Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021606.22ON56356328210.0
NDAI0C026306.22ON58053623040.0
Kpol_1037.276.22ON54653421180.0
KAFR0A050706.22ON56453220880.0
TDEL0G044706.22ON54256320850.0
CAGL0E02629g6.22ON54853220540.0
KNAG0F028906.22ON56353220500.0
TBLA0G009706.22ON55954420300.0
TPHA0J003506.22ON55953620190.0
ZYRO0C07744g6.22ON54753520070.0
Smik_15.1716.22ON54453419890.0
Suva_15.1776.22ON54453419870.0
YOR002W (ALG6)6.22ON54453419810.0
SAKL0E01364g6.22ON54153419780.0
Skud_15.1636.22ON54453419620.0
KLLA0D01221g6.22ON56653119530.0
Kwal_56.224376.22ON53653019130.0
KLTH0C11176g6.22ON53653619110.0
Ecym_30276.22ON54953218730.0
ACR004W6.22ON56353218500.0
TBLA0A093105.669ON5464343191e-30
KLTH0F17666g5.669ON5554213032e-28
TPHA0J013805.669ON5754183023e-28
Kwal_55.217425.669ON5554172996e-28
NCAS0G004505.669ON5704232961e-27
CAGL0L10450g5.669ON5504192943e-27
NDAI0F005105.669ON5704232909e-27
Kpol_1018.735.669ON6214102864e-26
KAFR0D024405.669ON5754262821e-25
YOR067C (ALG8)5.669ON5774282811e-25
ZYRO0A11506g5.669ON5564212757e-25
Suva_8.1185.669ON5764212758e-25
TDEL0B025405.669ON5694152731e-24
ADR210C5.669ON5722832703e-24
Skud_15.2345.669ON5772672703e-24
Smik_15.2475.669ON5772672685e-24
KLLA0F16621g5.669ON5612662642e-23
KNAG0L019205.669ON5684262623e-23
SAKL0G00836g5.669ON5614152605e-23
Ecym_40515.669ON6044182517e-22
SAKL0E03784g2.439ON526138780.69
Ecym_5319singletonON53051770.84
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02160
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...  1091   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   892   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   820   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   808   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   807   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   795   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   794   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   786   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   782   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   777   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   770   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   769   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   767   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   766   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   760   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   756   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   741   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   740   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   726   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   717   0.0  
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   127   1e-30
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   121   2e-28
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   120   3e-28
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   119   6e-28
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   118   1e-27
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   117   3e-27
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   116   9e-27
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   114   4e-26
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   113   1e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   112   1e-25
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   110   7e-25
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   110   8e-25
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   109   1e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   108   3e-24
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   108   3e-24
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   107   5e-24
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   106   2e-23
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...   105   3e-23
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   104   5e-23
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...   101   7e-22
SAKL0E03784g Chr5 complement(308703..310283) [1581 bp, 526 aa] {...    35   0.69 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    34   0.84 

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/563 (95%), Positives = 536/563 (95%)

Query: 1   MAGKNKIPKKDLXXXXXXXXXXXXXXXHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTI 60
           MAGKNKIPKKDL               HDIPEESFYASPLYDLLYPFRPAGSQWMTEYTI
Sbjct: 1   MAGKNKIPKKDLSSQKKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTI 60

Query: 61  VLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPP 120
           VLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPP
Sbjct: 61  VLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPP 120

Query: 121 LTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKW 180
           LTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKW
Sbjct: 121 LTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKW 180

Query: 181 LGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAV 240
           LGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAV
Sbjct: 181 LGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAV 240

Query: 241 CFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVF 300
           CFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVF
Sbjct: 241 CFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVF 300

Query: 301 GGDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVV 360
           GGDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVV
Sbjct: 301 GGDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVV 360

Query: 361 GFLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVL 420
           GFLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEK            YTSTDRNVL
Sbjct: 361 GFLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVL 420

Query: 421 SRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVS 480
           SRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVS
Sbjct: 421 SRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVS 480

Query: 481 MIGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGC 540
           MIGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGC
Sbjct: 481 MIGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGC 540

Query: 541 FFLFWIWNYYKLFSMIKKSLHHL 563
           FFLFWIWNYYKLFSMIKKSLHHL
Sbjct: 541 FFLFWIWNYYKLFSMIKKSLHHL 563

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/536 (79%), Positives = 467/536 (87%), Gaps = 1/536 (0%)

Query: 29  DIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDF 88
           +  +ESFYASPLYD LYPFRPAGSQWMTEY IVLF++IIRCAVGLGP+SG+  PPMFGDF
Sbjct: 45  ETSKESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDF 104

Query: 89  EAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRG 148
           EAQRHWMEITQ+LPI +WYWFDL+YWGLDYPPLTA+HSY+CGKIGSFF PNWF L  SRG
Sbjct: 105 EAQRHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRG 164

Query: 149 YEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILI 208
           YE QDLKTFMRLTVL SE+L YIP VVYF KWLGK R QSPIGQFIA AAIL QPSLILI
Sbjct: 165 YEGQDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILI 224

Query: 209 DHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSL 268
           DHGHFQ+NSV LGLTVY +NNLLDEFYA AAVCFVLSICFKQM LYYSPIFFAYLLSKSL
Sbjct: 225 DHGHFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSL 284

Query: 269 FTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ-GLNNVLQSIHRIFPFARGIFEDK 327
           F P+LFNIPRF AI+ AT+C+F  M+GP+Y FGG+  G+ N+LQSI RIFPFARGIFEDK
Sbjct: 285 FHPRLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDK 344

Query: 328 VANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSM 387
           VANFWCVTNVIFKYK  FTQ++LQLYSL+LT++ FLPAM++IL YP+KYLL YALSACSM
Sbjct: 345 VANFWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSM 404

Query: 388 AFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQY 447
           +FYLFSFQVHEK            YTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGL+LQY
Sbjct: 405 SFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQY 464

Query: 448 WVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYI 507
           WVCL+LSNWLIGNFSFITP FLPKVLTPGPS+  +GENY   +LLP N  WKVIIVLSY+
Sbjct: 465 WVCLILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYV 524

Query: 508 AMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
            MG IH +D F+ PP AYPDLWVILNCTLGFGCF LFW+WNYYKLFSM KK++H L
Sbjct: 525 MMGVIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/534 (73%), Positives = 454/534 (85%), Gaps = 4/534 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESF+ASPLYD L PFRP  +QW+TEY IV+F+LI+RCA+GLG +SG G PPMFGDFEAQ
Sbjct: 15  EESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQ 74

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLPI KWY+FDL+YWGLDYPPLTAYHSY+ G IGSF N +WFAL+ SRGYE+
Sbjct: 75  RHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYES 134

Query: 152 Q--DLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
           +  DLKT+MR TV++SE +FYIPGV+YF KW+G+HR+QS IGQ+IAAAAIL QPSL+LID
Sbjct: 135 ENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLID 194

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLTVYAINNLLDEFYA AA+CFVLSICFKQM LYY+PIFF YLL +SLF
Sbjct: 195 HGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLF 254

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329
           + K FNI RFL+IAI+TV +F  MY PLYVFGG  GL NV+QS+HRIFPFARG+FEDKVA
Sbjct: 255 SRKFFNISRFLSIAISTVFAFFSMYAPLYVFGG--GLRNVIQSVHRIFPFARGLFEDKVA 312

Query: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389
           NFWCVTN+  KYK+L+TQ+ELQLYSL+ TVVGFLPA++ ILFYPKK+LLPYAL+ACSM+F
Sbjct: 313 NFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSF 372

Query: 390 YLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449
           YLFSFQVHEK            YTSTD NVLS VSW+NN+GLFTLWPLLKKDGLTLQY V
Sbjct: 373 YLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQYGV 432

Query: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509
           C  LSNWLIGNFSFITP FLPK+LTPGP V    + YH RSLLP NI WK+IIV SYI M
Sbjct: 433 CFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYIVM 492

Query: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
             IH+ + FV+PP  YPD+WV++NC LGFGCF LFW+WNYYK+F++  K+L +L
Sbjct: 493 LLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTLQYL 546

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/532 (71%), Positives = 440/532 (82%), Gaps = 2/532 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EE FYASPLYD LYPFRPAG+QW+ +Y IV F+LIIRCA+GLG +SG G  PMFGDFEAQ
Sbjct: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLPI KWYWFDL+YWGLDYPPLTAYHSYI GKIGSF  P WF L+ SRG E 
Sbjct: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
           + +K++MR TVL+SEA+FY P ++YF KW GKHR QSPIGQ+IAA AIL QPSL+LIDHG
Sbjct: 155 EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHG 214

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYNSV LGLTVYAINNLLD+FY++A+VCFVLSICFKQM+LYY+PIFF YLLSKSLF P
Sbjct: 215 HFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFP 274

