Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021506.26ON36936914880.0
Suva_15.1746.26ON2952475459e-67
Kpol_1037.306.26ON3672275501e-66
Smik_15.1696.26ON2912515413e-66
Skud_15.1616.26ON2932465381e-65
YOL001W (PHO80)6.26ON2932455266e-64
TDEL0G044306.26ON3472425306e-64
TPHA0J003806.26ON3562335264e-63
ZYRO0C07634g6.26ON3822605251e-62
CAGL0E02541g6.26ON3422324975e-59
ACR001C6.26ON3461674871e-57
SAKL0E01408g6.26ON3072314832e-57
KLLA0D01287g6.26ON3452164836e-57
KNAG0I017506.26ON3241954816e-57
Kwal_56.224436.26ON2802484777e-57
KLTH0C11110g6.26ON2802494752e-56
TBLA0A071606.26ON2681824551e-53
NDAI0C026406.26ON4272234626e-53
Ecym_30296.26ON3511694472e-51
Skud_9.1197.240ON2851161841e-14
Suva_9.1497.240ON2861161813e-14
Smik_9.1407.240ON2851161778e-14
YIL050W (PCL7)7.240ON2851161761e-13
KNAG0D016307.240ON4381281754e-13
ADL075W7.240ON2071271675e-13
Ecym_43367.240ON3851271692e-12
KLTH0A04268g7.240ON5801101684e-12
Kwal_23.58077.240ON4651101649e-12
KAFR0I018407.240ON3251151621e-11
SAKL0F08602g7.240ON4741281631e-11
NCAS0E032207.240ON3411341612e-11
NCAS0A134807.240ON4481201603e-11
CAGL0M12342g7.240ON4571321578e-11
KAFR0L008807.240ON3131171531e-10
NDAI0A025607.240ON5031191542e-10
KLLA0C08305g7.240ON4091331513e-10
KNAG0L014707.240ON3541341496e-10
TPHA0C010907.240ON3851411452e-09
TDEL0H020207.240ON3631361372e-08
NDAI0E047707.240ON3031331237e-07
TBLA0D040707.240ON661731258e-07
ZYRO0C08118g7.240ON4051461248e-07
Kpol_1033.137.240ON250601147e-06
YER059W (PCL6)7.240ON420651167e-06
Smik_5.1897.240ON415601169e-06
Suva_5.1677.240ON424601169e-06
Skud_5.1737.240ON420601141e-05
TBLA0C048507.289ON368101900.012
CAGL0J10846g5.347ON229111810.10
TDEL0E028005.347ON19995790.19
NCAS0D040706.236ON473108790.30
SAKL0F09856g7.289ON33599750.86
NDAI0C019805.347ON22653721.5
TPHA0E011405.347ON21166692.9
Kpol_339.105.347ON19058683.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02150
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     577   0.0  
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   214   9e-67
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   216   1e-66
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   213   3e-66
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   211   1e-65
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   207   6e-64
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   208   6e-64
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   207   4e-63
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   206   1e-62
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   196   5e-59
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   192   1e-57
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   190   2e-57
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   190   6e-57
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   189   6e-57
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   188   7e-57
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   187   2e-56
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   179   1e-53
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   182   6e-53
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   176   2e-51
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    75   1e-14
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    74   3e-14
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    73   8e-14
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    72   1e-13
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    72   4e-13
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    69   5e-13
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    70   2e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    69   4e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    68   9e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    67   1e-11
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    67   1e-11
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    67   2e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    66   3e-11
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    65   8e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    64   1e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    64   2e-10
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    63   3e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    62   6e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    60   2e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    57   2e-08
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    52   7e-07
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    53   8e-07
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    52   8e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    49   7e-06
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    49   7e-06
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    49   9e-06
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    49   9e-06
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    49   1e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    39   0.012
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    36   0.10 
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    35   0.19 
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     35   0.30 
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    33   0.86 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    32   1.5  
TPHA0E01140 Chr5 complement(233837..234472) [636 bp, 211 aa] {ON...    31   2.9  
Kpol_339.10 s339 (17261..17833) [573 bp, 190 aa] {ON} (17261..17...    31   3.7  

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/369 (79%), Positives = 294/369 (79%)

Query: 1   MDIGNSLLTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXX 60
           MDIGNSLLTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSD            IQ    
Sbjct: 1   MDIGNSLLTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDM 60

Query: 61  XXXXXXXXXXXXXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY 120
                        HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY
Sbjct: 61  TSNTSNSSSDSNMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY 120

Query: 121 PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYR 180
           PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYR
Sbjct: 121 PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYR 180

Query: 181 IIPRSSNVTLIKLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
           IIPRSSNVTLIKLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG
Sbjct: 181 IIPRSSNVTLIKLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

