134
TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1...    34   0.54 
TBLA0D05690 Chr4 complement(1397632..1410426) [12795 bp, 4264 aa...    31   5.3  
KLLA0C18700g Chr3 complement(1658267..1662133) [3867 bp, 1288 aa...    31   6.2  

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP
Sbjct: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ
Sbjct: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF
Sbjct: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
           MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT
Sbjct: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD
Sbjct: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300

Query: 301 VEAFEKSNPE 310
           VEAFEKSNPE
Sbjct: 301 VEAFEKSNPE 310

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/309 (79%), Positives = 272/309 (88%), Gaps = 1/309 (0%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M+K  Q RSV K+F+AIEQEEGVGAHVRRSIGSMKQRNFSPFLLMD+FTVSHPAGFPDHP
Sbjct: 1   MSKVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHP 60

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYVL GMIAHEDFTGS+GVLRPGDLQFMTAGKAIMHSEIPV+M NG  GIGIQ
Sbjct: 61  HHGQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQ 120

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWV LP  LKN EPRYRNLR  +IPI+KPN++LTVRV+SGKSYG ESVKDLAYTPIDYY 
Sbjct: 121 LWVALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYI 180

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSAS-ED 239
            N  K G EF QE P +FN FLYI KG+V+IN  V+P+YST+FF TDGD+IKG SA+ E+
Sbjct: 181 FNMNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEE 240

Query: 240 TEFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHED 299
           TEF ++GG ILDQPI+QHGPFVE+DRESLL+VFKNYQYCINGFERARGWRS IADGI E 
Sbjct: 241 TEFAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEK 300

Query: 300 DVEAFEKSN 308
           DV AFEKS+
Sbjct: 301 DVPAFEKSS 309

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 259/304 (85%)

Query: 4   SMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHG 63
           +  FR++ K FVA+EQEEGVGA VRRS+GSM+QRNF+PFLL+D+FTVSHPAGFPDHPHHG
Sbjct: 7   ATTFRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHG 66

Query: 64  QETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWV 123
           QETITYV  GMIAHEDFTGS+G+LRPGDLQFMTAGK IMHSEIPV M NGDAG+G+QLWV
Sbjct: 67  QETITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 126

Query: 124 DLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNT 183
           DLP+++K+CEPRYRNLR  EIPIV+PN+ L V+V+SG+SYGVESVK+LAYTP+D+Y   +
Sbjct: 127 DLPQEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFIS 186

Query: 184 KKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFV 243
            K GT+FVQ+ P +FN FLY++KGSVKI D   PQYSTIFF  DG+ IKG  + +DTEF 
Sbjct: 187 NKKGTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFA 246

Query: 244 LVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEA 303
           ++GG ILDQP+IQHGPF+ES RE L+EVF+N+QY INGFERA GW+S I +GI E DV  
Sbjct: 247 IIGGLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPK 306

Query: 304 FEKS 307
           FE S
Sbjct: 307 FEGS 310

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  465 bits (1197), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 211/302 (69%), Positives = 258/302 (85%)

Query: 6   QFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQE 65
           +FR++ K F+A EQEEGVGA VRRS+GSM+QRNFSPFLL+D+FTVSHPAGFPDHPHHGQE
Sbjct: 74  EFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQE 133

Query: 66  TITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDL 125
           TITYV +GMIAHEDF GS+GVLRPGDLQFMTAGK IMHSEIPV M NGDAG+G+QLWVDL
Sbjct: 134 TITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDL 193

Query: 126 PKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKK 185
           PK +K+C PRYRNLR TEIPI +PN+ L ++V+SGKS+G++SVK+LAYTP+D+Y   + K
Sbjct: 194 PKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDK 253

Query: 186 TGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLV 245
            GT FVQE P +FNVFLY++KG+VKI+  V PQYST+F+  +GDAI+G    +DTEF ++
Sbjct: 254 KGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAII 313