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
           +LFNIPR + IA  T+ +F+ MY PLY+FGG  GL N++QS+HRIFPFARGIFEDKVANF
Sbjct: 275 RLFNIPRLVGIAAVTIVTFVAMYSPLYIFGG--GLENLIQSVHRIFPFARGIFEDKVANF 332

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCVTN++ KYK+ FTQ +LQLYSL  TV+GFLPA++II+ YPKK+LLPYAL+ACSM+F+L
Sbjct: 333 WCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFL 392

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           FSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLLKKDGL LQY VC 
Sbjct: 393 FSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCF 452

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
            LSNWL+GNFSF+TP FLPK+LTPGPS+S I ENYH RSLLP NI WKV+IV SY++M  
Sbjct: 453 ALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAV 512

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
            H LD FV PP  YPD+W+ LNC +GFG F  FW+W YY LF++  K+L  L
Sbjct: 513 FHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/563 (69%), Positives = 453/563 (80%), Gaps = 21/563 (3%)

Query: 1   MAGKNKIPKKDLXXXXXXXXXXXXXXXHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTI 60
           MA KNK  K++                    EESFYASPLYD LYPFRPAGSQW+TEY I
Sbjct: 1   MAPKNKEAKRNTV------------------EESFYASPLYDFLYPFRPAGSQWLTEYVI 42

Query: 61  VLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPP 120
           VLF+LII CAVG G +SG   PPMFGDFEAQRHWMEITQHL   +WYWFDL+YWGLDYPP
Sbjct: 43  VLFALIIGCAVGHGSYSGQFSPPMFGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPP 102

Query: 121 LTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKW 180
           LTAYHSY+ GKIGSF  P WF L+ SRG E  DLKTFMR TVL+SE LFYIP VVYF KW
Sbjct: 103 LTAYHSYVLGKIGSFIKPEWFELNESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKW 162

Query: 181 LGKHRRQSPIGQFIAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAV 240
           LGKHR++SPIGQFI+AAAIL QPSL+LIDHGHFQYN V LGLTVYAIN+L +EFYA+AA+
Sbjct: 163 LGKHRQKSPIGQFISAAAILFQPSLMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAI 222

Query: 241 CFVLSICFKQMTLYYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVF 300
           CFVLSICFKQM LYY+PIFFAYLLSKSLF+P+ FN PR  AIA+ATV SF  MY PLY+F
Sbjct: 223 CFVLSICFKQMALYYAPIFFAYLLSKSLFSPR-FNFPRLFAIAVATVLSFAAMYAPLYIF 281

Query: 301 GGDQGLNNVLQSIHRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVV 360
           GG  GL NV+QS+HRIFPFARGIFEDKVANFWCVTNV FKYK +F Q++LQLYSL+ T++
Sbjct: 282 GG--GLANVIQSVHRIFPFARGIFEDKVANFWCVTNVFFKYKNIFPQEQLQLYSLIATML 339

Query: 361 GFLPAMMIILFYPKKYLLPYALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVL 420
           GFLPA+++I  YPKK+++ YAL+ CSM+FYLFSFQVHEK            YTS++ +VL
Sbjct: 340 GFLPAVIVIFLYPKKHIICYALATCSMSFYLFSFQVHEKTILVPLLPITLLYTSSNWDVL 399

Query: 421 SRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVS 480
           S  +W+NN+GLFTL+PLLKKDGLTLQY+VC  LSNWL+GNFSF+TP FLPK LTPGPSVS
Sbjct: 400 SMANWINNVGLFTLYPLLKKDGLTLQYFVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVS 459

Query: 481 MIGENYHYRSLLPRNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGC 540
            +  NY  RS LP N+ WK+IIV SY AMG +HV+D  + PPV+YPDLWV+LNC LGFGC
Sbjct: 460 SVDINYRRRSFLPSNVIWKIIIVSSYTAMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGC 519

Query: 541 FFLFWIWNYYKLFSMIKKSLHHL 563
           F LFW+W+YY LF+M +K+L  L
Sbjct: 520 FTLFWLWSYYMLFTMPRKTLQQL 542

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/532 (70%), Positives = 445/532 (83%), Gaps = 3/532 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESFYASPLYD L+PFRPAGSQW+TE+ I++F++IIRCA+GLGP+SGY   PM GDFEAQ
Sbjct: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLPI KWY++DLKYWGLDYPPLTA+HSY+ GK+G+F NP+WFALDSSRG E 
Sbjct: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
           Q LK +MR TVL+SEA+FY+P VVYF KWLG+ R QSPIGQFIAAAAIL QPSL+LIDHG
Sbjct: 140 QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHG 199

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYNS+ LG TVYAINNLLDEFYA AA+CFVLSICFKQM+LYY+PIFFAYLL +S+F P
Sbjct: 200 HFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFP 259

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
           KLFNIPRF++I+IAT+ +F  M+ P Y+FGG  GL    Q++ RIFPFARGIFEDKVANF
Sbjct: 260 KLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLA---QTVRRIFPFARGIFEDKVANF 316

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCV N I K+K+LFT  +L++YSL+LTVVGF PAM++I+ YP+K+LLPYAL+ACSM+FYL
Sbjct: 317 WCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYL 376

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           FSFQVHEK            +TS D NVLS VSW+NN+ LFTLWPLLK++GL LQY+VC 
Sbjct: 377 FSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCF 436

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
            LSNWLIGNFSFITP FLPK +TPGPS+S + +NY  RSLLP +IFWK+IIV SYI M A
Sbjct: 437 FLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTA 496

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
            H LD F+  P  +PDLWVILNCT+GF  F LFW+W YYK  +++KK++  L
Sbjct: 497 YHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/532 (70%), Positives = 438/532 (82%), Gaps = 3/532 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EE FYASP+YD LYPFR  GSQW+TEY IV+F LII+ A+GLG +SG+  PPMFGDFEAQ
Sbjct: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLP+ +WYWFDL+YWGLDYPP TAYHSY+ GKIG+F  P WF LD+SRG E 
Sbjct: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
             +K++MR TVL+SE +FYIP +VYF KW+G+ ++QSPIGQF+AAAAIL QP+L+LIDHG
Sbjct: 155 DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHG 214

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYN V LGLTVYAINNLLD FYAMAAVCFVLSICFKQM LYY+PIFFA LLSKSLF P
Sbjct: 215 HFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFP 274

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
           +LFNIPRFL++A AT+ S  +M+ PLY+FG   G+ NVLQSIHRIFPFARGIFEDKVANF
Sbjct: 275 RLFNIPRFLSVAFATLASLFVMFAPLYIFG---GVGNVLQSIHRIFPFARGIFEDKVANF 331

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCVTNV FKYK +FTQ ELQ YSLV TVVGF PA MI++FYPKK+L+PY L+ACSMAF+L
Sbjct: 332 WCVTNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFL 391

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           FSFQVHEK            +TST+ N LS V W+NN+ LFTLWPLLKKDGL LQY VCL
Sbjct: 392 FSFQVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCL 451

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
           ++ NWL+GNFSFITP FLPK+LTPGPS+S I ENY  RSLLP NI WK+II++SY+ M  
Sbjct: 452 VMYNWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLM 511

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           IHVL+  +  P  YPDLWV LNCT+GFGCF LFW+W YYKL ++  K++  L
Sbjct: 512 IHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/544 (70%), Positives = 446/544 (81%), Gaps = 13/544 (2%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EE+FYASPL+D LYPFRP GSQW+TEY I++F++IIRCA+ LG +SG G PPMFGDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLPI KWYWFDL+YWGLDYPP TAYHSY  GK+GSFFNP+WFAL+SSRGYE+
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
            D  LKT+MR TV++SEA+FYIP VVYF KWLGKHR QSPIGQFIAAAAIL QPSL+LID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLTVYAINNLLDEFY  AA+CFVLS+CFKQM LYYSPIFF YLLSKSL 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ----------GLNNVLQSIHRIFPF 319
            P   NI RF+ +AI+TV SF++M+GP+Y+FG             GLNN++Q I RIFPF
Sbjct: 257 HPSC-NISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPF 315

Query: 320 ARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLP 379
           ARGIFEDKVANFWCVTNV+ KY+ LFTQ++LQ YSLV T++GFLP+M+ I  YP+K+L+P
Sbjct: 316 ARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIP 375

Query: 380 YALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 439
           YAL+ACSM+F+LFSFQVHEK            YTSTD NVLS V W+NN+ LFTLWPLL+
Sbjct: 376 YALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLR 435

Query: 440 KDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWK 499
           KDGL LQY+VC  LSNWLIGNFSFITP FLP  LTPGPS+S I ++Y   SLLP NI WK
Sbjct: 436 KDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWK 495