Query: 241 ASSDLLFKRVIYTFPNNSALTQKLNNLPPQIRAQLXXXXXXXXXXXXXXXXALNHLLPXX 300
           ASSDLLFKRVIYTFPNNSALTQKLNNLPPQIRAQL                ALNHLLP  
Sbjct: 241 ASSDLLFKRVIYTFPNNSALTQKLNNLPPQIRAQLIKRTISKKRSRTSSSIALNHLLPSS 300

Query: 301 XXXXXXXXXXPVQSYLGGAANTGVSYNNXXXXXXXXXXXXXXXXXXSKGGSVEIHPRKKQ 360
                     PVQSYLGGAANTGVSYNN                  SKGGSVEIHPRKKQ
Sbjct: 301 SASSGISDQSPVQSYLGGAANTGVSYNNDDEEEKEDDEEAYYDEDDSKGGSVEIHPRKKQ 360

Query: 361 FSKIEEKNT 369
           FSKIEEKNT
Sbjct: 361 FSKIEEKNT 369

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  214 bits (545), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 149/247 (60%), Gaps = 5/247 (2%)

Query: 13  SKESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXX 72
           ++E + ++     I  I +P E+ KCSR+D            I                 
Sbjct: 5   AREHSEDTQEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQIT- 63

Query: 73  XHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHR 132
             LTR+HS+IPPNISIFNY  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHR
Sbjct: 64  --LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHR 121

Query: 133 FLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIK 192
           FLLTA TVA KGLCDSF T A Y+K+GGV+  ELNILE  FL+ VNYRI+PR  N+TL  
Sbjct: 122 FLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCS 181

Query: 193 LERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRV 250
           +E+  + F +D   +    L   SY     +GY+VL+ YYQ IV++ G+  +S    +RV
Sbjct: 182 IEQKQKTFVIDKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRV 241

Query: 251 IYTFPNN 257
            Y  P+N
Sbjct: 242 NYALPSN 248

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  216 bits (550), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 111/227 (48%), Positives = 142/227 (62%), Gaps = 10/227 (4%)

Query: 26  IQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQX-----XXXXXXXXXXXXXXXXHLTRFHS 80
           I+ I +P ++I CSRSD            I+                      +LTRFHS
Sbjct: 43  IETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRFHS 102

Query: 81  RIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITV 140
           R+PPNIS++NYL RLTKY  +EHCVLLS +YYIDL ++ YP F  NSLT HRFLLTA T+
Sbjct: 103 RVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTATTI 162

Query: 141 AGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVF 200
           A KGLCDSFCT + Y+K+GGV   ELNILET FLR VNYRIIPR  N+ L K+E     F
Sbjct: 163 ASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQNKF 222

Query: 201 TLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG---ASSD 244
           T+D  D+    ++  S     ++G+++L+IYY  IV++ G   ASSD
Sbjct: 223 TMDFSDLSMVGMTVQSNH--QNSGFNILDIYYHKIVQLVGSFSASSD 267

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  213 bits (541), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/251 (46%), Positives = 150/251 (59%), Gaps = 8/251 (3%)

Query: 26  IQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTRFHSRIPPN 85
           IQ + +P ++ KCSR+D            I                   LTR+HS+IPPN
Sbjct: 18  IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQIT---LTRYHSKIPPN 74

Query: 86  ISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGL 145
           ISIFNY  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHRFLLTA T+A KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKGL 134

Query: 146 CDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHL 205
           CDSF T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+ L  +E+  + F +D  
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDKN 194

Query: 206 DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNNSALTQK 263
            +    L   SY   P +GY+VL+ YY+ IV++ G+  +S    K++ Y  P+N     K
Sbjct: 195 ALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSN---IDK 251

Query: 264 LNNLPPQIRAQ 274
            N   PQI  Q
Sbjct: 252 DNESGPQINEQ 262

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  211 bits (538), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 146/246 (59%), Gaps = 8/246 (3%)

Query: 31  VPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTRFHSRIPPNISIFN 90
           +P E+ KCSR+D            I                   LTR+HS++PPNISIFN
Sbjct: 23  LPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQIT---LTRYHSKVPPNISIFN 79

Query: 91  YLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFC 150
           Y  RLTK+  +EHCVL++ +YYIDL   AYP FT NSLTAHRFLLTA TVA KGLCDSF 
Sbjct: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDSFS 139

Query: 151 TTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHLDMKDP 210
           T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+TL  +E+  + F  D       
Sbjct: 140 TNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPGSF 199

