Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021406.28ON37637620050.0
NDAI0C026506.28ON38938713610.0
Kpol_1037.236.28ON37838012881e-178
TDEL0G044106.28ON38137912281e-168
ZYRO0C07546g6.28ON37737912151e-167
Suva_15.1726.28ON39837911661e-159
TPHA0J003906.28ON38038011621e-158
Skud_15.1596.28ON37937911551e-157
Ecym_30326.28ON37737811381e-155
Smik_15.1676.28ON37837911171e-152
CAGL0E02497g6.28ON37637811121e-151
YOL003C (PFA4)6.28ON37837911091e-150
SAKL0E01518g6.28ON37938110921e-148
ACL003C6.28ON37537710781e-146
KLLA0C06204g6.28ON37738310291e-138
KLTH0C10978g6.28ON37738010231e-137
KNAG0F029306.28ON38638410161e-136
Kwal_56.224596.28ON3833809941e-133
KAFR0A051306.28ON3963999711e-129
TBLA0B004806.28ON3774025207e-62
NDAI0G013403.12ON3351452292e-20
NCAS0E013003.12ON3271482274e-20
KAFR0A085903.12ON3311282265e-20
KNAG0K025703.12ON3281312184e-19
TPHA0P015603.12ON3312452185e-19
Kpol_1014.293.12ON3261422151e-18
CAGL0D02508g3.12ON3321412124e-18
TBLA0H001503.12ON3452602062e-17
SAKL0C13596g3.12ON333822053e-17
KLLA0E02069g3.12ON325732035e-17
Suva_14.153.12ON3302302001e-16
TDEL0A003103.12ON329721992e-16
Smik_14.63.12ON3342301973e-16
Kwal_55.221263.12ON3601331965e-16
Skud_14.153.12ON3361441931e-15
ZYRO0C04092g8.389ON3661081932e-15
KLTH0F19580g3.12ON3421331922e-15
YNL326C (PFA3)3.12ON3361391903e-15
SAKL0H13860g8.389ON352771878e-15
TDEL0F051308.389ON359741861e-14
KAFR0B053708.286ON3291071832e-14
NCAS0C029208.389ON374771833e-14
Skud_12.3218.389ON356601807e-14
Ecym_20143.12ON339511798e-14
ZYRO0C03410g3.12ON327531781e-13
Smik_12.3068.389ON359601791e-13
TPHA0C023608.389ON404721791e-13
Ecym_41788.389ON368821781e-13
ZYRO0D06600g8.286ON330481743e-13
YLR246W (ERF2)8.389ON359601735e-13
NCAS0B035908.286ON329971701e-12
TBLA0D040408.286ON329671701e-12
KLTH0F08668g8.389ON358601701e-12
Suva_10.3428.389ON356601701e-12
KAFR0H019808.389ON361601692e-12
SAKL0H16434g8.286ON555661712e-12
ADL197C3.12ON390631692e-12
AGL125C8.389ON367601682e-12
Skud_4.3878.286ON336621663e-12
TPHA0C010708.286ON333671654e-12
KNAG0A027108.389ON354601664e-12
CAGL0B01991g8.286ON330501654e-12
NDAI0G022508.389ON389771655e-12
TDEL0F041308.286ON3281241647e-12
CAGL0G08217g8.389ON326601647e-12
NDAI0J010008.286ON339631621e-11
TBLA0H009208.389ON360601612e-11
Kwal_23.33028.389ON353491602e-11
KLLA0D18370g8.389ON355601584e-11
Smik_4.3728.286ON335641584e-11
YDR126W (SWF1)8.286ON336481584e-11
Suva_2.2898.286ON335621575e-11
Ecym_42828.286ON3401081575e-11
KLTH0G13112g8.286ON349701558e-11
Kpol_1033.168.286ON321481487e-10
KLLA0F19690g8.286ON324481433e-09
AGR065W8.286ON326441398e-09
Kwal_56.236978.286ON338631381e-08
KNAG0H031108.286ON331881344e-08
KAFR0I011105.579ON370731336e-08
NCAS0F013905.579ON3742571264e-07
KLTH0G04972g5.579ON367861247e-07
Kwal_47.183665.579ON356901239e-07
Kpol_1004.575.579ON3621601212e-06
TBLA0E028305.579ON3861391177e-06
Ecym_41145.579ON372701168e-06
CAGL0K06347g5.579ON3521071159e-06
NDAI0H018905.579ON406501151e-05
TDEL0A044405.579ON365711132e-05
Skud_4.7345.579ON380681132e-05
SAKL0G06160g5.579ON364501122e-05
KNAG0C028305.579ON354741122e-05
YDR459C (PFA5)5.579ON374621114e-05
TBLA0J008305.626ON7391131106e-05
ZYRO0D13860g5.579ON3651291096e-05
Smik_4.7375.579ON378621079e-05
NDAI0H008505.626ON7861111081e-04
TDEL0A049205.626ON750611062e-04
KLLA0D06149g5.579ON349791052e-04
TPHA0C003705.626ON759701052e-04
Kpol_526.325.626ON7772051043e-04
Suva_2.6345.579ON388651033e-04
AER388C5.626ON724541043e-04
KNAG0B031405.626ON6821301034e-04
ZYRO0C11132g5.626ON7591601026e-04
KAFR0H005705.626ON757701000.001
Smik_4.5155.626ON76449990.001
KLTH0E02420g5.626ON73498990.001
NCAS0C052805.626ON757133990.001
YDR264C (AKR1)5.626ON76455990.001
Suva_2.4325.626ON76355980.002
CAGL0M08712g5.626ON763151980.002
Skud_4.5275.626ON76455970.002
Suva_8.875.626ON730162950.004
KNAG0C062305.626ON752140940.005
Ecym_13305.626ON73960940.005
ABR203W5.579ON35964920.008
SAKL0G07326g5.626ON73755920.008
YOR034C (AKR2)5.626ON74982890.021
Smik_15.2135.626ON74458820.14
NCAS0A017304.97ON784100800.28
KLLA0E16721g5.626ON75260800.28
Skud_15.1995.626ON74162770.50
TBLA0B016203.175ON126054741.4
Kwal_26.85618.617ON71772731.9
KAFR0F031704.97ON59261703.7
ACL040C7.281ON34230677.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02140
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   776   0.0  
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     528   0.0  
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   500   e-178
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   477   e-168
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   472   e-167
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   453   e-159
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   452   e-158
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   449   e-157
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   442   e-155
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   434   e-152
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   432   e-151
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   431   e-150
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   425   e-148
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   419   e-146
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   400   e-138
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   398   e-137
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   395   e-136
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   387   e-133
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   378   e-129
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   204   7e-62
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      93   2e-20
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    92   4e-20
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    92   5e-20
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    89   4e-19
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    89   5e-19
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    87   1e-18
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    86   4e-18
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    84   2e-17
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    84   3e-17
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    83   5e-17
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    82   1e-16
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    81   2e-16
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    80   3e-16
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    80   5e-16
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    79   1e-15
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    79   2e-15
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    79   2e-15
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    78   3e-15
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    77   8e-15
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    76   1e-14
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    75   2e-14
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     75   3e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    74   7e-14
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    74   8e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    73   1e-13
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    74   1e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    74   1e-13
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    73   1e-13
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    72   3e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    71   5e-13
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      70   1e-12
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    70   1e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    70   1e-12
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    70   1e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    70   2e-12
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    70   2e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    70   2e-12
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    69   2e-12
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    69   3e-12
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    68   4e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   4e-12
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    68   4e-12
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     68   5e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    68   7e-12
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    68   7e-12
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    67   1e-11
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    67   2e-11
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    66   2e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    65   4e-11
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    65   4e-11
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    65   4e-11
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    65   5e-11
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    65   5e-11
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    64   8e-11
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    62   7e-10
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    60   3e-09
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    58   8e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    58   1e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    56   4e-08
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    56   6e-08
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    53   4e-07
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    52   7e-07
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    52   9e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    51   2e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    50   7e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    49   8e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    49   9e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    49   1e-05
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    48   2e-05
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    48   2e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    48   2e-05
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    48   2e-05
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    47   4e-05
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    47   6e-05
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    47   6e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    46   9e-05
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    46   1e-04
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    45   2e-04
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    45   2e-04
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    45   2e-04
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    45   3e-04
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    44   3e-04
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    45   3e-04
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    44   4e-04
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    44   6e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    43   0.001
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    43   0.001
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    43   0.001
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    43   0.001
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    43   0.001
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    42   0.002
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    42   0.002
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    42   0.002
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    41   0.004
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    41   0.005
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    41   0.005
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    40   0.008
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    40   0.008
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    39   0.021
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    36   0.14 
NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97      35   0.28 
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    35   0.28 
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    34   0.50 
TBLA0B01620 Chr2 complement(356040..359822) [3783 bp, 1260 aa] {...    33   1.4  
Kwal_26.8561 s26 complement(839924..842077) [2154 bp, 717 aa] {O...    33   1.9  
KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {O...    32   3.7  
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    30   7.1  