Query: 246 GGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFE 305
           GG ILDQP+IQHGPFVE+ RE ++EVF+N+QY INGFERA GW+S I +GI E DV AFE
Sbjct: 314 GGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFE 373

Query: 306 KS 307
            +
Sbjct: 374 AA 375

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  448 bits (1152), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 199/302 (65%), Positives = 255/302 (84%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M+K++Q RS++K+FVA +QEEGVGA VRRSIG+M+ R FSPFL++D+FTVS PAGFPDHP
Sbjct: 58  MSKTLQVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHP 117

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITY+L GM+AHEDF+ S+G+L PGDLQFMTAGKAI+HSEIPV+M++G   +G+Q
Sbjct: 118 HHGQETITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQ 177

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLP+KLKNCEPRYR+L+A +IP++KP++ L V V+SG SYGV+S +DLAYTP+ YY 
Sbjct: 178 LWVDLPEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYH 237

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
             T K GTEFVQEFP  FN F+YI+KGS+ I + + PQ+ST+FF TDGDA++G SAS++ 
Sbjct: 238 FATSKKGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNA 297

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EFVL+GG+IL Q ++QHGPFVE++RE L+EVF NYQ  INGF+R R WRS IA GI E +
Sbjct: 298 EFVLIGGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESE 357

Query: 301 VE 302
            +
Sbjct: 358 AK 359

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  445 bits (1144), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 204/306 (66%), Positives = 248/306 (81%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M+KS+  RSVLK+F+AIEQEEGVGA VRRSIG+MK R F PFL++D+F V  PAGFPDHP
Sbjct: 67  MSKSISVRSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHP 126

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITY LKGMIAHEDFTGS+GVL PGDLQFMTAGK I+HSEIPV + +G A  G+Q
Sbjct: 127 HHGQETITYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQ 186

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLP +LKNCEPRYR+LR  + P VK ND+LTVRV+SGKSYGV+SV++LAYTP+ +Y 
Sbjct: 187 LWVDLPAELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYH 246

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
             T K GTEF QEFP DFNVF YI+KGS+ +ND V P++S +FF TDG+ + G S S+D 
Sbjct: 247 FITSKKGTEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDA 306

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EFVL+GG+ILDQ ++QHGPFVE+ RE +++VF+NYQY +NGFE A  W S+IA GI E +
Sbjct: 307 EFVLIGGKILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAE 366

Query: 301 VEAFEK 306
                K
Sbjct: 367 ARKLYK 372

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  438 bits (1127), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 200/299 (66%), Positives = 246/299 (82%)

Query: 7   FRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQET 66
           +RS+ K F+  EQEEGVGA VRRS+G+MKQR FSPFL++D+F V HPAGFPDHPHHGQET
Sbjct: 4   YRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHGQET 63

Query: 67  ITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLP 126
           ITYVL GM+AHEDFTG++GVL  GDLQFMTAGK I+HSEIPVQM +G+A  G+Q WVDLP
Sbjct: 64  ITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWVDLP 123

Query: 127 KKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKT 186
           K LK CEPRYRNLR  +IP+V+PN++LTV+V+SGKSYGV+SV+DLAYTPI  Y   T K 
Sbjct: 124 KDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLTNKA 183

Query: 187 GTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVG 246
           GT++ QEFP +FNVF+Y++KG V + D V P+++ +FF TDGDA+KG  A++D +F ++G
Sbjct: 184 GTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFAIMG 243

Query: 247 GQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFE 305
           GQILDQ  IQHGPFVE+DRESL++VF NYQY INGFERA+GW+S I  GI E  V   E
Sbjct: 244 GQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRENE 302

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  436 bits (1122), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 195/302 (64%), Positives = 244/302 (80%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M    + RS+   F+  E  EGVGA V+RS+GSM+QR F+PFL++D+FTV  P+GFPDHP
Sbjct: 54  MPSLFKLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHP 113

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYV+ G+IAHEDFTGS+GVLRPGDLQFMTAGK I+HSE+PV+M +G    G+Q
Sbjct: 114 HHGQETITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQ 173