Query: 211 KLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNNSALTQKLNNLP 268
            L   SY   P +GY+VL+ YY+ IV++ G+  +S    K+V Y  P+N     K     
Sbjct: 200 DLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSN---IDKDTESG 256

Query: 269 PQIRAQ 274
           PQI+ Q
Sbjct: 257 PQIQQQ 262

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  207 bits (526), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 31  VPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTRFHSRIPPNISIFN 90
           +P ++ KCSR+D            I                   LTR+HS+IPPNISIFN
Sbjct: 23  LPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT---LTRYHSKIPPNISIFN 79

Query: 91  YLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFC 150
           Y  RLTK+  +EHCVL++ +YYIDL    YP FT NSLTAHRFLLTA TVA KGLCDSF 
Sbjct: 80  YFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFS 139

Query: 151 TTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDHLDMKDP 210
           T A YAK+GGV+  ELNILE  FL+ VNYRIIPR  N+TL  +E+  + F +D   +   
Sbjct: 140 TNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSL 199

Query: 211 KLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKRVIYTFPNNSALTQKLNNLP 268
            L   SY   P +GY+VL+ YY+ IV++ G+  +S    ++V Y  P N  +  +  +  
Sbjct: 200 DLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNIDIVSESGSQT 259

Query: 269 PQIRA 273
            Q++ 
Sbjct: 260 TQLKG 264

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  208 bits (530), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 147/242 (60%), Gaps = 9/242 (3%)

Query: 2   DIGNSLLTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXX 61
           D   ++  +D    S +    T +I  I +P ++ KCSR+D            IQ     
Sbjct: 6   DAEVTVAARDKPIPSESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSL 65

Query: 62  XXXXXXXXXXXXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYP 121
                        LTRFHSR+PP IS++NYL RLTKY  +EHCVLL+ +YYIDL ++ YP
Sbjct: 66  ALSKPENARG---LTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYP 122

Query: 122 TFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRI 181
            FT +SLT HRFLLTA TVA KGLCDSFCT   YAK+GGV + ELNILE  FL+ VNYRI
Sbjct: 123 VFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRI 182

Query: 182 IPRSSNVTLIKLERGNQVFTLDHLDMKDPKLSFLS--YDYLPDNGYSVLNIYYQNIVRIT 239
           +PR  N+   KLE   Q FTL     ++P++   S   + L ++GY+VL+ Y++ IV++ 
Sbjct: 183 LPRDDNIDWCKLETKLQKFTL----YEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLV 238

Query: 240 GA 241
           G+
Sbjct: 239 GS 240

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  207 bits (526), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 113/233 (48%), Positives = 140/233 (60%), Gaps = 24/233 (10%)

Query: 26  IQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXX-------------- 71
           I+ I +P  ++KCSRSD            IQ                             
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 72  XXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAH 131
             +LTRFHSR+PPNIS+ NYL RLTKY  +EH VLLS +YYIDL ++ YP F  NSLT H
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 132 RFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLI 191
           RFLL A TVA KGL DSFCT + YAK+GGV+  ELNILET FLR +NYRIIPR  N+ L 
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 192 KLERGNQVFTLDHLDMK----DPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
           KLE+ +  FTLD  D+      P+L+       P++GY+VLNIYY+ +V+I G
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTH------PNSGYNVLNIYYRKMVQIVG 258

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  206 bits (525), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 152/260 (58%), Gaps = 16/260 (6%)

Query: 19  ESPMTSKIQVIEV--------PYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXX 70
           + P T+ I++  V        P  + +CSR+D            IQ              
Sbjct: 27  QGPPTTGIRIDNVNDVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVT 86

Query: 71  XXXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTA 130
              +LT+FHS++PP IS++NYL RLTKY  ++HCVL++ +YYIDL ++ YPTFT NSLT 
Sbjct: 87  ---NLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTV 143

Query: 131 HRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTL 190
           HRFLLTA TVA KGLCDSFCT   YAK+GGV   ELN+LE   LR +NYRIIPR  N+  
Sbjct: 144 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAW 203

Query: 191 IKLERGNQVFTLDHLDMKD--PKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLL 246
             LE  ++ F LD  D  D  P LS LS +   ++GY+VL+ YY  IV++ G+  S+   
Sbjct: 204 CNLESQHRHFVLDTQDGDDWTPILSNLSGNR-NNSGYNVLDTYYNKIVQLVGSLKSTQDK 262

Query: 247 FKRVIYTFPNNSALTQKLNN 266
            K V YTF N    T   NN
Sbjct: 263 SKLVNYTFANTLKPTNIHNN 282

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  196 bits (497), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 109/232 (46%), Positives = 135/232 (58%), Gaps = 9/232 (3%)