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/376 (100%), Positives = 376/376 (100%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTWNN 360
           YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTWNN
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTWNN 360

Query: 361 DWGENLEDFGVDVDVE 376
           DWGENLEDFGVDVDVE
Sbjct: 361 DWGENLEDFGVDVDVE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/387 (61%), Positives = 304/387 (78%), Gaps = 11/387 (2%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M +KLKYPW+GV IP  + SFIGY++H F+L+NF+S K Q+WFQ SL+M+W+SY LAIFT
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGRPAKSFKPL----KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116
           NPG+P K+ KP+    +++W   CKKC  +KPER+HHCKTCNQCVLMMDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 FKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGF 176
           +KNFPHF+RFL W+++TTGFLL  LLKRT+ +W ++ LPSY+F++ EI FL ILIPMD F
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 VLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPE 236
           +L+T++LLFIRC +NQI+ G TQIE WELERLENL+Y KKLLP ++  LWE+YPNE+T  
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 237 NKVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKN 296
               A  L  R +KVRFENIV FPYD+DIW+N  TV+GS   W+W+FG PD +G+ F+KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 297 ELALYEEGAAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFE------- 349
           E++LYE G+++EDLLLSLPWPPD GRNFI  K T+VES+  +GEQV+R R          
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTSVESLVYDGEQVVRNRASNDTNISTI 360

Query: 350 NDNSYRKTWNNDWGENLEDFGVDVDVE 376
           N +  R+ WNNDWGE+L DFGVD++ E
Sbjct: 361 NKDISREEWNNDWGESLVDFGVDIEAE 387

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  500 bits (1288), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 230/380 (60%), Positives = 296/380 (77%), Gaps = 6/380 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLKYPWMG+ IPC L SFI Y+AH F+L NF+S   Q+WF+ S+TM+WISY LAI+T
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG+P  ++ P   +W ++CKKC  +KPER HHCKTC QCVLMMDHHCPWTMNCVG+KNF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFLFWV+VTT +LLY L+ R ++LW  ++LPSYLF K+EI FL I  PMDGFVL+T
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           ++LLFIRC  NQ++ G+TQIE+WE ERLE+L+Y ++L PQL+ NLWE +P  KTP+N+  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A+K+    +++RF+ +V+FPYDL + +N  TVLGSPV WLW +G P  DGM FKKNE +L
Sbjct: 241 AEKIV--SKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSL 298

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNF--IQQKGTN-VESITENGEQVIRQRN-FENDNSYRK 356
           +EE + +ED +LSLPWPPDGG++   I+   TN +E+ T++GE VIR+R+        R 
Sbjct: 299 FEEDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRT 358

Query: 357 TWNNDWGENLEDFGVDVDVE 376
            W NDWGENLEDFGVD+DVE
Sbjct: 359 QWYNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  477 bits (1228), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 222/379 (58%), Positives = 283/379 (74%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLK+PW+G+ IPC+L SFIGY  H F+L+NF+S   QLWFQ +L ++W+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRP  +F+  K EW ++CKKCQ +KPERAHHCKTCNQCVLMMDHHCPWTMNCVG  NF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFL WV+V T FLLYQL+ R I LW  ++LP Y+F ++E+ FL IL P+D FVL+T
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + +L  RCL+NQI  G +QIE+WELERL+ L+  K+L+P L+   W+I+P  +   N+  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A +L    +++R E++V FPYDLD WSNA  +LG+P+ WLW FG P  DGM F KNE++ 
Sbjct: 241 AAELS-MNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISE 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQK--GTNVESITENGEQVIRQR-NFENDNSYRKT 357
           Y   A+ EDLLLSLPWPPDGGR         +++ESIT+ GEQ+IR+R N  +D   R+ 
Sbjct: 300 YSSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W NDWGENLEDFGVDVD E
Sbjct: 360 WQNDWGENLEDFGVDVDTE 378

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  472 bits (1215), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 222/379 (58%), Positives = 287/379 (75%), Gaps = 5/379 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPV+LK+P++G+ IPC L SFIGY+AH F+L+NF+S + Q+WF+ SLTM+W SY LAI+T
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
            PG+P  +F+P K  W  +CKKC+ +KPERAHHCKTCNQCVL MDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFLFWV+ TTG+LLY+L  R  ++    + P+YL+ K+E+ FL ILIPMDGF+L+T
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           +++LFIRCLSNQI  G+TQIE+WE ERLE LYY K+LLP LL N WE+YP  +T E +  
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A +L  R R++  +++V FPYD+D WSN +  LGSP+ WLW FG P  DGM F KN+++ 
Sbjct: 241 ASRLSTR-RRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISE 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGRN-FIQQKGTN-VESITENGEQVIRQRNFE-NDNSYRKT 357
           +EE   + D+LL+LPWPPDGG++  I   G N VE+   +GEQVIR+R  +  D S R  
Sbjct: 300 FEE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W N WGENLEDFGVDVD E
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  453 bits (1166), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 286/379 (75%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+S   Q+ F+SSL+M+W+SY LAI+T
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG+P+ +++P    W ++CKKCQ +KPER+HHCK CNQCVLMMDHHCPWTMNCVGFKN+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRF+FWV+ TTGFL    LKR  ++W  + LP YLF+K+E+ FL IL P++ FVL+T
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + +LF+RCL NQII G++QIESW+++RLE+L+  ++L+ +L+ N W IYP  ++P+ +  
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A+KL  +  K+RFE +V FPY++D+++NA   LG    WLW  G P  DG  F+KN+++ 
Sbjct: 261 AEKLLTQ-HKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISK 319

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN--VESITENGEQVIRQRNFENDNSY-RKT 357
           YE  +++ED++LSLPWPPDGG+       +N  +E+  E GEQV+R R  ++  S  R+ 
Sbjct: 320 YEVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W NDWGE+L+DFGVDVD+E
Sbjct: 380 WYNDWGESLDDFGVDVDME 398

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  452 bits (1162), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/380 (56%), Positives = 291/380 (76%), Gaps = 5/380 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVK K+PWMG+ IPC+L SFIGY +H ++L   +S   Q +F+ SLTM+W+SY +AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG+P K+FKPL  EW +FCKKC  +KPER+HHCKTCNQCVLMMDHHCPWTMNC+GF NF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFL W++ TTGFLL+  +KR IY+W  ++LPSYLFE++E+  L +  P++ F+L+T
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + LLF RCL NQII GKTQIE WE++RLEN +Y KKLLPQL++NLWE+YP  K+ ++   
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A++L E+ + +R+++IV FPYDL I+ N   ++G P+ WLW FGGP  +GM+F+KNE+AL
Sbjct: 241 AERLIEK-KGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIAL 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQ---KGTNVESITENGEQVIRQR-NFENDNSYRK 356
           ++  +++    L+LPWPPD GR+   +     +NVE IT +GEQV+R R + +N    R+
Sbjct: 300 FDPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSRE 359