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLPK LKNCEPRYRNLR+ +IP+VKP+++L VRV+SGKSYG ESVKDLAYTPID+Y+
Sbjct: 174 LWVDLPKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYY 233

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
           M   K GTEF QE P+DFN FLY++KGSV IN+ V  Q + IFF TDG+ + G + S+DT
Sbjct: 234 MLASKAGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDT 293

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EF ++GG+ILDQP++QHGPFVE+D+E L E F NY+    GFERA+GWRS IA GI+E +
Sbjct: 294 EFAIIGGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESE 353

Query: 301 VE 302
            +
Sbjct: 354 AK 355

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  429 bits (1104), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 195/304 (64%), Positives = 244/304 (80%)

Query: 7   FRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQET 66
           FRSV K+F A+EQ EGVGA VRRSIG  +QRNFSPFLL+D+FTVSHP+GFPDHPHHGQET
Sbjct: 5   FRSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQET 64

Query: 67  ITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLP 126
           ITY+ +GMIAHEDFTGS+G+LRPGDLQFMTAGK I+HSEIPV   +  A +G+QLWVDLP
Sbjct: 65  ITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLP 124

Query: 127 KKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKT 186
           K +K+C PRYRNLRA+EIPI +PN+ L V+V+SGKSYGVESVK+LAYTP+D+Y   + K 
Sbjct: 125 KNMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKE 184

Query: 187 GTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVG 246
           G  FVQE P ++N FLY+++GSV ++   +PQYSTIF+  +G+AIKG +  ++TEF ++ 
Sbjct: 185 GINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIA 244

Query: 247 GQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEK 306
           G ILDQ I+QHGPFVE+  E + EVF+NYQ+ INGFE+A  W S I +GI E D+  FE 
Sbjct: 245 GLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNFES 304

Query: 307 SNPE 310
              E
Sbjct: 305 QPKE 308

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 189/300 (63%), Positives = 247/300 (82%)

Query: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67
           R++ K FVA+EQ EGVGA VRRSIG+ + RNF+PFL++D+F V+ PAGFPDHPHHGQETI
Sbjct: 41  RTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHGQETI 100

Query: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127
           TYVL GM+AHEDFTGS+GVLRPGDLQFMTAGK I+HSEIPV+M +G+  +G+QLWVDLP+
Sbjct: 101 TYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWVDLPE 160

Query: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187
           +LKNCEPRYR+LR  E PI +P+ +L VRV+SG+SYGV+S  +LAYTP+ +Y   + K G
Sbjct: 161 RLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFISSKKG 220

Query: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247
           T F Q+FP DFNVF+Y++KGS+ +N    PQYS IFFK DG+ ++G +AS+DTEF LVGG
Sbjct: 221 TPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFALVGG 280

Query: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEKS 307
            IL+QP++QHGPFVE+ +E +++VF++YQ+ +NGFERA  W+S I+DGI + + E   KS
Sbjct: 281 SILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEKQLKS 340

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  419 bits (1078), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 235/301 (78%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M+K    RS+ K F++ EQ EGVGA VRRSIG+M  R FSPFL++D+F V+  AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYV +GMIAHEDFTG +GVL  GDLQFMTAGKAI H+E+PVQ N+G+  +G+Q
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLP  +KN EPRYR+LR  +IP   P DDL + V+SG SYGV+SVKDLAYTPID+Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
              KK GTEF Q+F  DFNVF+Y++KG+V I D V PQYS+IFF TDGDA+ G  A++DT
Sbjct: 181 YRGKKAGTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDT 240

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EF ++GG+ILDQ  +QHGPFVE  +E L++VF +YQ   NGFERAR WRS I DGI EDD
Sbjct: 241 EFAIIGGKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

Query: 301 V 301
            
Sbjct: 301 A 301

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  414 bits (1063), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 234/301 (77%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M+K    RS+ K F+A EQ EGVGA VRRSIG+M  R FSPFL++D+F V+  AGFPDHP
Sbjct: 1   MSKQQNLRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHP 60