Query: 25  KIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTRFHSRIPP 84
           +I  I++P +++KC + D            IQ                  LTRFHS+I P
Sbjct: 13  EIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYG----LTRFHSKIAP 68

Query: 85  NISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKG 144
           NIS+FNY  RLTKY  +EH VLLS +YYIDL +  YP F  NSLTAHRFLLTA T+A KG
Sbjct: 69  NISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKG 128

Query: 145 LCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDH 204
           LCDSFCT   Y+K+GGVQ  ELN+LE  FLR VNYRIIPR +N+T  K+E     F L  
Sbjct: 129 LCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPE 188

Query: 205 LDMKD--PKLSFLSYDYLPDNGYSVLNIYYQNIVRITG--ASSDLLFKRVIY 252
               D  P L    Y  + + GY+VL  YY  I+ + G  +SS    K+V Y
Sbjct: 189 SIESDLAPSLR-QGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  192 bits (487), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 93/167 (55%), Positives = 114/167 (68%), Gaps = 7/167 (4%)

Query: 75  LTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFL 134
           LTRFHSR+PP IS++NYL RLTKY  +EHCVLL+ +YYIDL T  YP F  +SLT HRFL
Sbjct: 57  LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFL 116

Query: 135 LTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLE 194
           LTA TVA KGLCDSFCT   YAK+GGVQ  ELN+LE  FL  VNYRI+PR  N+    LE
Sbjct: 117 LTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLE 176

Query: 195 RGNQVFTLDHLDM-KDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
           R  ++F+  ++ M KD  L         +NG+ VL  YY  ++ + G
Sbjct: 177 RQERIFSYSNIPMDKDCALQDR------NNGFGVLEKYYHRMIHLIG 217

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  190 bits (483), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 138/231 (59%), Gaps = 20/231 (8%)

Query: 14  KESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXX 73
           ++   ++P  +  Q++ +P E++KCSR+             IQ                 
Sbjct: 33  RQCLTQAPEQTSSQIM-LPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNL------ 85

Query: 74  HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRF 133
            LTRFHSR+PP IS++NYL RL KY  +E  VL++ +YYIDL ++ YP+FT NSLT HRF
Sbjct: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRF 145

Query: 134 LLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKL 193
           LLTA TVA KGL DSFCT   YAK+GGVQ  ELN+LET FL+ VNYRIIPR  N+   K 
Sbjct: 146 LLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKE 205

Query: 194 ERGNQVFTLDHLDMKDPKLSFLSYDYL--PDNGYSVLNIYYQNIVRITGAS 242
           E    VF           ++F   D +  P+NG++VL+ YY+ ++++ G S
Sbjct: 206 EYQQGVF-----------ITFPLADKIKGPNNGFNVLDTYYKKMIQLVGPS 245

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  190 bits (483), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 130/216 (60%), Gaps = 17/216 (7%)

Query: 27  QVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTRFHSRIPPNI 86
           Q+I +P EY++CSR+             IQ                  LTRFHS+  P+I
Sbjct: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTM-----ELTRFHSKAAPSI 71

Query: 87  SIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLC 146
           +++ YL RLTKY  +EH VLLS +YYIDL +A YP FT NSLT HRFLLTA T+A KGLC
Sbjct: 72  TVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLC 131

Query: 147 DSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLER--GNQVFTLDH 204
           DSFCT   Y+K+GGVQ  ELNILE  FL  V YRIIPR  N+   K+E+  G+ +     
Sbjct: 132 DSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNML---- 187

Query: 205 LDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
           + MK+      +    PDNG++VL  YY+ IV++ G
Sbjct: 188 IPMKN------ASQRGPDNGFNVLQNYYRKIVQLVG 217

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  189 bits (481), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 99/195 (50%), Positives = 127/195 (65%), Gaps = 8/195 (4%)

Query: 75  LTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFL 134
           LTRFHS +PP IS++NYL RLTKY  +E  VLL+ IYYIDL ++ YP FT NSLT HRFL
Sbjct: 85  LTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFL 144

Query: 135 LTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLE 194
           LTA TVA KGLCDSFCT A YAK+GGVQ  ELNILE+ FL+ +NYR++PR  N+T  K E
Sbjct: 145 LTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKYE 204

Query: 195 RGNQVFTLDHLDMKDPKLSFLSY--DYLPDNGYSVLNIYYQNIVRITGASSDLL--FKRV 250
                FT+         L+ +S       ++GY+VL +YY  I+++ G  S  L   K+ 
Sbjct: 205 HRAHEFTI----YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKA 260

Query: 251 IYTFPNNSALTQKLN 265
            Y F N   ++  L+
Sbjct: 261 NYVFENVPGMSSALS 275

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  188 bits (477), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 144/248 (58%), Gaps = 17/248 (6%)