Query: 357 TWNNDWGENLEDFGVDVDVE 376
            W N+WGENLEDFGVDV++E
Sbjct: 360 EWFNEWGENLEDFGVDVEME 379

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 279/379 (73%), Gaps = 3/379 (0%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+S   QL F+ SL+M+W+SY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           N GRP  +++P    W +FCKKCQ +KPER+HHCK CNQCVLMMDHHCPWTMNCVGF+N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFLFWV+VTT  L    +KR  ++W  + LP YLFEK+E+ FL IL P+D FVL+T
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           +A+LF+RCLSNQII G++QIESW+++RLE+L    KL+P+L+ N W IYP  ++ +++  
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A KL  +  + RF+ +V+FPY+ +  +NA+  LG    WLW +G P  DG  F KN+++ 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 301 YEEGAAIEDLLLSLPWPPDGGRN--FIQQKGTNVESITENGEQVIRQRNFEN-DNSYRKT 357
           YE  + +ED++LSLPWPPDG +         + +E+  E GEQ++R RN ++  ++ R+ 
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREK 360

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W NDWGE+L+DFGVDVD+E
Sbjct: 361 WYNDWGESLDDFGVDVDME 379

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  442 bits (1138), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 207/378 (54%), Positives = 269/378 (71%), Gaps = 4/378 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLK+PW+G+ IPC L +FIGYSA +FVL  F+S K Q+WFQ SLTM+W+SY  AI+T
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG P   F+PLK EW ++CKKCQ FKPER HHCKTC QCVL+MDHHCP+TMNCVG+ NF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFLFW++ TT +L  Q  KRT ++W ++   + L  K EI FL IL P + FVL+T
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           +++LF RC+ NQ++ G TQIE+WE++R+E+++Y ++L+PQLL NL E+YPN        +
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
            + L    RK+ FE++V FPYD D W N +  +G  + WL  FG P+ +GM F+KNEL+ 
Sbjct: 241 DRILN--NRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSA 298

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGT-NVESITENGEQVIRQRNFEND-NSYRKTW 358
           YE G+ + D LLSLPWPPDG R          VES T NGE +IR+R+ E   N  R  W
Sbjct: 299 YEHGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEW 358

Query: 359 NNDWGENLEDFGVDVDVE 376
            NDWGENL  FGVDVD +
Sbjct: 359 YNDWGENLAHFGVDVDAD 376

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  434 bits (1117), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 279/379 (73%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M VKL++PW+G+ IP LL SFIGY AH F+L+NF+    Q+ F+ SL+M+W SY LAI+T
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRP  +++P    W +FCKKCQ +KPER+HHCKTCNQCVLMMDHHCPWTMNCVGF N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFLFW+++TT  L    +KR  ++W  ++ P YLF+K+E+TFL IL P++ FVL+T
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + +LF+RCL NQI+ G++QIESW+++RLE+L+  ++L+ +L+ N W IYP  KT +++  
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A+ L ++ R   FE +V FPY+ D+ +NA+  LG    WLW +G P  +G +F KN+++ 
Sbjct: 241 AEGLLKQQRS-SFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISN 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFI--QQKGTNVESITENGEQVIRQRNFENDNSY-RKT 357
           YE  + +ED++LSLPWPPDGG        K + +E+  E GEQV+R R  +N  S  R+ 
Sbjct: 300 YEVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W NDWGE+L+DFGVDVD+E
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  432 bits (1112), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/378 (53%), Positives = 270/378 (71%), Gaps = 4/378 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLK+PW+G+ IP  L + IGY AH F+L NF+S + QLW+Q   TM+W+SY LAI+T
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
            PG+P  +FKP K EW  +CKKC+ +KPER+HHCKTCNQCVLMMDHHCPWTMNCVG+ NF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFLFWV+V T  L   L  R   +W  +  PSYL+ K+E+ FL IL P++ F+L+T
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           +++L IRCL NQI  G++QIESWE++RLE L    KLLP L+ N+W I+PN +    +  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A+ L  + R +  + +V FPYDL  + NA+ +LG+P  WL+ F GP  DG+HF+KNE ++
Sbjct: 241 AEALLNKKR-LSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESM 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGR--NFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTW 358
            E+  ++ D++L LPWPPD  +  N   +  +NV+ I+E GEQVIR R  E   S R  W
Sbjct: 300 IEDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIRTPEKKLS-RSEW 358

Query: 359 NNDWGENLEDFGVDVDVE 376
            NDWGE+LEDFGVDVDVE
Sbjct: 359 LNDWGESLEDFGVDVDVE 376

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  431 bits (1109), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/379 (52%), Positives = 274/379 (72%), Gaps = 4/379 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKL++PW+G+ IP  L SFIGY AH F+L+NF+S   Q+ F+  L+M+W+SY LAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRP  ++KP    W +FCKKCQ +KPER+HHCKTCNQCVLMMDHHCPWTMNCVGF N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHFLRFLFW++VTT  L     KR  ++W  + LP Y F+K+E+ FL I  P++ FVL+T
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + +LF+RCL NQI+ G++QIESW+++RLE+L+   +L  +L+ N W IYP  ++ +NK  
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A++   + R  RF+ +V FPYD D+++NAL  LG    WLW +G P  DG +F KN ++ 
Sbjct: 241 AEEHLTKKRP-RFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISK 299

Query: 301 YEEGAAIEDLLLSLPWPPDGGR--NFIQQKGTNVESITENGEQVIRQRNFEND-NSYRKT 357
           YE  +++ED +LSLPWPPDGG+         + +E   E+GEQ+IR R  +N  ++ R+ 
Sbjct: 300 YEANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 358 WNNDWGENLEDFGVDVDVE 376
           W NDWGE+L+DFGVDVD+E
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  425 bits (1092), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/381 (54%), Positives = 273/381 (71%), Gaps = 7/381 (1%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M VKLK+PW+G+ IP  L SFIGY AH F+L+NF+  K QLWF+ SL M+WISY LAI+T
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG+P   F+P K EW +FC KC  +KPERAHHCK CNQCVL MDHHCPWTMNCVG +NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
            HF+RFLFWV+ TT FLL  L+KR ++LW  + +P+Y   ++E+ FL IL PMD FVL+T
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           ++LL +RC  NQI+ G TQIESWE++R+EN+++  +L+P++L NL EI P   + ++  +
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
            K L +   ++  + IV FPYDL+ W+NA+  LG    W+  +G    +GM F+KNEL++
Sbjct: 241 RKLLSQ--NRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSV 298

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN----VESITENGEQVIRQRNFENDNSY-R 355
           YE    IED LLSLPWPPDGGR+ +   G N    VES T +GE+V+R+R  +   +  R
Sbjct: 299 YEPEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPR 358

Query: 356 KTWNNDWGENLEDFGVDVDVE 376
           K W NDWGENL DFGVD+D E
Sbjct: 359 KKWYNDWGENLADFGVDLDEE 379

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/377 (51%), Positives = 263/377 (69%), Gaps = 3/377 (0%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M V +K+PW+GV IPC L SF GY AH FVL NF+S+K  LWFQ SL+M+WISY  AI+ 
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRP K F+PL+ EW ++C KC+ +KPER HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
                   W++ TTG LL+  +KR  + W  +   + L  K E+ FL IL P+D F+L+T
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           ++LLF+RC+ NQI+ G+TQIE+WE++R+ENL+Y ++LLPQLL NL EIYP     + K +
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
            + L        F+ ++ FPYD++ W N L  +GSP+ WL  FGGP +DGM F+KNE++ 
Sbjct: 241 EEFLS--SSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISD 298