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYV +GMIAHEDFTG +GVL  GDLQFMTAGKAI H+E+PVQ N+G+  +G+Q
Sbjct: 61  HHGQETITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQ 120

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLP  +KN EPRYR+L+  EIP   P DDL V V+SG SYGV+SVKDLAYTPID+Y 
Sbjct: 121 LWVDLPTDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYM 180

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
              KK GTEF Q F  DFNVF+Y+++G++ I D V PQYS+IFF TDGDA+ G  A+++T
Sbjct: 181 YRGKKAGTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNT 240

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDD 300
           EF ++GG+ILDQ  +QHGPFVE  +E L++VF +YQ   NGFERAR W+S I DGI E+D
Sbjct: 241 EFAIIGGKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

Query: 301 V 301
            
Sbjct: 301 A 301

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  409 bits (1050), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 189/295 (64%), Positives = 229/295 (77%)

Query: 4   SMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHG 63
           S   RS+LK F+A EQ EGVGA VRRSIG+ K R FSPFL++D+F V  PAGFPDHPHHG
Sbjct: 2   SQNTRSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHG 61

Query: 64  QETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWV 123
           QETITYV KGM+AHEDFTGS+G+LRPGDLQFMTAGKA+ HSE+PV M NG+   G+QLWV
Sbjct: 62  QETITYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWV 121

Query: 124 DLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNT 183
           DLP  LKN EPRYR+L    IPI KP+++L + V+SGKSYG+ESVKDLAYTP+D+Y    
Sbjct: 122 DLPTNLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKA 181

Query: 184 KKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFV 243
           +K G+ F Q+F  D+NVFLYI+KGSV I + V PQ+S+IFF TDGD ++G   S+DTEF 
Sbjct: 182 RKKGSAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFA 241

Query: 244 LVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298
           ++GGQIL Q  +QHGPFVE   E L++VF NY+    GFERA  WRS I +GI E
Sbjct: 242 IIGGQILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  409 bits (1051), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 185/296 (62%), Positives = 236/296 (79%)

Query: 3   KSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHH 62
           +S + RS+LK F+A EQ EG GA VRRS+GS +   FSPFL++D+F V+ P GFPDHPHH
Sbjct: 57  ESQKERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHH 116

Query: 63  GQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLW 122
           GQETITYV  G++AHEDFTGS+GVL PGDLQFMTAGK I+H E+PV MN+     G+Q W
Sbjct: 117 GQETITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFW 176

Query: 123 VDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMN 182
           VDLP  LKNCEPRYRNLRA  IP+V+ ND+L V+V+SGKSY VESVKDLAYTPID+Y+  
Sbjct: 177 VDLPADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFI 236

Query: 183 TKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEF 242
           + K GTEF QE P DFN F+Y+ KG++ I + V   +S++FF+TDG+ I+G +AS++TEF
Sbjct: 237 SNKAGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEF 296

Query: 243 VLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298
            ++GG+ILDQ ++QHGPFVE+ RE L+EVF NY+  INGFE+A GW+S I++GI E
Sbjct: 297 AVIGGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDE 352

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  409 bits (1051), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/300 (64%), Positives = 237/300 (79%), Gaps = 3/300 (1%)

Query: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHP-AGFPDHPHHGQET 66
           R++LK F+  EQ EGVGA VRR+IG+ +   F PFL++D+F V+ P  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 67  ITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLP 126
           ITY+L GMIAHEDFTGS+GVLRPGDLQFMTAGK I+HSE+PV M +G  GIG+QLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 127 KKLKNCEPRYRNLRATEIPIVKPNDD--LTVRVVSGKSYGVESVKDLAYTPIDYYFMNTK 184
           ++LKNCEPRYRNLR  EIPIV  +D+  +TV+V+SG +YGV+SV+DLAYTPI +Y   + 
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 185 KTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVL 244
           K G EF Q  P DFNVFLY++KG+V I+D +  Q + +FF  DG +IKG SA+ DTEF +
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 245 VGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAF 304
           +GG+ILDQP++QHGPFVE+ RE L +VF+NYQ  INGFERA  WRS IADGI ED   A 
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  404 bits (1038), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 183/295 (62%), Positives = 230/295 (77%)