Query: 12  GSKESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXX 71
           GS +S  E    + +  + +P ++ +CSR+D             +               
Sbjct: 15  GSPKSPGERLEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDDAK---- 70

Query: 72  XXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAH 131
              LTRFHSR+PP IS+++Y+ RLT+Y  +E  VL++ +YYIDL +A YP+F+ NSLT H
Sbjct: 71  --ELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVH 128

Query: 132 RFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLI 191
           RFLLTA TVA KGLCDSFCT + YAK+GGVQ  EL++LE+ FL+ VNYRI+PR  N++  
Sbjct: 129 RFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNC 188

Query: 192 KLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDLLFKR 249
           K E+   +F            ++      P+NG++VL+ YY+ I+ I G+  SS    KR
Sbjct: 189 KAEKKAGLFVTP---------TYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKR 239

Query: 250 VIYTFPNN 257
             Y   N+
Sbjct: 240 AHYVMINS 247

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  187 bits (475), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 142/249 (57%), Gaps = 22/249 (8%)

Query: 8   LTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXX 67
           LT+D +K  T E P    +  + +P ++ +C R+D            I+           
Sbjct: 16  LTED-TKPDTGEDP----VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSS 70

Query: 68  XXXXXXHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNS 127
                  LTRFHSR+PP IS+++YL RLT+Y  +E  VL++ +YYIDL +A Y  F+ NS
Sbjct: 71  ------ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNS 124

Query: 128 LTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSN 187
           LT HRFLLTA TV  KGLCDSFCT + YAK+GGVQ  EL++LE+ FL+ VNYRI+PR  N
Sbjct: 125 LTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDN 184

Query: 188 VTLIKLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA--SSDL 245
           +   K ER   +F            ++   +  P+NG++VL+ YYQ I+ I G+  SS  
Sbjct: 185 ILNCKAERREGLFVT---------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPD 235

Query: 246 LFKRVIYTF 254
             KR  Y  
Sbjct: 236 KTKRAHYVM 244

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  179 bits (455), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 122/182 (67%), Gaps = 9/182 (4%)

Query: 75  LTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFL 134
           LTRFHS++PPNISIF+YL RLTKY  +E  VL++ +YYIDL +  YP F+ NSLT HR+L
Sbjct: 60  LTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYL 119

Query: 135 LTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLE 194
           LTA T+A KGLCDSFCT + YAK+GG++  ELN+LET FL  V YR+IPR + + L KLE
Sbjct: 120 LTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLE 179

Query: 195 RGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG--ASSDLLFKRVIY 252
                    + D+  P       D L ++GY+VL+ YY  +V++ G   SS   F+ V Y
Sbjct: 180 YKYSPIEDINNDIHIP-------DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNY 232

Query: 253 TF 254
            F
Sbjct: 233 IF 234

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  182 bits (462), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 134/223 (60%), Gaps = 7/223 (3%)

Query: 18  AESPMTSKIQVIEVPYEYIKCSRSDXXXXXXXXXXXXIQXXXXXXXXXXXXXXXXXHLTR 77
           AE+P   KI +   P ++++C R D            I+                 + TR
Sbjct: 49  AENPKHVKITL---PIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN---YATR 102

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTA 137
           FHSR+ P ISI NYL RLTK+C ++  VLL+ +YYIDL +A +P+F+FNSLTAHRF+LTA
Sbjct: 103 FHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTA 162

Query: 138 ITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGN 197
           + VA K LCDS  +   YAK GGVQ  EL +LE YFL+++ YR++PR  N  L  +E   
Sbjct: 163 VIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHF 222

Query: 198 QVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
             F L+   +K+   SF SY  LP +GY+VL++YY+ I+ I G
Sbjct: 223 DTFALNDGQIKESGTSF-SYRQLPHSGYNVLHMYYRRIIDIIG 264

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  176 bits (447), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 111/169 (65%), Gaps = 9/169 (5%)

Query: 74  HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRF 133
            LTRFHSR+PP+IS+++YL RLTKY  +EHCVLL+ +YYIDL ++ +P F  +SLT HRF
Sbjct: 62  QLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRF 121

Query: 134 LLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKL 193
           LLTA TVA KGLCDSFCT   YAK+GGVQ  ELN+LE  FL  VNYRI+PR  N+     
Sbjct: 122 LLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSR 181

Query: 194 ERGNQVFTLDHL--DMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240
           E     F+  ++  D +  + S        +N + VL  YY  ++ + G
Sbjct: 182 EHQEGTFSFANIPADAEQDQKS-------EENRFDVLENYYHRMIHLIG 223