Query: 500 VIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKS 559
           +II+ SYI MGA+ +LD F  PP  YPDLW+ILNCT+GFGCF LFW+WN YK+  M  K+
Sbjct: 496 IIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKT 555

Query: 560 LHHL 563
           L+ L
Sbjct: 556 LNDL 559

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 439/536 (81%), Gaps = 2/536 (0%)

Query: 28  HDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGD 87
             +  E FYASPLY  L PF+   +QW++ Y IVLF+LIIRCA+GLGP+SG    PMFGD
Sbjct: 26  ETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGD 85

Query: 88  FEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSR 147
           FEAQRHWMEITQHLPI +WY++DL+YWGLDYPPLTAYHSYICG IG FFNP WF L++SR
Sbjct: 86  FEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSR 145

Query: 148 GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLIL 207
           G E ++LKTFMRLT +VSE +FYIP ++YF  W+GK R+QSP+GQ+IAAAAIL QP L+L
Sbjct: 146 GMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLML 205

Query: 208 IDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKS 267
           IDHGHFQYNSV LGLTVYAINNLLD+ YA AA+ FV+SICFKQM+LYY+PIFFAYLL +S
Sbjct: 206 IDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRS 265

Query: 268 LFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDK 327
           LF  + FN+ RFL IAIAT+ SF  ++ PLYVFGG  G  N++QS+HRIFPFARGIFEDK
Sbjct: 266 LFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGG--GKRNIIQSVHRIFPFARGIFEDK 323

Query: 328 VANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSM 387
           VANFWCVTNVI KYK+ +TQ ELQLYSL+LTVVGFLPAM+ IL++PKK+LLPY+L+AC+M
Sbjct: 324 VANFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAM 383

Query: 388 AFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQY 447
           +F+LFSFQVHEK            YTSTD NVLS VSW+NN+ LFTLWPLLKKDG+ LQY
Sbjct: 384 SFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQY 443

Query: 448 WVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYI 507
            VC +LSNWLIGNFSF TP FLPK+LTPGP +  +  +Y  RSLLP NI WK+IIVLSYI
Sbjct: 444 GVCFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYI 503

Query: 508 AMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
            M AI  L+ FV PP  YPD++V+LNCTLGF CF  FW+WNYYKLF++  K+L +L
Sbjct: 504 VMVAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/535 (71%), Positives = 446/535 (83%), Gaps = 3/535 (0%)

Query: 29  DIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDF 88
           +  EESFYASPLYD LYPF+P GSQW+ EY I+LF++IIRCA+GLGP+SG  V PM GDF
Sbjct: 16  NTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDF 75

Query: 89  EAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRG 148
           EAQRHW+EITQHLPI +WY+FDL+YWGLDYPPLTAYHSYI GK+GS  NP+WFAL+ SRG
Sbjct: 76  EAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRG 135

Query: 149 YEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILI 208
            E+ DLKT+MR TV++SE +FYIP VVYF KW+G+HR  SP+GQFIAAAAIL QP+L+LI
Sbjct: 136 LESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLI 195

Query: 209 DHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSL 268
           DHGHFQYN V LG TVYAIN+L+DEFYA AA CFVLSICFKQM LYYSPIFFAYLL + +
Sbjct: 196 DHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCV 255

Query: 269 FTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKV 328
           F   +   PRFL+IA+AT+ +FL+MY PLY+ G   G  NVLQS+HRIFPFARGIFEDKV
Sbjct: 256 FKTGI-RFPRFLSIAMATIATFLVMYIPLYIMG--SGSQNVLQSVHRIFPFARGIFEDKV 312

Query: 329 ANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMA 388
           ANFWCVTN+  KYK LFTQQ+LQLYSL+ T +GFLPA++++L YPKK+L+P+AL+ACSM+
Sbjct: 313 ANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMS 372

Query: 389 FYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYW 448
           F+LFSFQVHEK            YTST+ +VLS VSW+NN+GLFTLWPLLKKDGL LQY 
Sbjct: 373 FFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYC 432

Query: 449 VCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIA 508
           VC    NWLIGNFSF+TP FLPK LTPGPSVS +  NY  RSLLP++I WK+IIV SYI+
Sbjct: 433 VCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYIS 492

Query: 509 MGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           MGAIHVLD FV PP+ YPDLWVILNCTLGFGCF LFW+WNYYKLFS+  +SL  L
Sbjct: 493 MGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/534 (69%), Positives = 432/534 (80%), Gaps = 5/534 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RC +GLGP+SG G PP+ GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQ 73

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HSY+ G IGSFFNP+WFALD SRG+E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFES 133

Query: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAA+AIL QPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLT YAINNLLDE+YAMAA+CFVLSICFKQM LYY+PIFFAYLLS+SL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329
            PK FNI R   I+ AT+ +F LM  PLY  GG  GL N+ Q IHRIFPFARGIFEDKVA
Sbjct: 254 FPK-FNIARLTVISFATLATFALMLAPLYFLGG--GLKNIYQCIHRIFPFARGIFEDKVA 310

Query: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389
           NFWCVTNV  KYK  F+ Q+LQLYSLV TV+GFLPAM++ L +PKK+LLPY L ACSM+F
Sbjct: 311 NFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSF 370

Query: 390 YLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLK+DGL LQY V
Sbjct: 371 FLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAV 430

Query: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509
             LLSNWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 431 SFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490

Query: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           G  H LD FV PP  YPDLWV+LNCT+GF CF +FW+W+YYK+F+   KS+  L
Sbjct: 491 GLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/534 (69%), Positives = 433/534 (81%), Gaps = 5/534 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RCA+GLGP+SG   PP+ GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQ 73

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HSY+ G IG+FFNP+WFALD SRG+E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFES 133

Query: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAAAAIL QPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLT YAINNLLDE+YAMAA+CFVLSICFKQM LYY+PIFFAYLLS+SLF
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLF 253

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329
            PK FNI R   IA AT+ +F LM+ PLY  GG  GL N+ Q IHR+FPFARGIFEDKVA
Sbjct: 254 FPK-FNIARLTVIAFATLATFSLMFAPLYFLGG--GLRNIYQCIHRMFPFARGIFEDKVA 310

Query: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389
           NFWCV+N+  KYK  F+ Q+LQLYSLV TV+GFLPAMM+ L +PKK+LLPY L ACSM+F
Sbjct: 311 NFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSF 370

Query: 390 YLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDGL LQY V
Sbjct: 371 FLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVV 430

Query: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509
             LL+NWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 431 SFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490

Query: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           G  H LD FV PP  YPDLWV+LNC +GF CF +FWIW+YYK+F+   KS+  L
Sbjct: 491 GLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/534 (69%), Positives = 433/534 (81%), Gaps = 5/534 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RC +GLGP+SG G PP++GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HSY+ G IGSFFNP+WFAL+ SRG+E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133

Query: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAA+AIL QPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLT YAINNLLDE+YAMAAVCFVLSICFKQM LYY+PIFFAYLLS+SL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329
            PK FNI R   IA AT+ +F +++ PLY  GG  GL N+ Q IHRIFPFARGIFEDKVA
Sbjct: 254 FPK-FNIARLTVIAFATLATFAIIFAPLYFLGG--GLKNIHQCIHRIFPFARGIFEDKVA 310

Query: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389
           NFWCVTNV  KYK  FT Q+LQLYSL+ TV+GFLPAM++ L +PKK+LLPY L ACSM+F
Sbjct: 311 NFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSF 370

Query: 390 YLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDGL LQY V
Sbjct: 371 FLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAV 430

Query: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509
             LLSNWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 431 SFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490

Query: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           G  H LD FV PP  YPDLWV+LNC +GF CF +FW+W+YYK+F+   KS+  L
Sbjct: 491 GFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/534 (70%), Positives = 440/534 (82%), Gaps = 4/534 (0%)

Query: 28  HDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGD 87
             I +ESF+ASPL+D L PFRP  +QW  +Y IVLF+LIIRC VGLG FSG  VPPM GD
Sbjct: 10  RKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGD 69

Query: 88  FEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSR 147
           FEAQRHWME+T +LP+ +WYW+DL YWGLDYPPLTAYHSYI GK+G  F+P WF L  SR
Sbjct: 70  FEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSR 129

Query: 148 GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLIL 207
           G E+ DLK++MR TVL+SE L YIPGV+YF KW+GKHR Q+PIGQ+IAAAAIL QPSLIL
Sbjct: 130 GQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLIL 189

Query: 208 IDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKS 267
           IDHGHFQYNSV LGLTVYAINNLLDE+YA AA+CFVLS+CFKQM LYY+PIFF+YLLSKS
Sbjct: 190 IDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKS 249

Query: 268 LFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDK 327
           LF+P LFN+PR LA+A AT+ SF  M+ PLY++G   G+ NVLQSIHRIFPF+RGIFEDK
Sbjct: 250 LFSP-LFNLPRLLAVAAATLISFAAMFFPLYMWG---GIRNVLQSIHRIFPFSRGIFEDK 305