Query: 7   FRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQET 66
           +RS+L  F+A EQEEGVGA VRRS+G+ + R F+PFL++D+FTV+ P GFPDHPHHGQET
Sbjct: 82  YRSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQET 141

Query: 67  ITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLP 126
           ITYV  GMIAHED TGS+GVL  GDLQFMTAGK I+HSEIPV   +G    G+QLWVDLP
Sbjct: 142 ITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLP 201

Query: 127 KKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKT 186
             +KN +PRYRNLR  E P+  PN++L VRV+SGKSYGVES++DLAYTP+  Y     KT
Sbjct: 202 SDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKT 261

Query: 187 GTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVG 246
           GTEFVQ+ P DFNVF+Y++KGS+++ND     +S+ FF  DG+AI+G + SED +F ++ 
Sbjct: 262 GTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIA 321

Query: 247 GQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDV 301
           G+ILDQ +IQHGPFVE++RE L+EVF+NYQ   NGFE A  WRS I DGI E++ 
Sbjct: 322 GRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEA 376

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/299 (62%), Positives = 237/299 (79%)

Query: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67
           RS+LK F A+EQ EGVGA VRRSIGS + RNF+PFL++D+F VS PAGFPDHPHHGQETI
Sbjct: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64

Query: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127
           TYVL GMIAHEDFTGSRGVLRPGDLQFMTAGK I+HSEIPV++ +G   +G+QLWVDLP 
Sbjct: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124

Query: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187
            LK+CEPRYR+L   EIP V+P   L VRV+SG+SYGV S+ +LAYTP+ +Y   T+K G
Sbjct: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184

Query: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247
           T F Q FP++FNVF+Y++KGSV +N     QYS++FF TDG  ++G  +SE++EF+L+GG
Sbjct: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFILIGG 244

Query: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEK 306
           ++LDQPI+Q+GPFVE+ ++++ EV  NYQ   NGFERA+GW S IA G+   DV   E 
Sbjct: 245 EVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 238/299 (79%)

Query: 6   QFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQE 65
           + RSVLK FVAIEQ EG GA V+RSIG+++ RNF PFL++DNF VS PAGFP+HPHHGQE
Sbjct: 8   KVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQE 67

Query: 66  TITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDL 125
           TITYVL+GM+AHEDFTGS+GVLR GDLQFMTAGKAI+HSEIPV+M+NG++  G+QLWVDL
Sbjct: 68  TITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDL 127

Query: 126 PKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKK 185
           P  +KN EPRYR+LR  EIP+  P+D+L V+V+SG+SYGV+S+ +LAYTP+++Y     K
Sbjct: 128 PNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANK 187

Query: 186 TGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLV 245
             TEF Q F  DF+ F+YI+KGS+ I+D  +P+ S IFFK DGD I+G + S++ EF ++
Sbjct: 188 KNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAII 247

Query: 246 GGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAF 304
            G+  +Q ++Q+GPFVES RE++++V +NYQ  +NGFE AR W   I +G+ E +V+ +
Sbjct: 248 AGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQY 306

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 179/301 (59%), Positives = 232/301 (77%)

Query: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67
           RS+LK F A+EQ EGVGA VRRSIG+ K RNF+PFL++D+FT++ PAGFPDHPHHGQET+
Sbjct: 19  RSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHGQETV 78

Query: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127
           T++L+G +AHEDFTGS+GVLR GDLQFMTAGK  +HSEIPVQ+ +GD   GIQLWVDLP 
Sbjct: 79  THILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWVDLPA 138