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%), Gaps = 11/116 (9%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFT-----------FN 126
           F+ +  P IS+  YL R+ KYC   + + LS++ Y D  +  Y  F+            +
Sbjct: 150 FYGKSVPEISVVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMD 209

Query: 127 SLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           S   HR L+T IT+  K L D F + ++YAK+GG+  +ELN LE  FL + +++++
Sbjct: 210 SGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 64/116 (55%), Gaps = 11/116 (9%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPT-----------FTFN 126
           F+ +  P I++  YL R+ KYC   + + LS++ Y D  +  Y +           F  +
Sbjct: 151 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMD 210

Query: 127 SLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           S   HR L+T IT+  K + D F + ++YAK+GG+  +ELN LE  FL + +++++
Sbjct: 211 SGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 11/116 (9%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY-----------PTFTFN 126
           F+ +  P I +  YL R+ KYC   + + LS++ Y D  +  Y             F  +
Sbjct: 150 FYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQLFVMD 209

Query: 127 SLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           S   HR L+T IT+  K L D F + ++YAK+GG+  +ELN LE  FL + +++++
Sbjct: 210 SGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 11/116 (9%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY-----------PTFTFN 126
           F+ +  P I++  YL R+ KYC   + + LS++ Y D  +  Y             F  +
Sbjct: 150 FYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMD 209

Query: 127 SLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           S   HR L+T +T+  K L D F + ++YAK+GG+  +ELN LE  FL + +++++
Sbjct: 210 SGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 66/128 (51%), Gaps = 20/128 (15%)

Query: 75  LTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT----------------- 117
           +T F+ +  P I+I  YL R+ KYC   + + LS++ + D  +                 
Sbjct: 283 ITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDS 342

Query: 118 ---AAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFL 174
              A + TF  +S   HR L+  +TV+ K   D F + A+YA++GG+  +E+N LE  FL
Sbjct: 343 DEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFL 402

Query: 175 RIVNYRII 182
            + +++++
Sbjct: 403 ILCDFKLL 410

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 10/127 (7%)

Query: 74  HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT----AAYPT-FTFNSL 128
           H+  F  +  P I++ +Y  R+ KYC + + V LS++ Y D       A  P  F  +S 
Sbjct: 61  HVLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSY 120

Query: 129 TAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNV 188
             HR ++ A+TV+ K   D F + ++YA++GG+  EELN LE  F  + ++ +I     V
Sbjct: 121 NIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELI-----V 175

Query: 189 TLIKLER 195
           ++ +L+R
Sbjct: 176 SIQELQR 182

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 69/127 (54%), Gaps = 10/127 (7%)

Query: 74  HLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT----AAYPT-FTFNSL 128
           H+  F  +  P I++ +Y  R+ KYC + + V LS++ Y D       A  P  F  +S 
Sbjct: 230 HVLSFRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSY 289

Query: 129 TAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNV 188
             HR ++ A+TV+ K   D F + ++YA++GG+   ELN LE  F  + ++ +I     V
Sbjct: 290 NIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQFSILCDFELI-----V 344

Query: 189 TLIKLER 195
           ++ +L+R
Sbjct: 345 SVQELQR 351

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT-----AAYPTFTFNSLTAHR 132
           F  +  P I++  Y  R+ KYC   + V LS++ Y D        A    F  +S   HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 133 FLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
            +++A+TV+ K   D F + ++YA++GG+  +ELN LE  FL + ++ +I
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT-----AAYPTFTFNSLTAHR 132
           F  +  P I++  Y  R+ KYC   + V LS++ Y D             F  +S   HR
Sbjct: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383

Query: 133 FLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
            +++A+TV+ K   D F + ++YA++GG+  +ELN LE  FL + ++ +I
Sbjct: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPT----------FTFNS 127
           FH +  P+I+I  Y  R+ KYC   + V L ++   D       T          F  +S
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 128 LTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
              HRF++  +TV  K L D F + ++YAK+GG+   E+N LE  FL + ++++I
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 65/128 (50%), Gaps = 15/128 (11%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTA----------AYPTFTFNS 127
           F  +  P IS+  Y  R+ KYC   + V LS++ Y D                  F  +S
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 128 LTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSN 187
              HR ++ A+TV+ K   D F + ++YA++GG+  +ELN LE  FL + ++ +I     
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI----- 451

Query: 188 VTLIKLER 195
           +++ +L+R
Sbjct: 452 ISIEELQR 459

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 62/134 (46%), Gaps = 28/134 (20%)

Query: 82  IPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY--------------------- 120
           IPP I +  Y  R+ KYC   + VLL+I+ Y D  +                        
Sbjct: 189 IPP-IKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 121 ------PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFL 174
                   F  +S   HR +++AITV+ K   D F + ++YAK+GG+  +E+N LE  FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