Query: 328 VANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSM 387
           VANFWC +N+  KYK+L+TQ +LQ+YSL  T +GFLPA ++I FYPKK+L+PYAL+ACSM
Sbjct: 306 VANFWCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSM 365

Query: 388 AFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQY 447
           +F+LFSFQVHEK            YTSTD NVLS VSW+NN+  FTLWPLLKKDGL LQY
Sbjct: 366 SFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQY 425

Query: 448 WVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYI 507
              LLLSNWLIGNFSF+TP FLPK LTPGPS S + ENY  RSLLP NIFWK+IIV SYI
Sbjct: 426 ATLLLLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYI 485

Query: 508 AMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLH 561
           +MG +H+LD +V PP  YPDLWV+LNC+LGF  FFLFW+WNYYK+F++  K+L+
Sbjct: 486 SMGILHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLY 539

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 431/534 (80%), Gaps = 5/534 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESFYASP+YD LYPFRP G+QW+ EY I + ++I+RCA+GLGP+SG   PP+ GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEITQHLP+ KWYW+DL+YWGLDYPPLTA+HS + G IG+FFNP+WFALD SRG+E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133

Query: 152 QD--LKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILID 209
            D  LKT+MR TV++S+ LFY P V+YF KWLG++R QSPIGQ IAAAAIL QPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 210 HGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLF 269
           HGHFQYNSV LGLT YAINNLLDE+YAMAAVCFVLSICFKQM LYY+PIFFAYLLS+SL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 270 TPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVA 329
            PK FNI R   IA AT+ +F ++  PLY  GG  GL N+ Q I+RIFPF+RGIFEDKVA
Sbjct: 254 FPK-FNIARLTVIAFATLATFSVILAPLYFLGG--GLRNIHQCIYRIFPFSRGIFEDKVA 310

Query: 330 NFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAF 389
           NFWCVTN+  KYK  FT Q+LQLYSLV TV+GFLPAM++ L +PKK+LLPY L ACSM+F
Sbjct: 311 NFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSF 370

Query: 390 YLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWV 449
           +LFSFQVHEK            Y+STD NVLS VSW+NN+ LFTLWPLLKKDGL LQY V
Sbjct: 371 FLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTV 430

Query: 450 CLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAM 509
             LLSNWLIGNFSFITP FLPK LTPGPS+S I  +Y  RSLLP N+ WK  I+ +YIAM
Sbjct: 431 SFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAM 490

Query: 510 GAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           G  H+LD FV PP  YPDLWV+LNC +GF CF +FWIW+YYK+F+   KS+  L
Sbjct: 491 GVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/531 (66%), Positives = 430/531 (80%), Gaps = 4/531 (0%)

Query: 33  ESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQR 92
           E+F+ASP+YD L PFRP G+QW  +Y IV+F+LIIRCAVGLG +SG   PPMFGDFEAQR
Sbjct: 40  EAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFGDFEAQR 99

Query: 93  HWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEAQ 152
           HWMEITQHLP+ +WYW+DL+YWGLDYPPLTAYHSY+ GK+GSFF   WF L+SSRGYE+ 
Sbjct: 100 HWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESSRGYESL 159

Query: 153 DLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHGH 212
           +LK++MR TV++SE L YIP V+YF KW+GK+R QSPIGQ+IAAAAIL QP+LIL+DHGH
Sbjct: 160 NLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALILVDHGH 219

Query: 213 FQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTPK 272
           FQYN V LG+TVY +NNLLD FYAM A+CFVLS+CFKQM LYYSPIFFAYLLSKS ++P 
Sbjct: 220 FQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSKSTYSPG 279

Query: 273 LFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANFW 332
           + N+PR  AI+++T  +F+  +GP+Y+FGG +   N++QS+HRIFPFARGIFEDKVANFW
Sbjct: 280 I-NLPRLFAISVSTALAFIGSFGPIYIFGGYK---NLVQSMHRIFPFARGIFEDKVANFW 335

Query: 333 CVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYLF 392
           CV+N+  KY+ LFTQ++LQLYSL+ TV+G LP+ +I   YPK++LLPYAL+ACSM+F+LF
Sbjct: 336 CVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFFLF 395

Query: 393 SFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCLL 452
           SFQVHEK            YTS D NVLS V W+NN+ LFTLWPLLKKD L LQY V  +
Sbjct: 396 SFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVMFM 455

Query: 453 LSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGAI 512
            SNWLIGNFSF+TP FLPK LTPGPS+S I  +Y   SLLP+++ W++IIV SYIAMG I
Sbjct: 456 FSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMGII 515

Query: 513 HVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           H LD +V+PP  YPDLWV+ NC+LGF CF  FWIWN YKLF M   +L  L
Sbjct: 516 HFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/530 (66%), Positives = 423/530 (79%), Gaps = 4/530 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
            E F+ASPLYD L PFRP  +Q+  EY IV+F+L+IRCAVGLG FSG    P+ GDFEAQ
Sbjct: 9   NEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIHGDFEAQ 68

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWME+T HLP+ +WYW+DL+YWGLDYPPLTAYHSY+ GK+GS  N  WFAL SSRG E 
Sbjct: 69  RHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLSSRGIEN 128

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
            D+K +MR TV++SEA  YIP V+YF KW G  RRQSPIGQ+IAAAAIL QPSLILIDHG
Sbjct: 129 PDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYNSV LGLTVY+INNLLD +Y  AA+CFVLS+CFKQM LYYSP+FFAYLLS+ L +P
Sbjct: 189 HFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLSECLISP 248

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
            L N+PRFL++A +TV SF +++ PLYVFGG +   NVLQSIHRIFPF+RGIFEDKVANF
Sbjct: 249 SL-NVPRFLSVAFSTVISFCIIFSPLYVFGGTK---NVLQSIHRIFPFSRGIFEDKVANF 304

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCV+NV+FKY   +TQQELQ +S++ T  GFLP+ +++L YPKK+++P+AL+ACSMAF+L
Sbjct: 305 WCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAFFL 364

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           FSFQVHEK            Y STD NVLS VSW+NN+ LFTLWPLLKKD LTLQY + +
Sbjct: 365 FSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGILM 424

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
           LLSNWLIGNFSF+TP FLPK +TPGPS+S++ E Y  RS LP N FWK+IIV SY+ M A
Sbjct: 425 LLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIMAA 484

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLH 561
           IH+LD FV  P   PDLWV+LNC LGF CF +FW+W +YKLF+M   +L 
Sbjct: 485 IHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQ 534

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/536 (65%), Positives = 418/536 (77%), Gaps = 4/536 (0%)

Query: 28  HDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGD 87
             +P+ESF+ASPLYD L PFRP  +Q+  EY IV+F+L+IRCAVGLG FSG    PM GD
Sbjct: 5   KSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGD 64

Query: 88  FEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSR 147
           FEAQRHWME+T +LP+ +WYWFDL+YWGLDYPPLTAYHSY  GK+GS  NP WFAL SSR
Sbjct: 65  FEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSR 124

Query: 148 GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLIL 207
           G E  +LK +MR TV++SEA  YIP V+YF KW G  RRQSPIGQ+IAAAAIL QPSLIL
Sbjct: 125 GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184

Query: 208 IDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKS 267
           IDHGHFQYNSV LGLTVYAINNLLD F+  AA+CF+LS+CFKQM L+YSPIFFAYLLS+S
Sbjct: 185 IDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRS 244

Query: 268 LFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDK 327
           LF+P  F   RF+++A++TV +F LM+ PLYVFG   G+ NVLQSIHRIFPF+RGIFEDK
Sbjct: 245 LFSPS-FKFSRFMSVALSTVITFCLMFSPLYVFG---GMKNVLQSIHRIFPFSRGIFEDK 300

Query: 328 VANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSM 387
           VANFWCV+NVI KY   FTQ +LQ  S   T  GFLP+  +++ YPKK+++PY L+ACSM
Sbjct: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360

Query: 388 AFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQY 447
           AF+LF FQVHEK            + STD NVL+ VSW+NN+ LFTLWPLLKKD L LQY
Sbjct: 361 AFFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420

Query: 448 WVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYI 507
            + +LLSNWLIGNFSF+TP FLP  +TPGPS+S + E Y  RS LP NI WK++I+ SYI
Sbjct: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480

Query: 508 AMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
            M  IH+LD FV PP   PDLWV++NC LGF CF +FW+WN YKLF+M  KS+  L
Sbjct: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/532 (64%), Positives = 420/532 (78%), Gaps = 4/532 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           EESF+ASPLYD LYP RP  +QW  +Y I++F+LI+R AVGLG +SG G  P+FGDFEAQ
Sbjct: 22  EESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPLFGDFEAQ 81