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQ-QKGTNVESITENGEQVIRQRNFENDNSYRKTWN 359
           Y+E  +I+D LL+LPWPPD  R+ I     ++VE  T+ GEQV+R+R+       R  W 
Sbjct: 299 YDEATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWY 358

Query: 360 NDWGENLEDFGVDVDVE 376
           NDWGE+LE FGVDV+VE
Sbjct: 359 NDWGESLEHFGVDVEVE 375

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 187/383 (48%), Positives = 263/383 (68%), Gaps = 13/383 (3%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M +KLK  W+GV IP  L + IGY +H F+L+NF+SW  Q+++Q+  TM+W+SY LAI+T
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG P K FKP  +EW ++CKKC+++KPERAHHCKTCNQCVL MDHHCPWT+NCVG  NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFLFWV+ +T +LL+ L+ R   LW ++    +    +EI F+ I+ PMD FVL+T
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLW----EIYPNEKTPE 236
           V+ L  RC+ NQ + G TQIESWE++R+++L+Y+ +LL Q++  L     EI P ++   
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 237 NKVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKN 296
           NK+L+K      R V  E+   FPYD++ W+N    +G    WLW +  P + G  F KN
Sbjct: 241 NKLLSK------RYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKN 294

Query: 297 ELALYEEGAAIEDLLLSLPWPPDGGRNFIQQ--KGTNVESITENGEQVIRQRNFE-NDNS 353
           EL  Y+  ++IED+L+SLPWPPDG  +  +    G+++E+I   GEQVIR ++ +  D  
Sbjct: 295 ELFFYDPNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRL 354

Query: 354 YRKTWNNDWGENLEDFGVDVDVE 376
            R +W NDWGE+L DFGVD ++E
Sbjct: 355 GRNSWYNDWGEDLSDFGVDTELE 377

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  398 bits (1023), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 187/380 (49%), Positives = 260/380 (68%), Gaps = 8/380 (2%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPV+LK+PW+G+ +P  L ++IGYS+H F+L NF S   QLWF+ SLT++W+SYA AIF 
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPGRP  +F+P   +W ++CKKC  +KPER HHCKTC QCVL MDHHCPWTMNCVG  NF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFL WVV+TT +L   L +R    W  ++   ++   +E+ FL +  P++ F+L+T
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           V+LL  RC+ NQ + G TQIESWE +R+ENL++ ++L+PQL+ NL E++P +   E    
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGA-- 237

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           A+KL    +++  E+I+ FPYD+DI  N  + +G    W    G P  +G  F  N+L+ 
Sbjct: 238 AQKLLS-SKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSD 296

Query: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQK---GTNVESITENGEQVIRQRNFENDNSYRKT 357
           Y+  A+IED LLSLPWPPDGGR   Q+     + +E+ +  GE  +R R+F++  S  +T
Sbjct: 297 YDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRT 356

Query: 358 -WNNDWGENLEDFGVDVDVE 376
            W+NDWGENL DFGVDVD E
Sbjct: 357 EWHNDWGENLSDFGVDVDAE 376

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  395 bits (1016), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 190/384 (49%), Positives = 261/384 (67%), Gaps = 14/384 (3%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPV+LK PW G+ IPC L  FIGY AH F+L N +S K Q+ FQ  LTM+WISY +AI+T
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGRP--AKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFK 118
           NPG+P    + +    +   +C KC  FKPER+HHCKTC QCVLMMDHHCPWTMNC+GF 
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLP----SYLFEKTEITFLIILIPMD 174
           NFP F+RFL WV++TT  L + LL R   +W  +++P           E+  L++L PMD
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 GFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKT 234
            FVL T+  LF+RC++NQ+IGG TQIESWE+ERL+N++Y KKLLP ++  +WE +P+E+T
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 PENKVLAKKLQERGRK--VRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMH 292
           PE+++ A+KL E   +  ++F ++V FPYD+D+ +N    LGSP+  LW F     +G+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 293 FKKNELALYEEGAAIEDLLLSLPWPPDGGRNFIQQKGTN----VESITENGEQVIRQRNF 348
           F+KN+++ YE+  +I DLLL L WPPDGGR     +  +    ++   E+GE +IR+RN 
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 349 ENDNSYRKTWNNDWGENLEDFGVD 372
             ++  R TW N WGE LE FGVD
Sbjct: 361 PIES--RTTWENQWGETLEGFGVD 382

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  387 bits (994), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/380 (50%), Positives = 255/380 (67%), Gaps = 8/380 (2%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           MPVKLK+PW+G+ IP  L +FIGY +H F+L NF+S   Q+WFQ  L+M+WISYALAIFT
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           NPG+P   F+PL  +W + C+KC+ +KPER HHCKTC+QCVL+MDHHCPWTMNCVG  NF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
           PHF+RFL WV++TT +L + L KR    W ++    Y+ +K E+ F+ I  P++ FV +T
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYV-QKIELVFIFINTPLNAFVWLT 179

Query: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240
           + LL +RC  NQ + G TQIE WE ER+EN +   +L+PQLL NL EIY ++    N   
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDIL--NSPN 237

Query: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300
           AKKL    R ++ E IV FPYDL+I +N    +G+ +  +  +  P  +G+ F KN+L+ 
Sbjct: 238 AKKLIN-ARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSS 296

Query: 301 YEEGAAIEDLLLSLPWPPDGGR---NFIQQKGTNVESITENGEQVIRQRNFE-NDNSYRK 356
           Y+    IED LLSLPWPPDGGR       Q  + +E  +  GE V+R+R  +   N  R 
Sbjct: 297 YDTCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRT 356

Query: 357 TWNNDWGENLEDFGVDVDVE 376
            W NDWGENL DFGVDV+ E
Sbjct: 357 EWYNDWGENLSDFGVDVESE 376

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  378 bits (971), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 203/399 (50%), Positives = 266/399 (66%), Gaps = 26/399 (6%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M ++LK+PW+G+ IP  L SFIGYSAH F+L + +SWKLQLWFQ SL+M+W+SY LAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGRPAKSFKPLK-KEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKN 119
           +PG P+ + K    K    +CKKC  +KP RAHHCKTCN+C+LMMDHHCPWTMNCVGFKN
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLI 179
           +PHFLRFLFWV+VTT FLL QL +R  ++W      S L ++ EI  L IL PMD F+L+
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 180 TVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKK-----LLPQLLVNLWEIYPNEKT 234
           T+ LL IRC  NQI  G +QIE WE+ERLE+ +Y +K      L  L+ N++ I+  E +
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIE-S 239

Query: 235 PEN---KVLAKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGM 291
           PE+   +V     Q   R++ F +I+ FPYD+DI +NA  VLG    WL  FG P+ DGM
Sbjct: 240 PEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGM 299

Query: 292 HFKKNELALYEEGAAIEDLLLSLPWPPDG-----GRNFIQQKGTNVESITENGEQVIRQR 346
           HF+ NE+A  E+ + + DLLLSLPWPPD      G++ I +    VE+  E GE V+R R
Sbjct: 300 HFELNEIA-SEKASTLADLLLSLPWPPDTCTSKYGKS-IDEGTKYVETHIEGGECVLRNR 357

Query: 347 NFE--------NDNSY-RKTWNNDWGENLEDFGVDVDVE 376
                      N+N   RK+W N+WGENL+ FGVD++ E
Sbjct: 358 TVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  204 bits (520), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 141/402 (35%), Positives = 210/402 (52%), Gaps = 54/402 (13%)