Query: 175 RIVNYRIIPRSSNV 188
            I N+ +I  S  +
Sbjct: 308 LISNFDLIISSEEI 321

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT----------AAYPT----- 122
           F  +  P IS+  Y  R+ KYC   + V LS++ Y D  +             PT     
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  +TV  K   D F + ++YA++GGV  +ELN LE  FL + ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 19/132 (14%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTA--------------AYPTF 123
           F  +  P I+++ Y  R+ KYC   + V LS++ Y D  +               A   F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 124 TFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIP 183
             +S   HR ++  +TV  K   D F + ++YA++GG+   ELN LE  FL + ++ ++ 
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL- 423

Query: 184 RSSNVTLIKLER 195
               +++ KL+R
Sbjct: 424 ----ISVDKLQR 431

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 12/117 (10%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYID-LFTAAYPTF-----------TF 125
           F  +  P I++  Y  R+ KYC   + V LS++ Y D +F      F             
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 126 NSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           +S   HR ++  +TV+ K L D F + ++YAK+GG+  +ELN LE  FL + ++ ++
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL 291

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 14/119 (11%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTA---AYPT-----------F 123
           F  +  P I++  Y  R+ KYC   + V LS++ Y D  +    + PT           F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 124 TFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
             +S   HR ++  ITV  K   D F + ++YA++GG+  +ELN LE  FL + ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 28/133 (21%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYID----------------------- 114
           F  +  P I++  Y  R+ KYC   + VLLS++ + D                       
Sbjct: 240 FRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDK 299

Query: 115 ----LFTAAYPT-FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNIL 169
               L   + P  F  +S   HR ++ AITV+ K + D F + ++YA++GG+  +ELN L
Sbjct: 300 TTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHL 359

Query: 170 ETYFLRIVNYRII 182
           E  FL + ++R+I
Sbjct: 360 ELQFLILCDFRLI 372

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 21/134 (15%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPT--------------- 122
           F  +  P I++  Y  R+ KYC   + V LS++ Y D  +    +               
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 123 -FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRI 181
            F  NS   HR ++  + V+ K   D F + A+YAK+GG+   E+N LE  FL + ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 182 IPRSSNVTLIKLER 195
           +     +++ ++ER
Sbjct: 331 L-----ISVEEMER 339

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 62/141 (43%), Gaps = 36/141 (25%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY----------------- 120
           F  +  P IS+  Y  R+ KYC + + V LS++ Y D  +                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 121 -------------------PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGV 161
                                F  +S   HR ++TA+TV+ K   D F + ++YA++GG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 162 QNEELNILETYFLRIVNYRII 182
             +ELN LE  FL + +++++
Sbjct: 328 SLQELNHLELQFLILCDFQLM 348

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 59/136 (43%), Gaps = 31/136 (22%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTA------------------- 118
           F  +  P IS+ +Y  R+ KYC   + V LS++ Y D  +                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 119 ------------AYPTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEEL 166
                           F  +S   HR L+  +TV+ K   D F + ++YA++GG+  +EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 167 NILETYFLRIVNYRII 182
           N LE  FL + ++ ++
Sbjct: 316 NHLELQFLVLCDFELL 331

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 29/133 (21%)

Query: 86  ISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTA--------AYPTFTF------------ 125
           I +  YL  L ++C +    LL+++ Y+D              P + F            
Sbjct: 164 IELEEYLNTLQRHCPMNTIDLLALLIYLDRIIQNLYKYPLDKKPIYQFMASRFQHKQTCL 223

Query: 126 ----NSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRI 181
               NS T HR +L  ITV+ K L D   +  +YA+  G+  EELN LE  FLR+ N+ +
Sbjct: 224 SRIVNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

Query: 182 IPRSSNVTLIKLE 194
                +V+L +LE
Sbjct: 284 -----SVSLNELE 291

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 45/73 (61%), Gaps = 5/73 (6%)

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  +TVA K   D F + A+YAK+GG+  +ELN LE  FL + +++++
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

Query: 183 PRSSNVTLIKLER 195
                +++ +L+R
Sbjct: 638 -----ISVNELQR 645

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSL 128
           F  +  P I++F Y  R+ KYC + + V LS++ Y D  +    T + N +
Sbjct: 444 FRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRISKRCNTISSNDV 494

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 59/146 (40%), Gaps = 41/146 (28%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT-------------------- 117
           F  +  P IS+ +Y  R+ KYC   + V LS++ Y D  +                    
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 118 ---------------------AAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYA 156
                                A    F  +S   HR ++   TV+ K   D F + ++YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 157 KIGGVQNEELNILETYFLRIVNYRII 182
           ++GG+  +ELN LE  FL + ++ ++
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 37/60 (61%)