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWMEIT  LPI +WY++DL+YWGLDYPPLTAYHSYI G++GSF N  WF L++SRG+E+
Sbjct: 82  RHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLNTSRGFES 141

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
            DLK+FMR+TVL+SE + YIP V+YF +W+G+HR QSPIGQ++A AAIL QPSLILIDHG
Sbjct: 142 IDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPSLILIDHG 201

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYN V LGL VY INNLLDEFY  AA+CFVLS+ FKQM LYYSP+ FAYL S+S + P
Sbjct: 202 HFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLFSRSAYYP 261

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
           + FN PRF  IAIAT+ +F  +Y PL +FG      N++QS++R+FPF+RGIFEDKVANF
Sbjct: 262 R-FNFPRFAGIAIATLLTFGALYAPLCLFG---DFRNIIQSVYRVFPFSRGIFEDKVANF 317

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCVTNVI KY+ L+TQ++LQ Y L+ T +   PA +II  YPKK+LLPYAL+ACSMAF+L
Sbjct: 318 WCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMAFFL 377

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           FSFQVHEK            + ST+ +VLS V+W+NN+ LFTLWPLLKKDGL LQY +  
Sbjct: 378 FSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYAIMF 437

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
           LLSNWL+GNFSF+TP FLPK LTPGPSVS + ++Y  RSLLP+NIFW++IIV SY+ M  
Sbjct: 438 LLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVCMAF 497

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           IH+LD +V PP  YPD+WV+  C LGF CF  FW+WNYY+L+ M   SL+ L
Sbjct: 498 IHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/532 (62%), Positives = 424/532 (79%), Gaps = 4/532 (0%)

Query: 32  EESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQ 91
           +E+F+ASPLYD LYP RP  +QW  +Y IV+F+LIIR AVGLG +SG G PPMFGDFEAQ
Sbjct: 36  KEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQ 95

Query: 92  RHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEA 151
           RHWME+TQH+P+ KWY+  L+YWGLDYPPLTAYHSY+ GK+GS+ +P WF+L +SRGYE+
Sbjct: 96  RHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYES 155

Query: 152 QDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSLILIDHG 211
           +DLK++MRLTV++SE  FYIP V+YF +W+G+ R+QSPIGQ+IA AAIL QP+LILIDHG
Sbjct: 156 EDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHG 215

Query: 212 HFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLSKSLFTP 271
           HFQYN V LGLTV AINNLLD++YA+AAV FV S+ FKQM LYY+P+ F YLLS+S++ P
Sbjct: 216 HFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYP 275

Query: 272 KLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIFEDKVANF 331
           +L NIPRF+A+A+AT+ +F ++Y PLY+ G    ++ + QSIHR+FPF RG+FEDKVANF
Sbjct: 276 RL-NIPRFVAVAVATLIAFGVLYAPLYLLG---NISAIFQSIHRVFPFERGLFEDKVANF 331

Query: 332 WCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
           WCVTNV+ KYK  +T  +L+ +SLVLT    LP+++I   YPKK++LPYAL+ACSM+F+L
Sbjct: 332 WCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFL 391

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLTLQYWVCL 451
           F FQVHEK            YTSTD NVLS V+W+NNI LFTLWPLLKKDGL+LQY +  
Sbjct: 392 FGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMF 451

Query: 452 LLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVLSYIAMGA 511
           LLSNWLIGNFSFITP FLPKVLTPGPSVS + + Y  RSLLP NI W++IIV+SYI +GA
Sbjct: 452 LLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYICVGA 511

Query: 512 IHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563
           IH+ + +  P    PD+WV+ NC +G   F LFW+WN YK+F+M   ++  L
Sbjct: 512 IHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 112/434 (25%), Positives = 188/434 (43%), Gaps = 76/434 (17%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY  +   +    F P 
Sbjct: 36  IPDYFSTDFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQ----FVPK 91

Query: 140 WFALDSS-----RGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFI 194
           +   D        G        F RLTV++SE L ++   V+        + QS    F+
Sbjct: 92  FVKEDGCLDILPEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FV 147

Query: 195 AAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLY 254
            A++I+L P  ++IDH HFQYN    G+ + +I    ++ Y +  + + +++CFK + LY
Sbjct: 148 VASSIILSPGFLMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLY 207

Query: 255 YSPIFFAYLLSKSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGG 302
            +P +F +LL   +   + F    +            + +    VC   + +GP +    
Sbjct: 208 LAPCYFVFLLRAYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW---- 263

Query: 303 DQGLNNVLQSIHRIFPFARGIFEDKVA-NFWCVTNVIFKY-KMLFTQ------------Q 348
                ++ Q + R+FPF+RG+     A NFW + + + K   +LF +            +
Sbjct: 264 ----RDMNQLLSRLFPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIE 319

Query: 349 ELQLY-----------------------SLVLTVVGFLPAMMIILFYPKKYLLPYALSAC 385
           E + +                       + VLT+   + A++ +LF P       +L+ C
Sbjct: 320 ERKRWNNGSRGLVEDVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLC 379

Query: 386 SMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL-KKDGLT 444
             A +LF + VHEK                DR +LS    + + G  +L+PLL K     
Sbjct: 380 GFASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLSSFMLVGSAGYVSLFPLLFKGQDFL 438

Query: 445 LQYWVCLLLSNWLI 458
           L+   CL L  W I
Sbjct: 439 LK---CLYLIVWCI 449

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 109/421 (25%), Positives = 175/421 (41%), Gaps = 84/421 (19%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDS- 145
           DF+  R+W+ IT  LP+HKWY+     W LDYPP  AY  ++  +    F P     D  
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQ----FVPQRVQDDGC 99

Query: 146 ----SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201
               + G        F R+TV+VSE L ++   VY    + K         F+ A++I+L
Sbjct: 100 LDIVAVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVL 155

Query: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261
            P  ++IDH HFQYN     + + +I     + Y +    F  ++CFK + LY +P FFA
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 262 -----YLLSKSLFTPKLFNI-------PRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNV 309
                Y+L  S F  + +N             +    +  F + + P         +  +
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF--------IYQL 267

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWCVTNVIFKYKMLF----------------------- 345
            Q + R+FPF+RG+     A NFW + + + K   LF                       
Sbjct: 268 PQLMSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVT 327

Query: 346 ---TQQELQLYSL-----------------------VLTVVGFLPAMMIILFYPKKYLLP 379
               + +LQ Y++                       +LT+   + A++ +LF P      
Sbjct: 328 IDEIKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFV 387

Query: 380 YALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 439
            +L+ C  A +LF + VHEK             T TDR +L+    + + G  +L+PLL 
Sbjct: 388 GSLTLCGFASFLFGWHVHEKAVLLIIIPFSFLVT-TDRRLLTPFHLVASAGYVSLFPLLH 446

Query: 440 K 440
           +
Sbjct: 447 E 447

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 113/418 (27%), Positives = 180/418 (43%), Gaps = 76/418 (18%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT +LPI KWY+ +   W LDYPP  AY  ++  +       N   LD  
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G        F RLTV++SE L +     Y      K R Q     F+ A++I+L P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           ++IDH HFQYN     + + +I     + Y   AV + +S+CFK + LY +P +F +LL 
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLLR 239

Query: 266 KSLFTPKLFNIPRFLAI----------AIATVCS--FLLMYGPLYVFGGDQGLNNVLQSI 313
             +   + F    ++ +           +A + S  F + + P ++F   Q L+      
Sbjct: 240 AYVLNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAP-FIFQLPQVLS------ 292

Query: 314 HRIFPFARGIFEDKVA-NFWCVTNVIFK------------YKMLF--------------- 345
            R+FPF+RG+     A NFW + + I K            +K++                
Sbjct: 293 -RLFPFSRGLTHAYWAPNFWAMYSFIDKVLTFVMLRFPYVHKLMLSFTSSPILPKTAAEI 351

Query: 346 ----------TQQELQLY------------SLVLTVVGFLPAMMIILFYPKKYLLPYALS 383
                     T+  +Q Y            + +LT+   + A++ +LF P       +L+
Sbjct: 352 RERMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYKRFIGSLT 411

Query: 384 ACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 441
            C MA YLF + VHEK              S DR +L     +   G  +L+PLL ++
Sbjct: 412 LCGMASYLFGWHVHEKAIMLVIIPFSFLVVS-DRRLLISFMLVTAAGYVSLFPLLFEN 468

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  119 bits (299), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 104/417 (24%), Positives = 176/417 (42%), Gaps = 76/417 (18%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT  LP+ +WY+ +   W LDYPP  AY  +   ++          LD  
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
           + G        F RLTV+ SE L ++   VY    + K         F+ A++I+L P  
Sbjct: 104 KVGQFGMPTIVFQRLTVIASEILLFVVLQVY----INKSHISERSANFVVASSIVLSPGF 159