Query: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187
           +LK+C+PRYR+L+   IP  +  + L + V+SG+SYGV+S+++LAYT + YY     +  
Sbjct: 139 RLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVFSEAN 198

Query: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247
             F Q FP DFNVFLY++KG + I      ++S+IFFKTDG  + G S S D EF+L GG
Sbjct: 199 ISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFILAGG 258

Query: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEKS 307
           QILDQPI+Q+GPFVE+ +E ++EVF+NYQ   NGFE+A GW S IA+GI E D+  F KS
Sbjct: 259 QILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISDFVKS 318

Query: 308 N 308
           +
Sbjct: 319 S 319

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 230/298 (77%)

Query: 1   MTKSMQFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHP 60
           M++ +  RS++  F+  E  EG GA V+RSIGS +QR F+PFL++D+F V+ PAGFPDHP
Sbjct: 78  MSRIIHQRSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHP 137

Query: 61  HHGQETITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQ 120
           HHGQETITYVL GMIAHEDFTG  G+L PGDLQFMTAG+ I+HSEIPV M NG +  G+Q
Sbjct: 138 HHGQETITYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQ 197

Query: 121 LWVDLPKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYF 180
           LWVDLP+ LK  EPRYRNLRA +IPI  P ++L V V+SGKSY VES+ DLAYTP+  Y 
Sbjct: 198 LWVDLPQDLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYH 257

Query: 181 MNTKKTGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDT 240
             T K GT F+QEFP DFNVFLY+IKG+V IN+ +  + + IFF  DG++I+G  A++D+
Sbjct: 258 FVTIKAGTPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDS 317

Query: 241 EFVLVGGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHE 298
           EFVLVGG+IL+QP++Q GPFVE+D++ L++VF +++   NGFERA  W S I  GI E
Sbjct: 318 EFVLVGGEILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKE 375

>TPHA0A03000 Chr1 (649118..661423) [12306 bp, 4101 aa] {ON} Anc_1.216
            YKR054C
          Length = 4101

 Score = 34.3 bits (77), Expect = 0.54,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 190  FVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKG 233
            FV++   DFN  L I +   KI +  H Q+ TIF  T+ + IKG
Sbjct: 1115 FVEQLECDFNDLLQIHESKYKILEANHSQFDTIFL-TETNKIKG 1157

>TBLA0D05690 Chr4 complement(1397632..1410426) [12795 bp, 4264 aa]
            {ON} Anc_1.216 YKR054C
          Length = 4264

 Score = 30.8 bits (68), Expect = 5.3,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 143  EIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTGTEFVQEFPADFNVFL 202
            E  I+K N D    + S K   +    +  Y PI    +N KK  + +++ F  ++N  +
Sbjct: 1251 EQTIIKLNTDYNAVLDSAKQILIPMKPEFDYHPILKAIINAKKAWS-YLESFFKEYNSLI 1309

Query: 203  YIIKGSVKINDTVH 216
             +   S+ IN ++H
Sbjct: 1310 NMTWNSLDINSSIH 1323

>KLLA0C18700g Chr3 complement(1658267..1662133) [3867 bp, 1288 aa]
            {ON} similar to uniprot|P28273 YKL215C Saccharomyces
            cerevisiae Hypothetical ORF
          Length = 1288

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 80   FTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNG-----DAGIGIQLWVDLPKKLKNCEP 134
            F G  GV+R  +++F    +A + SE  V   NG     D   G+ LW+      ++ E 
Sbjct: 1197 FRGGNGVIR--EVEFTEQVQASILSERRVHPPNGLQGGGDGERGMNLWIRGGGS-EDTEG 1253

Query: 135  RYRNLRATEIPIVKPNDDLTVRVVSGKSYGVES 167
               NL      +++P D + ++   G  YG  S
Sbjct: 1254 SIVNLGGKNTVMMRPGDKIVIQTPGGGGYGCAS 1286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,354,979
Number of extensions: 1536833
Number of successful extensions: 2863
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2910
Number of HSP's successfully gapped: 27
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)