Query: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60
           M ++   PW GV IP  +   +   ++  +L + ++    +W+ ++  M+  SY LAI T
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPE-----------RAHHCKTCNQCVLMMDHHCP 109
            P  PA S             +  +F              RAHHCKTCN CV+MMDHHCP
Sbjct: 61  -PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCP 119

Query: 110 WTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFE--KTEITFL 167
           WTMNCVG+ N+PHF+RFL WV+++T  LL QL+K+   L+  ++ P +L++  K +I  L
Sbjct: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIIL 179

Query: 168 IILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKK----LLPQLLV 223
            +LIP   FV +TV LL ++ L NQI  G TQIE W+ E +EN Y++ K     L   L+
Sbjct: 180 TLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLL 239

Query: 224 NLWEIYPNEKTPENKV-----LAKKLQERGR-KVRFENIVTFPYDLDIWSNALTVLGS-- 275
                + N+K   + +     L   LQ   R    F +I+ FPYDL + +N  T +GS  
Sbjct: 240 ENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299

Query: 276 PVQWLWLFGGPDSDGMHFKKNELALYEEGAA---IEDLLLSLPWPPDGGRNFIQQKGTNV 332
           P+ W   +  P +   + K NE A++++      I+D+LL LPWP +   N         
Sbjct: 300 PLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN--------- 349

Query: 333 ESITENGEQVIRQRNFENDNSYRKTWNNDWGENLEDFGVDVD 374
            S  ++GE V++              +ND+GE L+DFGVD D
Sbjct: 350 -STFQDGELVVK--------------SNDYGETLQDFGVDYD 376

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 75/145 (51%), Gaps = 13/145 (8%)

Query: 67  KSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRF 126
           KS+   +      C+ CQ++KP+R HHC TCN+C+L MDHHCPW   C+GFKN   F++F
Sbjct: 96  KSYTMKRNGRYRLCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQF 155

Query: 127 LFWVV----VTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVA 182
           L +      V  G + YQ +      W      +Y+ E  + T LI  + +  FV+    
Sbjct: 156 LIYCTIYAFVALGLISYQFVN-----WYKNQ--NYMNEYIDFTLLI--VGLLAFVISISV 206

Query: 183 LLFIRCLSNQIIGGKTQIESWELER 207
           L F      Q++  +T IE + + R
Sbjct: 207 LAFSSFSIYQVLKNRTTIEMYGIRR 231

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 62  PGRPAKSFKPLKKEWTH-FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120
           P   AK    LKK+  +  C+ CQ++KP+R HHC TC++C+L MDHHCPW   C+GF+N 
Sbjct: 82  PEYIAKRSFTLKKDGRYRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQ 141

Query: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180
            +F++FL +    +  +L+       Y +  K     L +   +T  I+ I      +IT
Sbjct: 142 KYFVQFLIYCTAYSIVVLFFTSCELHYWFSGKQYEDELIDLMLLTVWILAI------VIT 195

Query: 181 VALLFIRCLS-NQIIGGKTQIESWELER 207
           V+L+F    S  Q++  +T IE + ++R
Sbjct: 196 VSLIFFSSFSIYQLLKNQTTIEMYGMKR 223

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 91.7 bits (226), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 5/128 (3%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C  +KP+R HHC +CN+C+L MDHHCPW   C+GFKN  +F++FLF+    +  +L+
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCTSYSIIVLF 165

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQ 199
            +    IY W      S  +E   I F ++ + +   V+    +LF      Q++G +T 
Sbjct: 166 -VTSIQIYHW----FRSTSYEYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLGNQTT 220

Query: 200 IESWELER 207
           IE +   R
Sbjct: 221 IELYAYRR 228

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 88.6 bits (218), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 5/131 (3%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C+ +KP+R HHC +C++C+L MDHHCPW   CVGF+N   F++FL +      F+L 
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVL- 161

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQ 199
            +    +Y W   D     F++  I+  ++ + +   V+     LF     +Q++  +T 
Sbjct: 162 SMTSVQLYRWFYND----KFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQTT 217

Query: 200 IESWELERLEN 210
           IE + ++R  N
Sbjct: 218 IEMYGVQRWRN 228

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 114/245 (46%), Gaps = 38/245 (15%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C ++KP+R+HHC TCN+CVL MDHHCPW   C+GFKN   F++FL +   T  +++ 
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY-NTTYAYVIA 168

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSN----QIIG 195
            L  + +Y W   D  SY  E   +  L +      ++L  V  L + C +      ++ 
Sbjct: 169 ILTSKQMYNWF--DDGSYENEFVNMYLLFL------WILALVVSLALSCFAGFSVYMVMN 220

Query: 196 GKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVLAKKLQERG-RKVRFE 254
            KT IE + + +     YR  L         E+Y   + P      + + + G +K  +E
Sbjct: 221 NKTTIEMYAMRK-----YRDDL---------ELY--NRNPNRVPSVENIFDLGSKKENWE 264

Query: 255 NIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELALYE--EGAAIEDLLL 312
           +I+   +    W   ++   S    L +    D  G++FK NE       + A I+D LL
Sbjct: 265 DIMG--HSFIEWLLPISTFHS----LLMKNTLDEKGLYFKVNERVHQRLLDSANIQDQLL 318

Query: 313 SLPWP 317
               P
Sbjct: 319 RRVTP 323

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 87.4 bits (215), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 74/142 (52%), Gaps = 18/142 (12%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C ++KP+R HHC  C++C+L MDHHCPW   CVGFKN  +F++FL +  V    L+ 
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV-YAILVM 164

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSN----QIIG 195
                 IY W   +L  Y  E  +I  L++      ++L     L + C +     Q I 
Sbjct: 165 TYTSFQIYDWFKNEL--YETEIIKIRLLMV------WILSVAVFLTVTCFTGFSIYQTIN 216

Query: 196 GKTQIESWELERLENLYYRKKL 217
            +T IE + L +     YR++L
Sbjct: 217 NRTTIEMYTLRK-----YREEL 233

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 70/141 (49%), Gaps = 5/141 (3%)

Query: 67  KSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRF 126
           +S+   +      CK C  +KP+R HHC TCN CVL MDHHCPW   CVG++N   F++F
Sbjct: 93  RSYTQKRNGRFRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQF 152

Query: 127 LFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFI 186
           L +  V +  L+  L    IY W         FE   I F ++ + +   V+     +F 
Sbjct: 153 LIYCTVYS-ILVLILSSMEIYTW----FKGEFFEVELINFTLLSLWLLALVVSISITIFT 207

Query: 187 RCLSNQIIGGKTQIESWELER 207
               +Q+   +T IE + L R
Sbjct: 208 VFSISQVCQNQTTIELYSLRR 228

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 114/260 (43%), Gaps = 44/260 (16%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C ++KP+R HHC +C++C+L MDHHCPW   C+GFKN  +F+ FL +  +   F+  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFV-- 163

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQ 199
             L  +  LW       Y+ E   I  L++ I     +      LF      Q++  +T 
Sbjct: 164 -CLISSKELWNWFSQEKYVTELINIHLLLLFIV--SLITSVSMTLFTAYSIYQVLINRTT 220

Query: 200 IESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVLAKKLQERGRKVRFENIVTF 259
           IE +   R     Y+++L         EI  +  T  N        +  R +  +N+   
Sbjct: 221 IELYAYRR-----YKEEL---------EILQDTTTTYNS-------QSNRPLPTDNV--- 256

Query: 260 PYDLDIWS-NALTVLGS-------PVQ---WLWLFGGPDSDGMHFKKNE--LALYEEGAA 306
            +DL  +  N    +G+       PVQ   ++      D  G++F  N    +  +E A 
Sbjct: 257 -FDLGSYKLNWCETMGTTWKEWLLPVQTNKYIKSRHTSDEKGLYFNINRKVASQLQESAI 315