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  +TV+ K   D F + ++YA++GG+  +ELN LE  FL + ++ ++
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 78  FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYID 114
           F  +  P IS+  Y  R+ KYC + + V +S++ Y D
Sbjct: 42  FRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFD 78

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 119 AYPT-FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIV 177
           A+P  F  +S   HR ++  ITV+ K L D F + ++Y+++GG+  +ELN LE  FL + 
Sbjct: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384

Query: 178 NYRII 182
           ++ ++
Sbjct: 385 DFELL 389

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  ITV+ K L D F + ++Y+++GG+  +ELN LE  FL + ++ ++
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  ITV+ K L D F + ++Y+++GG+  +ELN LE  FL + ++ ++
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 38/60 (63%)

Query: 123 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           F  +S   HR ++  ITV+ K L D F + ++Y+++GG+  +ELN LE  FL + ++ ++
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 10/101 (9%)

Query: 80  SRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFN-SLTAHRFLLTAI 138
           S IPP   ++ ++  L  +  V+   L++ + Y+    A  P+  +    T HR  L  +
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIETTRHRMFLGCL 104

Query: 139 TVAGKGLCDSFCTTAQYAKI--GGVQNEELNILE----TYF 173
            +A K L DS      +AK   G +Q  E+N +E    TYF
Sbjct: 105 IIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREILTYF 145

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 10/111 (9%)

Query: 76  TRFHSRIP-PNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAY------PTFTFNSL 128
           ++ H RI     SI N+L  +TK  ++   +LL    Y D    ++      P F +   
Sbjct: 60  SKSHKRINNSKTSIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEFAY--- 116

Query: 129 TAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNY 179
              R LL  I +A K   D   +   + ++ G+    + I+E + L+ +NY
Sbjct: 117 CGKRLLLVCIILAHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNY 167

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query: 110 IYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNIL 169
           IY   L+    P F   +  + R  L+ + +A K L D+  T   +  I G+   +L ++
Sbjct: 93  IYDGQLWNGKLPDF---ARCSKRIFLSCLILAHKYLNDNSFTMKTWNMISGLSQNDLCLM 149

Query: 170 ETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDH 204
           E + L  ++YR++    ++T ++     +  T D 
Sbjct: 150 ERWGLEKLDYRLLVAEEDLTKLEDSLATKKRTFDE 184

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 75  LTRFHSRIPPNISIFNYLFRLTKYC-YVEHCVLLS--IIYYIDLFTAAYPT-----FTFN 126
            + F  + PP++S  +++ R+   C Y  H  L++  ++  + L    +       F F 
Sbjct: 337 FSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFE 396

Query: 127 SLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFL 174
               HR ++  + +A K L D   +   + K+ G+  + L+ LE   L
Sbjct: 397 KSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 86  ISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFN-SLTAHRFLLTAITVAGKG 144
           +S+ +++  L  +  V+   L+S + Y+    +  P   +    T HR  L  + +A K 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 145 LCDSFCTTAQYAKI--GGVQNEELNILETYFLRIVNYRI 181
           L DS      +++   G +   E+N +E   L   ++++
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 130 AHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 182
           + R  L+ + ++ K L D   +   ++ I G+   +L+ILE + L  +NY ++
Sbjct: 134 SKRIFLSCLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>TPHA0E01140 Chr5 complement(233837..234472) [636 bp, 211 aa] {ON}
           Anc_5.347 YHR071W
          Length = 211

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 121 PTFTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYR 180
           P FTF      R  +  + +A K L D     + ++ I     ++L I+ETY L+ ++Y 
Sbjct: 120 PLFTF---CIKRMFIMCLVLANKFLVDENYVLSTWSLITASSLKDLKIMETYVLKTLDYN 176

Query: 181 IIPRSS 186
           +   +S
Sbjct: 177 LFYSAS 182

>Kpol_339.10 s339 (17261..17833) [573 bp, 190 aa] {ON}
           (17261..17833) [573 nt, 191 aa]
          Length = 190

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 30/58 (51%)

Query: 132 RFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVT 189
           R    ++ +A K + DS  + A ++ + G+    L I+E + LR ++Y +    +N T
Sbjct: 124 RIFFVSLIIAQKFIEDSKLSMASWSLVSGISQRSLCIMEKWCLRKLDYSLNVEINNTT 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,910,555
Number of extensions: 1125632
Number of successful extensions: 2638
Number of sequences better than 10.0: 57
Number of HSP's gapped: 2656
Number of HSP's successfully gapped: 62
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)