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           ++IDH HFQYN     + + +I    ++ Y +  + F ++ICFK + LY +P FF +LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLLR 219

Query: 266 KSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSI 313
             +     F+   +              +    +C F + + P         ++   Q +
Sbjct: 220 VYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF--------ISQWPQLL 271

Query: 314 HRIFPFARGIFEDKVA-NFWCVTNVIFKYKMLF--------------------------T 346
            R+FPF+RG+     A NFW + +++ K   L                            
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEI 331

Query: 347 QQELQLYSL-----------------------VLTVVGFLPAMMIILFYPKKYLLPYALS 383
           +Q+L  Y++                       +LT+   + A++ +LF P       +L+
Sbjct: 332 KQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 384 ACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 440
            C  A +LF + VHEK             TS DR +L+  + + + G  +L+PLL +
Sbjct: 392 LCGFASFLFGWHVHEKAIMLIIIPFSFLVTS-DRRLLTPFNLLASAGYVSLFPLLHE 447

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 111/423 (26%), Positives = 176/423 (41%), Gaps = 86/423 (20%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ +T  LP+ +WY+     W LDYPP  AY  +I  +       +   LD  
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G   +    F RL+V+ SE L ++    +      K R QS    FI A +I+L P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           +++DH HFQYN     + + +I     + Y + AV +  ++CFK + LY +P +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 266 KSLFTPKLFNIPRF-----------------LAIAIATVCSFLLMYGPLYVFGGDQGLNN 308
             +   K F    +                 + ++I  VC     +GP ++F   Q L  
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVC-----FGP-FIFDMPQLLT- 284

Query: 309 VLQSIHRIFPFARGIFEDKVA-NFWCV---TNVIFKYKML-------------------F 345
                 R+FPF+RG+     A NFW +   T+ +    ML                    
Sbjct: 285 ------RLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPA 338

Query: 346 TQQELQLY---------------------------SLVLTVVGFLPAMMIILFYPKKYLL 378
           T +E+Q                             + +LT+   L A++ +LF P     
Sbjct: 339 TIKEIQKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRF 398

Query: 379 PYALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 438
             +L+ C MA YLF + VHEK                DR +LS     ++ G  +L+PLL
Sbjct: 399 IGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFLVVC-DRRLLSSFMLASSAGYVSLFPLL 457

Query: 439 KKD 441
            ++
Sbjct: 458 YEN 460

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  117 bits (294), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 106/419 (25%), Positives = 174/419 (41%), Gaps = 84/419 (20%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDS- 145
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +   +    F P++   D  
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPSYVKSDGC 91

Query: 146 ----SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201
                 G        F RLTV+ SE L ++   VY        R QS    F+ A++I +
Sbjct: 92  LDIVEVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAI 147

Query: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261
            P  ++IDH HFQYN     + + +I    ++ Y      + +++CFK + LY +P +F 
Sbjct: 148 SPGFLIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFV 207

Query: 262 YLLSKSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGGDQGLNNV 309
           +LL   +   K F    +            + +    + +F + +GP ++F   Q L   
Sbjct: 208 FLLRAYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIFDLPQLLT-- 264

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWCVTNVIFK------YKMLFT---------------- 346
                R+FPF+RG+     A NFW + + I K       KM +T                
Sbjct: 265 -----RLFPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPAS 319

Query: 347 ---------------------------QQELQLYSLVLTVVGFLPAMMIILFYPKKYLLP 379
                                       Q +   + +LT++  + A++ +LF P      
Sbjct: 320 LNEIKAKMAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFM 379

Query: 380 YALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 438
            +++ C +A +LF + VHEK              S DR +LS    + + G  +L+PLL
Sbjct: 380 GSMTLCGLASFLFGWHVHEKAIMLVIIPFSFLVIS-DRRLLSSFMLLTSAGYVSLFPLL 437

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  116 bits (290), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 108/423 (25%), Positives = 181/423 (42%), Gaps = 83/423 (19%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +   +    F P     D  
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQ----FVPKVVRDDGC 109

Query: 147 R-----GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKW-LGKHRRQSPIGQFIAAAAIL 200
                 G        F R +V++SE L ++      ++W + K +       FI A +I+
Sbjct: 110 LDIVPVGQFGWATVVFQRTSVIISEILLFV-----VLQWFINKSKDNERTQSFIVATSII 164

Query: 201 LQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFF 260
           L P  ++IDH HFQYN     + + +I     E Y +  + + +++CFK + LY +P +F
Sbjct: 165 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYF 224

Query: 261 AYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGD----------QGLNNVL 310
            +LL   +   K F    +  + +      L+ +  L+  GG             + ++ 
Sbjct: 225 VFLLRAYVLNVKNFKFKSYKDLIL------LIQWNNLFKLGGIVLSIFGICFLPFIYHLP 278

Query: 311 QSIHRIFPFARGIFEDKVA-NFWCV--------TNVIFK----YKML----------FTQ 347
           Q   R+FPF RG+     A NFW +        T ++ K    +K+L           T+
Sbjct: 279 QVFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTR 338

Query: 348 QELQ-----------------LYSLVL---------TVVGF--LPAMMIILFYPKKYLLP 379
           +E+Q                 +Y ++L          + GF  L A++ +LF P      
Sbjct: 339 EEIQSRIMEYGNNGSKGLVEDVYFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRFI 398

Query: 380 YALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 439
            +L+ C MA +LF + VHEK                DR +L+    +++ G  +L+PLL 
Sbjct: 399 GSLTLCGMASFLFGWHVHEKAILLVIIPFSFL-VVCDRRLLTSFMLVSSAGYVSLFPLLY 457

Query: 440 KDG 442
           K+ 
Sbjct: 458 KND 460

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 109/410 (26%), Positives = 173/410 (42%), Gaps = 60/410 (14%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+WM IT  LPI KWY+ +   W LDYPP  AY  +   +       +   LD  
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G        F RLTV++SE   +     Y        R QS    F+ A++I+L P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           +++DH HFQYN+    + + +I     + Y   AV + +++CFK + LY +P +F +LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 266 KSLFTPKLFNIPRFLAIAIATVCSFLLMYGP--LYVFGGDQG--LNNVLQSIHRIFPFAR 321
             +   K F    +  +        LL  G   L +FG      +  + Q + R+FPF+R
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPFIFQMPQVLSRLFPFSR 344

Query: 322 GIFEDKVA-NFWCVTNVI----------FKYKMLFTQQ------------ELQLY----- 353
           G+     A NFW + + +          F Y   F  +            E++L      
Sbjct: 345 GLTHAYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIAEIKLRMEENN 404

Query: 354 ----------------------SLVLTVVGFLPAMMIILFYPKKYLLPYALSACSMAFYL 391
                                 + +LT+   + A++ +LF P       +L+ C +A YL
Sbjct: 405 NGSKGLVEDVFFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFIGSLTLCGLASYL 464

Query: 392 FSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKKD 441
           F + VHEK                DR +LS    + + G  +L+PLL ++
Sbjct: 465 FGWHVHEKAILLVIIPFSFLVV-CDRRLLSSFMLVASAGYVSLFPLLYEN 513

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 108/426 (25%), Positives = 181/426 (42%), Gaps = 77/426 (18%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHS-YICGKIGSFFNP 138
           VP  F  DF+  R+W+ IT  + +  WY+     W LDYPP  AY   +I   + SF   
Sbjct: 57  VPDYFSTDFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRR 116

Query: 139 NWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAA 198
           +        G        F RLTV+ SE+L ++   +Y      + R QS    FI A++
Sbjct: 117 DGCLDIVEVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASS 172

Query: 199 ILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPI 258
           I+L P  +++DH HFQYN     + V +I    ++ Y + A+ + +++CFK + LY +P 
Sbjct: 173 IVLSPGFLIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPC 232

Query: 259 FFAYLLSKSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGGDQGL 306
           +F +LL   +   + F    +              + +  V  F L +GP ++F   Q L
Sbjct: 233 YFVFLLRVYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGP-FIFDMPQLL 291

Query: 307 NNVLQSIHRIFPFARGIFEDKVA-NFWCVTNVIFKYKMLFT------------------- 346
           +       R+FPF+RG+     A NFW + + + K   +F                    
Sbjct: 292 S-------RLFPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLL 344

Query: 347 -------QQELQLY-----------------------SLVLTVVGFLPAMMIILFYPKKY 376
                  +Q +  +                       + +LT+   + A++ +LF P   
Sbjct: 345 PSSIEEIRQRIAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFK 404

Query: 377 LLPYALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWP 436
               +L+ C MA YLF + VHEK                DR +L   + +++ G  +L+P
Sbjct: 405 RFMGSLTLCGMASYLFGWHVHEKAIMLVIIPFSFL-VVFDRRLLISFTLVSSAGYVSLFP 463