Query: 307 IEDLLLSLPWPPDGGRNFIQ 326
           ++D LL     P   R++ Q
Sbjct: 316 LQDRLLRRV-TPRSSRDYSQ 334

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 54/82 (65%), Gaps = 7/82 (8%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFW-------VVV 132
           C+ C+++KP+R+HHC +CN+C L MDHHCPW  +C+GFKN   F++FL +       V +
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

Query: 133 TTGFLLYQLLKRTIYLWGVKDL 154
           TTG  L++ L   +Y   + DL
Sbjct: 165 TTGLQLWKWLDNKMYEKELIDL 186

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 82.8 bits (203), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 49/73 (67%), Gaps = 3/73 (4%)

Query: 78  HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFL 137
            FC+ C+++KP+R HHC  CN+C L MDHHCPW  +CVGF+N   F++FL +   TT + 
Sbjct: 103 RFCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAY---TTVYS 159

Query: 138 LYQLLKRTIYLWG 150
           LY LL  +  L+ 
Sbjct: 160 LYVLLMTSAQLYS 172

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 98/230 (42%), Gaps = 38/230 (16%)

Query: 16  CLLTSFIGYSAHIFV--LANFMSWKLQLWFQSSLTMLWISYALAIFTNPGRP-------- 65
           CL T    ++A+I +  +    SW L +    +L +   +Y  AI   PG P        
Sbjct: 14  CLTTCLYIWTAYITLTRIHQIPSWFLAVTIIPTLLVALYTYFKAIAKGPGSPLDFPDLLV 73

Query: 66  -----------------AKSFKPLKKEWT-HFCKKCQLFKPERAHHCKTCNQCVLMMDHH 107
                            +K    LK +     C+ C ++KP+R HHC +C+ C+L MDHH
Sbjct: 74  HDLQAAENGLELPPEYMSKRCMTLKHDGRFRVCQICHVWKPDRCHHCSSCDMCILKMDHH 133

Query: 108 CPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFL 167
           CPW   C GFKN   F++FL +    T F  + +L  + Y  G     S  F +  I F 
Sbjct: 134 CPWFAECTGFKNQKLFIQFLMY----TTFYAFLVLIYSCYELGTW-FHSGSFNQELIDFH 188

Query: 168 IILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKL 217
           ++ + +    +    L F      Q+   +T IE + + R     YR+ L
Sbjct: 189 LLGVALLAIAIFISVLAFTAFSIYQVCNNQTTIELYGMRR-----YRRDL 233

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTT-GFL 137
            C+ C ++KP+R HHC  CN+C+L MDHHCPW  +CVGF+N  +F++FL +  +     L
Sbjct: 107 LCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNVL 166

Query: 138 LYQLLKRTIYLW 149
           ++  ++  +Y+W
Sbjct: 167 IFDTIQ--LYIW 176

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 95/230 (41%), Gaps = 38/230 (16%)

Query: 16  CLLTSFIGYSAHIFV--LANFMSWKLQLWFQSSLTMLWISYALAIFTNPGRP-------- 65
           CL T    ++ +I +  +     W L L   ++LT+   +Y   I   PG P        
Sbjct: 14  CLTTCLYAWTTYITLTRIHEIPKWFLTLTIVATLTVALYTYYKVISRGPGSPLDFPDLIV 73

Query: 66  -----------------AKSFKPLKKEWT-HFCKKCQLFKPERAHHCKTCNQCVLMMDHH 107
                            +K    LK +     C+ C ++KP+R HHC +C+ CVL MDHH
Sbjct: 74  HDLKAAENGLELPPEYISKRCMTLKHDGRFRVCQVCHVWKPDRCHHCSSCDICVLKMDHH 133

Query: 108 CPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFL 167
           CPW   C GFKN   F++FL +    T    + +L  T Y  G     S  F +  I F 
Sbjct: 134 CPWFAECTGFKNQKFFIQFLMY----TTCYAFLVLIYTCYELGTW-FNSGSFNRELIDFQ 188

Query: 168 IILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKL 217
           ++ + +    +    L F      Q+   +T IE   + R     YR+ L
Sbjct: 189 LLGVALLAVAVFITVLAFTVFSIYQVCKNQTTIEVHGMRR-----YRRDL 233

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 5/133 (3%)

Query: 78  HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFL 137
            FC+ C ++KP+R HHC  CN+C L MDHHCPW  +CVG++N  +F+ FL +    +  L
Sbjct: 131 RFCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYS-IL 189

Query: 138 LYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGK 197
           ++ L    + +W      S  + +  I   ++++ +   V+    L F       +   +
Sbjct: 190 VFFLTGADLLMW----FRSQGYNQELINLPLLIVWILSLVITISMLAFTSYTIYLVAKNQ 245

Query: 198 TQIESWELERLEN 210
           T IE +E     N
Sbjct: 246 TTIEMYEWTNYRN 258

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 72/144 (50%), Gaps = 22/144 (15%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C ++KP+R HHC +C+ C+L MDHHCPW   C GFKN   F++FL +    T F  +
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY----TTFYAF 161

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLS------NQI 193
            +L  T Y  G        F     +  +I + + G  L+ +A +FI  L+       Q+
Sbjct: 162 LVLIDTCYELGT------WFNSGSFSRELIDLHLLGTALLAIA-VFISVLAFSAFSIYQV 214

Query: 194 IGGKTQIESWELERLENLYYRKKL 217
              +T IE   + R     YR+ L
Sbjct: 215 CNNQTTIELHSMRR-----YRRDL 233

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 63/108 (58%), Gaps = 9/108 (8%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC TC  C+L  DHHC W  NC+G +N+ +F+ FL   ++++ FL+
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLI 239

Query: 139 YQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFI 186
                 +I+++  ++LPS      ++   I+L+   G  +I   LL I
Sbjct: 240 ANC---SIHIYHHRNLPS------KVPVTILLLIYGGLAIIYPMLLLI 278

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 7/133 (5%)

Query: 78  HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFL 137
            FC+ C ++KP+R HHC  C +C L MDHHCPW  +CVG+ N  +F++FL +  V +  L
Sbjct: 104 RFCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFS-IL 162

Query: 138 LYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALL-FIRCLSNQIIGG 196
           ++ L    + LW       Y  E  ++  L++ I     V I++++L F       I   
Sbjct: 163 IFLLSGTELLLWFKNQ--RYNQEMIQLPLLVVWILS---VAISISMLAFTSYTVYLITKN 217

Query: 197 KTQIESWELERLE 209
           +T IE +E   L+
Sbjct: 218 QTTIEMYEWSNLK 230

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (51%), Gaps = 12/139 (8%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C ++KP+R HHC +C+ C+L MDHHCPW   C GF+N   F++FL +    T    +
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY----TTLYAF 161

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLS-NQIIGGKT 198
            +L  T Y  G     S  F +  I F ++ + +   V + +++L   C S  Q+   +T
Sbjct: 162 LVLIYTCYELGTW-FNSGSFNRELIDFHLLGVALLA-VAVFISVLAFTCFSIYQVCKNQT 219

Query: 199 QIESWELERLENLYYRKKL 217
            IE   + R     YR+ L
Sbjct: 220 TIEVHGMRR-----YRRDL 233

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 76.6 bits (187), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC TC  C++  DHHC W  NC+G +N+ +F  FL   V+ T F++
Sbjct: 171 YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFII 230

Query: 139 YQLLKRTIYLWGVKDLP 155
                R       KD P
Sbjct: 231 ANCAIRVSRSVHAKDAP 247

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P  +  PL K    +C  C++++P RA HC TC  CV+  DHHC W  NCVG +N+ +F+
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFI 225