Query: 437 LLKKDG 442
           LL ++ 
Sbjct: 464 LLYENA 469

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 110/428 (25%), Positives = 173/428 (40%), Gaps = 85/428 (19%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT  LPI +WY+     W LDYPP  AY  +   +    F P 
Sbjct: 59  IPDYFSTDFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ----FVPK 114

Query: 140 WFALDS-----SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFI 194
               D        G        F RLTV+ SE L ++   +Y        R QS    F+
Sbjct: 115 SVRDDGCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FV 170

Query: 195 AAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLY 254
            A++I+L P  ++IDH HFQYN     + + +I    ++ Y + AV +  +ICFK + LY
Sbjct: 171 VASSIVLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLY 230

Query: 255 YSPIFFAYLLSKSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGG 302
            +P +F +LL   +     F    +            L +A   V  F + + P      
Sbjct: 231 LAPCYFVFLLRAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF----- 285

Query: 303 DQGLNNVLQSIHRIFPFARGIFEDKVA-NFWC--------VTNVIFK--YKMLFTQQELQ 351
               + + Q + R+FPF+RG+     A NFW         +T V+ K  Y   F  + ++
Sbjct: 286 ---AHQMPQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIK 342

Query: 352 ---------------------------------------LYSLVLTVVGFLPAMMIILFY 372
                                                    + +LT+   + A++ +LF 
Sbjct: 343 PPLIPQNIKEINERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFD 402

Query: 373 PKKYLLPYALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLF 432
           P       +L+ C +A +LF + VHEK                DR +L     + + G  
Sbjct: 403 PSFKRFVGSLTLCGLASFLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLVPFMLVASAGYV 461

Query: 433 TLWPLLKK 440
           +L+PLL K
Sbjct: 462 SLYPLLYK 469

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  110 bits (275), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 174/421 (41%), Gaps = 69/421 (16%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT +LP+ +WY+     W LDYPP  AY  +   +    F P 
Sbjct: 38  IPDYFSTDFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQ----FVPG 93

Query: 140 WFALDS-----SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFI 194
               D       +G        F R TV++SE L ++   V+        R QS    F+
Sbjct: 94  TVKQDGCLEIVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FV 149

Query: 195 AAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLY 254
            A++I+L P+ +++DH HFQYN     + + +I       Y   A  + +++CFK + LY
Sbjct: 150 IASSIVLSPAFLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLY 209

Query: 255 YSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLY--VFGGDQG--LNNVL 310
            +P +F +LL       + F    +  +        L   G +   VF    G  + ++ 
Sbjct: 210 LAPCYFVFLLRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLP 269

Query: 311 QSIHRIFPFARGIFEDKVA-NFWC--------VTNVIFK--YKMLFTQQELQ-------- 351
           Q + R+FPF+RG+     A NFW         +T V+ K  Y   FT + +Q        
Sbjct: 270 QVLTRLFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTI 329

Query: 352 -------------------------------LYSLVLTVVGFLPAMMIILFYPKKYLLPY 380
                                            +  LT    + A++ +LF P       
Sbjct: 330 DEIKQRIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIG 389

Query: 381 ALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLKK 440
           +L+ C +A YLF + VHEK              + DR +L+    +   G  +L+PLL +
Sbjct: 390 SLTLCGLASYLFGWHVHEKAIMLAIVPFSFL-VACDRRLLTSYMLLAASGYVSLFPLLYE 448

Query: 441 D 441
           +
Sbjct: 449 N 449

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 110/421 (26%), Positives = 172/421 (40%), Gaps = 72/421 (17%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  +   +       +
Sbjct: 59  IPDYFSTDFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRD 118

Query: 140 WFALDSSR-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAA 198
              LD    G        F RLTV+ SE L +    +Y        R QS    F+ A++
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASS 174

Query: 199 ILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPI 258
           I+L P  ++IDH HFQYN     + + +I    ++ Y   AV +  SICFK + LY +P 
Sbjct: 175 IVLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPC 234

Query: 259 FFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ-GLNNVL------- 310
           +F +LL   +     F    +          FL+ +  L+  G    G+  +        
Sbjct: 235 YFVFLLRAYVLNVNNFKFKSYKDFL------FLIRWTNLFKLGSIVIGIFTICFLPFAHQ 288

Query: 311 --QSIHRIFPFARGIFEDKVA-NFWC--------VTNVIFK--YKMLFTQQELQ------ 351
             Q + R+FPF+RG+     A NFW         +T ++ K  Y  +F  + ++      
Sbjct: 289 MPQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLKLPYVHMFATKLIKPPLIPK 348

Query: 352 --------------------------------LYSLVLTVVGFLPAMMIILFYPKKYLLP 379
                                             + +LT+   + A++ ILF P      
Sbjct: 349 DIKEINERLLANNGSKGLVQDVFFVILPQIPPRLTFILTIFYQILAVLPILFDPSFKRFI 408

Query: 380 YALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLLK 439
            +L+ C +A YLF + VHEK                DR +L     + + G  +L+PLL 
Sbjct: 409 GSLTLCGLASYLFGWHVHEKAIMLVIIPFTFL-VGFDRRLLIPFMLVASAGYVSLYPLLF 467

Query: 440 K 440
           K
Sbjct: 468 K 468

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 106/415 (25%), Positives = 167/415 (40%), Gaps = 76/415 (18%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++  +          ALD  
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G        F RLTV+ SE L ++   V+        + +S    F+ A++I+L P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPGF 170

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           ++IDH HFQYN       + +I     + Y   A  + +++CFK + LY +P +F +LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 266 KSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSI 313
             +   K F    +              +A   +  F + +GP         L ++ Q +
Sbjct: 231 AYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPF--------LYDLPQVM 282

Query: 314 HRIFPFARGIFEDKVA-NFWCV--------TNVIFK-----------------------Y 341
            R+FPF+RG+     A NFW +        T V+ K                        
Sbjct: 283 TRLFPFSRGLTHAYWAPNFWAIYSFLDKILTFVMLKLPYVHAFATKFISPPLIPESLDDL 342

Query: 342 KMLFTQQELQLYSLVLTV-VGFLPAM------MIILFYPKKYLLPY-----------ALS 383
           K    Q       LV  V    LP +      ++ +FY    ++P            +L+
Sbjct: 343 KERLVQNNSGTKGLVQDVFFAILPQISPKLTFILTMFYQALAVIPLLFDPSFKRFIGSLT 402

Query: 384 ACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 438
            C ++ YLF + VHEK                DR +LS    +   G  +L+PLL
Sbjct: 403 LCGLSSYLFGWHVHEKAIMLVIVPFSFL-VVCDRRLLSSFMLVAAAGYVSLFPLL 456

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 127/283 (44%), Gaps = 16/283 (5%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKI--GSFFNPNWFALD 144
           DFE  R+W+ +T  LP+ KWY      W +DYPPL A+  +   ++  G+        L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKL- 117

Query: 145 SSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPS 204
            + G        F RLTV+ SE L Y+   VY      + R  +    F+   ++ L P+
Sbjct: 118 VAEGRYGWPTVVFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 205 LILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLL 264
            +L+DH HFQYN     + V +I    +  Y +    F +++C K + LY +P +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 265 SKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYV------FGGDQGLNNVLQSIHRIFP 318
              +     F    +  +  A     L   G + +      F    G+  + Q + R+FP
Sbjct: 234 RAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGV--MPQLMARLFP 291

Query: 319 FARGIFEDKVA-NFWCVTNVIFKYKMLFTQQELQLYSLVLTVV 360
           F+RG+     A NFW + + + K       +   +Y L  ++V
Sbjct: 292 FSRGLTHAYWAPNFWAIYSFVDKVLTFLMLRVPYVYKLATSLV 334

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 121/267 (45%), Gaps = 23/267 (8%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT  LPI KWY+     W LDYPP  AY  +   +       +
Sbjct: 59  IPDYFSTDFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRD 118

Query: 140 WFALDSSR-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAA 198
              LD    G        F RLTV+ S+ L ++   VY        R QS    F+ A++
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASS 174

Query: 199 ILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPI 258
           I+L P   +IDH HFQYN     + + +I     + Y + A+ +  +ICFK + LY +P 
Sbjct: 175 IVLSPGFFMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPC 234

Query: 259 FFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ-GLNNVL------- 310
           +F +LL   +     F    +          FL+ +  L+  G    G+  +        
Sbjct: 235 YFVFLLRAYVLNVNNFKFKSYKDFL------FLIRWANLFKLGSIVIGIFTICFLPFAHQ 288