Query: 125 RFLFWVVVTTGFLL 138
            FL   V+   FL+
Sbjct: 226 IFLIGTVLAELFLI 239

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           FC  C+L KP R+ HC  CN+CVL+ DHHC W  NC+G  N+ +F  FL    V+   LL
Sbjct: 136 FCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLLL 191

Query: 139 YQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLF 185
                R I L    D+    F    +TFLI+       +L+   L F
Sbjct: 192 GYAFLRIILLTAYSDIG---FPNIVLTFLILSGAFFAILLVFTYLQF 235

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 44/77 (57%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +CK C++++P R+ HC  C  CVLM DHHC W  NCVG +N+ +FL FL    +T+ FL+
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLI 242

Query: 139 YQLLKRTIYLWGVKDLP 155
                       V D P
Sbjct: 243 VNAAIDVARTPDVTDTP 259

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 41/60 (68%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C+ C++++P R  HC TCN CV++ DHHC W  NCVG +N+  FL FL   + ++ FLL
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLL 233

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (72%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFW 129
           +C  C ++KP+R+HHC +CN+C L  DHHCPW  +C+GF N   F++FL +
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           C+ C ++KP+R HHC  C++C+L MDHHCPW   C+GF N   F+++L +   
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATT 159

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 42/60 (70%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C+ C++++P R+ HC TCN CV++ DHHC W  NC+G +N+  FL FL   V+++  LL
Sbjct: 174 YCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILL 233

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 4/72 (5%)

Query: 71  PLKKEWTH----FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRF 126
           P+K E  +    +C+ C++++P R+ HC  C+ CV+ +DHHC W  NCVG +N+ +FL F
Sbjct: 183 PIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIF 242

Query: 127 LFWVVVTTGFLL 138
           L   ++T  FLL
Sbjct: 243 LTSTIMTVIFLL 254

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 5/82 (6%)

Query: 57  AIFTNPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116
           +I T P     S   LK     +C  C++++P RA HC TCN C++  DHHC W  NCVG
Sbjct: 171 SIITLPSSSTNSPIQLK-----YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVG 225

Query: 117 FKNFPHFLRFLFWVVVTTGFLL 138
            +N+ +FL F++  V+T   L+
Sbjct: 226 QRNYRYFLTFIYSAVLTIILLV 247

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 33/48 (68%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           C+ CQL KP R+ HC  CNQCVL +DHHC W  NCVG  N+ +F  FL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFL 182

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P R+ HC TCN CV++ DHHC W  NC+G +N+  FL FL   ++++  LL
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILL 233

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 9/97 (9%)

Query: 55  ALAIFTNPGRPAKSFKPLKKEWTH---------FCKKCQLFKPERAHHCKTCNQCVLMMD 105
              +FT P    K    +  E+            C+ CQ +KP R+ HC  C++CVL+ D
Sbjct: 103 VFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILCRTCQSYKPARSKHCSICDRCVLVAD 162

Query: 106 HHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLL 142
           HHC W  NCVG  N+ +F  FL     +  +   +LL
Sbjct: 163 HHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLL 199

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           CK C++ KP R+ HC  C+QC+L+ DHHC W  NC+G  NF +F  FLF   +   +   
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASM 196

Query: 140 QLLKRTI 146
           +LL+ T+
Sbjct: 197 RLLEITL 203

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC TC  CVL  DHHC W  NC+G +N+ +FL FL    + T   +
Sbjct: 177 YCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATTLCI 236

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 40/60 (66%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P R+ HC TCN CV++ DHHC W  NC+G +N+  FL FL   + ++  LL
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C+ C++++P RA HC  C  CV+  DHHC W  NCVG +N+ +F+ FL    + + FLL
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLL 236

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 38/66 (57%), Gaps = 3/66 (4%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C   KP R+ HC  CN+C+LM+DHHC W  NC+G  N+ +F  FL   V     L Y
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVT---LLSY 188

Query: 140 QLLKRT 145
             L+ T
Sbjct: 189 SFLRLT 194

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL-------FWVV 131
           +C KC+++KP+R HHC  C++C L  DHHC W   C+G+ N   FL FL       FW+ 
Sbjct: 170 YCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWIC 229

Query: 132 VTT 134
           + T
Sbjct: 230 IIT 232

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC  C+ C+L  DHHC W  NC+G +N  +FL FLF  V+++ +LL
Sbjct: 186 YCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLL 245

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  C++ KP R+ HC  CN+C+L+ DHHC W  NC+G  N+  F  FL   +V+  +   
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 140 QL 141
           +L
Sbjct: 196 RL 197

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  C + KP R+ HC  C  C+L+ DHHC W  NC+G  N+ +F  FL    ++  +   
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 140 QLLKRTI 146
           +LL  T+
Sbjct: 199 RLLHITL 205

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC+ C  CV   DHHC W  NCVG +N+ +FL FL     T   L 
Sbjct: 185 YCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLF 244

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 78  HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           H C+ C+  KP R+ HC  CN C+ + DHHC W  NCVG  N+ +F  FL
Sbjct: 134 HECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFL 183

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 41/77 (53%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P R+ HC  C  C++  DHHC W  NC+G +N+  FL FL     T+ FL+
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLI 275

Query: 139 YQLLKRTIYLWGVKDLP 155
                       V+D P
Sbjct: 276 INASIDIARTPKVRDTP 292

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 51  WISYALAIFTNPGRPAKSFKPLKKEWTHF-----CKKCQLFKPERAHHCKTCNQCVLMMD 105
           W+S  +   T+ G    S +    ++  +     C+ C + KP R+ HC  C +CVL+ D
Sbjct: 104 WLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTCHIEKPARSRHCNLCRECVLVAD 163

Query: 106 HHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEIT 165
           HHC W  NC+G  N+  F  FL   VV    L Y  L R +++  +KD    ++ ++ + 
Sbjct: 164 HHCVWVNNCIGKGNYQFFYAFL---VVNVISLSYGFL-RVLWISVMKDPSMVVYPRSILI 219

Query: 166 FLII 169
           F I+
Sbjct: 220 FTIL 223

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 36/60 (60%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C++++P RA HC  C  CVL  DHHC W  NCVG +N+ +FL FL    +    L+
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C + KP R+ HC+ CN C+L+ DHHC W  NC+G  N+ +F  FL    +T  +   
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 140 QLL 142
           +L 
Sbjct: 199 RLF 201

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C  C +++P RA HC  C  C+ + DHHC W  NCVG +N+ +F+ FL   ++++ F++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFII 248

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 33/49 (67%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           +C  C++++P RA HC  C  C+L  DHHC W  NC+G +N+ +FL FL
Sbjct: 172 YCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFL 220

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLL 138
           +C+ C++++P R+ HC  C+ CVL  DHHC W  NC+G +N+  FL FL    ++   L+
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLI 232

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  C + KP R+ HC  CN+C+L+ DHHC W  NC+G  N+  F  FL   + +   LLY
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFS---LLY 192

Query: 140 QLLK 143
             L+
Sbjct: 193 AFLR 196

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (64%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           C  C++ KP R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  C+  K  R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FLF  + +  +   
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 140 QL 141
           +L
Sbjct: 196 RL 197

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 59/108 (54%), Gaps = 10/108 (9%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C+L K  R+ HC  C +C+L+ DHHC W  NC+G  N+ +F  FL   +     L Y
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL---LSNCSMLSY 189

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIR 187
                TI L  V   PS L+   + +FL ++I +  F +I+++  +++
Sbjct: 190 A----TIRLSSVA--PSGLWRSNK-SFLSLMILVCCFAVISISFTYMQ 230