Query: 311 --QSIHRIFPFARGIFEDKVA-NFWCV 334
             Q + R+FPF+RG+     A NFW +
Sbjct: 289 MPQVLSRLFPFSRGLTHAYWAPNFWAL 315

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 121/267 (45%), Gaps = 23/267 (8%)

Query: 81  VPPMFG-DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPN 139
           +P  F  DF+  R+W+ IT  LPI +WY+     W LDYPP  AY  +   +       +
Sbjct: 59  IPDYFSTDFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRD 118

Query: 140 WFALDSSR-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAA 198
              LD    G        F RLTV+ SE L Y    +Y        R QS    F+ A++
Sbjct: 119 DGCLDIVEVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASS 174

Query: 199 ILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPI 258
           I+L P  ++IDH HFQYN     + + +I    ++ Y + A  +  +ICFK + LY +P 
Sbjct: 175 IVLSPGFLMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPC 234

Query: 259 FFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQ-GLNNVL------- 310
           +F +LL   +     F    +          FL+ +  L+  G    G+  +        
Sbjct: 235 YFVFLLRAYVLNVNNFKFKSYKDFL------FLIRWANLFKLGSIVIGIFTICFVPFAHQ 288

Query: 311 --QSIHRIFPFARGIFEDKVA-NFWCV 334
             Q + R+FPF+RG+     A NFW +
Sbjct: 289 MPQVLSRLFPFSRGLTHAYWAPNFWAL 315

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/266 (28%), Positives = 119/266 (44%), Gaps = 34/266 (12%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDS- 145
           DF+  R+W+ IT  LP++KWY      W LDYPP  AY  +   +    F P   A D  
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQ----FVPKSVAEDGC 107

Query: 146 ----SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201
                 G        F R+TV++SE + Y    V+    +           F+ A++I+L
Sbjct: 108 LDIVKVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVL 163

Query: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261
            P L+++DH HFQYN    G+ + +I    ++ Y + A  F +++CFK + LY +P +F 
Sbjct: 164 SPGLLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFV 223

Query: 262 YLLSKSLFTPKLFNIPRF------------LAIAIATVCSFLLMYGPLYVFGGDQGLNNV 309
           +LL   +     F    +            L +A   +  F L + P         +   
Sbjct: 224 FLLRAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF--------ITTW 275

Query: 310 LQSIHRIFPFARGIFEDKVA-NFWCV 334
            Q + R+FPF+RG+     A N W V
Sbjct: 276 QQLLARLFPFSRGLTHAYWAPNVWAV 301

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 104/426 (24%), Positives = 171/426 (40%), Gaps = 89/426 (20%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT  LP+ +WY+     W LDYPP  AY  ++  +    F P     D  
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQ----FVPAAVRADGC 108

Query: 147 RGYEAQDL-----KTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILL 201
                Q +       F R TV+ SE L ++   VY        + QS    F+ A++I+L
Sbjct: 109 LDIVPQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVL 164

Query: 202 QPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFA 261
            P L+++DH HFQYN     + + +I       + + A  +  ++CFK + LY +P +F 
Sbjct: 165 SPMLLIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFM 224

Query: 262 YLLS--------------KSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLN 307
           +LL               K LF  ++ +  R   +    +   ++ + P   F  D    
Sbjct: 225 FLLRTYVLQFEGFRFKSYKDLF--RIIHWGRLFKLGGVVLGVAVVCFAP---FARDMP-- 277

Query: 308 NVLQSIHRIFPFARGIFEDKVA-NFWCVTNV--------------------------IFK 340
              Q + R+FPF+RG+     A NFW + ++                          IF 
Sbjct: 278 ---QLLSRLFPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFP 334

Query: 341 YKMLFTQQELQ-------------LYSLVLTVVGFLPAMMIILFYPKKYLLPY------- 380
             +   +Q L+             +Y +VL  +      ++ L Y    +LP        
Sbjct: 335 ASLDIIRQRLKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFK 394

Query: 381 ----ALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWP 436
               +L+ C  A +LF + VHEK                DR +L+    +   G  +L+P
Sbjct: 395 RFLGSLTLCGFASFLFGWHVHEKAIMLVIIPFSFL-VVYDRRLLTSFKLVTTAGYVSLFP 453

Query: 437 LLKKDG 442
           LL K+ 
Sbjct: 454 LLYKND 459

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 100/415 (24%), Positives = 165/415 (39%), Gaps = 76/415 (18%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSS 146
           DF+  R+W+ IT  LP+ +WY      W LDYPP  AY  +   +       +   LD  
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 147 R-GYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G        F R+TV+VSE L ++   ++    + K         FI A++I+L P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPGF 163

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLLS 265
           +++DH HFQYN     + + AI       Y +    F  ++CFK + LY +P FF +LL 
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLLR 223

Query: 266 KSLFTPKLFNIP------------RFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSI 313
             +     F               R L + +  +  F + + P         ++ + Q +
Sbjct: 224 AYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF--------ISEMPQLL 275

Query: 314 HRIFPFARGIFEDKVA-NFWCVTNVIFKY------------------------------- 341
            R+FPF+RG+     A NFW + +++ K                                
Sbjct: 276 ERLFPFSRGLTHAYWAPNFWALYSLLDKVLTFVMLRLPYVHRFIIKFVAPPLIPATIDEI 335

Query: 342 KMLFTQQELQLYSLV------------------LTVVGFLPAMMIILFYPKKYLLPYALS 383
           K   +Q  +    LV                  LT+   + A++ +LF P       +L+
Sbjct: 336 KQRLSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFAGSLT 395

Query: 384 ACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 438
            C  + +LF + VHEK             T  DR +++    + + G  +L+PLL
Sbjct: 396 LCGFSSFLFGWHVHEKAIMLVIIPFSFLVT-LDRRLVTPFRLLVSAGYVSLFPLL 449

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 96/418 (22%), Positives = 163/418 (38%), Gaps = 82/418 (19%)

Query: 87  DFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALD-S 145
           D E  R+W+ +T  LP+  WY      W LDYPP  AY  ++  +       +   LD  
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 146 SRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPSL 205
             G        F+RLTV+ +E L ++   V+    +           FI A++I L P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIALSPGF 208

Query: 206 ILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLL- 264
           +++DH HFQYN     + + +I     E Y +    F   +CFK + LY +P +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 265 --------------SKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVL 310
                            +F  + FN+ +   I ++ +    + + P+           + 
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV-----------LP 317

Query: 311 QSIHRIFPFARGI--------------FEDKVANF---------WCVTNVIFKYKMLFTQ 347
           Q I R+FPF+RG+              F D++  F          C T ++    +  + 
Sbjct: 318 QLISRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNSI 377

Query: 348 QELQ---------------------------LYSLVLTVVGFLPAMMIILFYPKKYLLPY 380
           +E++                             +  LT+   + A++ +LF P       
Sbjct: 378 EEIKNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFIG 437

Query: 381 ALSACSMAFYLFSFQVHEKXXXXXXXXXXXXYTSTDRNVLSRVSWMNNIGLFTLWPLL 438
            L+ C  + +LF + VHEK              S DR +L+    +   G  +L+PLL
Sbjct: 438 CLTLCGFSSFLFGWHVHEKAIMLVIVPFSFL-VSMDRRLLTPFMLLTASGYVSLFPLL 494

>SAKL0E03784g Chr5 complement(308703..310283) [1581 bp, 526 aa] {ON}
           similar to uniprot|Q04458 Saccharomyces cerevisiae
           YMR110C Hypothetical ORF
          Length = 526

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 56/138 (40%), Gaps = 18/138 (13%)

Query: 43  LLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHWMEITQHLP 102
           +LY  R  G         V+   +I  A+   PF G G    +G++  +  +   T    
Sbjct: 404 ILYRIRSGG--------CVIGDTVIHVAIANAPFGGIG-SSGYGNYHGKWSFSAFTHERT 454

Query: 103 IHKW-YWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALDSSRGYEAQDLKTFMRLT 161
           + +  YW D     + Y P T+  + I     +  N  WF  + S+ +  +D   F  L 
Sbjct: 455 VMRQPYWVDF-LLSVRYAPFTSQKTKIAKL--AMENKPWFNRNGSKAWTIKDSLFFAVLG 511

Query: 162 VLVSEALFYIPGVVYFVK 179
           VLVS     + G VY+ +
Sbjct: 512 VLVS-----VAGKVYYER 524

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 44  LYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPMFGDFEAQRHW 94
           + P R  GS       +VLF L I   V +G F  YG    FGD  +++HW
Sbjct: 187 ISPVRIRGSM------VVLFQLNITVGVLVGNFVNYGCKKGFGDILSKKHW 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.145    0.481 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,326,133
Number of extensions: 2452664
Number of successful extensions: 6536
Number of sequences better than 10.0: 52
Number of HSP's gapped: 6552
Number of HSP's successfully gapped: 71
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)