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTT--GFL 137
           C+ C+L K  R  HC  C+QCV + DHHC W  NC+G  N+ +F  FL   V  T  GFL
Sbjct: 133 CRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFL 192

Query: 138 LYQLLKRTIY 147
               L+R ++
Sbjct: 193 RLLFLQRFVH 202

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           CK C+  KP R+ HC  C++C+L+ DHHC W  NC+G  N+  F  F+
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFI 182

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           C+ C+  K  R+ HC  C +C+ + DHHC W  NCVG+ N+ +F  FL
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHF 123
           C+ C++ KP R+ HC  C +CV + DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 35/63 (55%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C+ C++ K  R+ HC  C +C  + DHHC W  NC+G  N+ +F  FL   V  T +   
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFT 190

Query: 140 QLL 142
           +LL
Sbjct: 191 RLL 193

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 41/88 (46%), Gaps = 12/88 (13%)

Query: 52  ISYALAIFTNP---GRPAKSFKPLKKEWTH---------FCKKCQLFKPERAHHCKTCNQ 99
           +S  L +FT P   G   +   P + +W +          C+ C   K  R+ HC  C +
Sbjct: 99  VSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRR 158

Query: 100 CVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           C+ + DHHC W   C+G  NF +F  FL
Sbjct: 159 CIQLADHHCIWFNTCIGRGNFFYFYVFL 186

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           PAK ++     +  +C  C+  K  R+HH    N C+   DH+C W    +G  N+  F+
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFV 163

Query: 125 RFLFWVVVTTGFL 137
            FLF+  V+ G +
Sbjct: 164 IFLFYCTVSFGIM 176

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 109/257 (42%), Gaps = 32/257 (12%)

Query: 64  RPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHF 123
           +P K ++  K  +  +C  CQ  K  R+HH K   +C+L  DH+C W    +   N+  F
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLF 161

Query: 124 LRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVAL 183
           L+++ W  +    LL+  L   +++  +  L         +    IL  +   + + + +
Sbjct: 162 LQYVGWFNL---LLLWYWLTIAVFIRTIGML------NGNVIVGFILSCLGWMMTLGLFI 212

Query: 184 LFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVLAKK 243
             I  +SN     KT IE+ + ER +    RKK   +++V   EI  + +   N+   K 
Sbjct: 213 SHIYYMSNN----KTSIETLDAERGK----RKK--HKMMVTNDEI-EHARIEYNR---KY 258

Query: 244 LQERGRKVRFENIVTFPYD--------LDIWSNALTVLGSPVQ-WLWLFGGPDSDGMHFK 294
                ++ +F  +V    D           W NA   LGS +  WL+ +G    D    +
Sbjct: 259 FCYYNQQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDLRKRE 318

Query: 295 KNELALYEEGAAIEDLL 311
            +    Y +   +E+++
Sbjct: 319 ASSFQSYGQSYDLENII 335

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P + ++   + +  +C  CQ  K  R HH  T   C+   DH+C W    VG KN+  F+
Sbjct: 117 PPRIYQCDPQGYPIWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFV 176

Query: 125 RFLFW-------VVVTTGFLLYQLLK 143
           +F F+       V+V+T   L ++++
Sbjct: 177 QFAFYFWAFAIFVIVSTASFLPKIIR 202

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 60  TNPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKN 119
           T   +P + ++   + +  +C  CQ  K  R HH  T   C+   DH+C W    VG KN
Sbjct: 105 TRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKN 164

Query: 120 FPHFLRFLFWVVVTTGFLLYQL---LKRTI 146
           +  F++F F+  + T +++  +   L+R I
Sbjct: 165 YRLFVQFAFYFWLFTIYMIASIASFLRRII 194

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 67/160 (41%), Gaps = 15/160 (9%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  C+  K  R HH K    C+   DHHC W    +G  N+  F +F+F+    +  LL 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYF---SCLLLI 180

Query: 140 QLLKRTIYLWGVKDLP--SYLFEKTEITFLIILIPMD----GFVLITVALLFIRCLSNQI 193
             +    Y+  + D P   Y  +   I  LI+ +P         L  V   F+   S +I
Sbjct: 181 FWISIVSYIKRIVDYPHTGYKLDPNLIVILILSVPFSIMTLSLFLSHVYFTFMNRTSLEI 240

Query: 194 I----GGKTQIESW--ELERLENLYYRKKLLPQLLVNLWE 227
           I      K  I+ +   L++     Y  ++ P+ + N+W+
Sbjct: 241 INIKRNKKLNIKKFVCYLDKTSGNRYVIEMSPEDMANIWK 280

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 57/139 (41%), Gaps = 4/139 (2%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C +CQ  K ER HH      CV   DH+C W    +G  N+  FL+F+ +  +    +  
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWV 182

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFIRCLSNQIIGGKTQ 199
            ++     +  ++  P+          +IIL+      L TV L F       I   +T 
Sbjct: 183 SIVSYIHMI--IRKRPNQPHHHFNTNLIIILVFAILGWLFTVGLFFANIY--YISKNRTS 238

Query: 200 IESWELERLENLYYRKKLL 218
           +E    +  +N   +KK +
Sbjct: 239 LEMLLQKHKKNSPLKKKFI 257

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWV---VVTTGF 136
           C  CQ  K ER+HH +    CV   DH+C W    +G KN+  F++++ +    +VT   
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 137 LLYQLLKRTI 146
            +   +KR +
Sbjct: 187 TIALFMKRIV 196

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 8/107 (7%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  CQ  K  R  H      CV   DH+C W    +GFKN+  F++F+F+  V    L+ 
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAV---LLMI 172

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLITVALLFI 186
             +  ++Y+  ++   + L        LI+L+ + G   +  + LF+
Sbjct: 173 VWITISVYIRDIRQYHARLNAN-----LIVLLIISGIGWLMTSGLFV 214

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFW 129
           C  CQ  K ER HH +    C+   DH+C W    +G  N+  F++++F+
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFY 166

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFL-- 137
           C  C   K ERAHH      CV   DH C W    +G  N+  F++F+ ++ + + F+  
Sbjct: 127 CSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFVFV 186

Query: 138 -LYQLLKRTIY 147
            +   ++R I+
Sbjct: 187 PICAFIRRIIH 197

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P K ++     +  +C  CQ  K ER HH      CV   DH+C W    +G  N+  F+
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFV 176

Query: 125 RFLFWVVV 132
           +F+ +  +
Sbjct: 177 QFVAYFSI 184

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFW 129
           C  CQ  K ER HH  T   CV   DH+C W    VG KN+  F++F  +
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMY 176

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 59  FTNP--GRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVG 116
           FT+P   +P   ++  +  +  +C  CQ  K  R HH      CV   DH+C W    +G
Sbjct: 103 FTSPQVNKPPLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIG 162

Query: 117 FKNFPHFLRFLFWV 130
             N+  F++FL ++
Sbjct: 163 AGNYLLFIQFLVYM 176

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P K ++     +  +C +CQ  K ER HH      C+   DH+C W    +G  N+  F+
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFV 175

Query: 125 RF 126
           +F
Sbjct: 176 QF 177

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 16/113 (14%)

Query: 37  WKLQLW---FQSSLTMLWISYALAIFTNPGRP---------AKSFKPL----KKEWTHFC 80
           W+  +W   F  S+  +   +   I +NPGR           K+ + L    K +  HFC
Sbjct: 409 WEEPIWNSIFGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFC 468

Query: 81  KKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVT 133
            +  + KP R+         V   DH+CPW  N +G +N   F+ F+F+  VT
Sbjct: 469 LETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVT 521

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139
           C  CQ  K ERAHH +    CV   DH C +  + +G  N+  F+++  ++ +    +  
Sbjct: 127 CTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWT 186

Query: 140 QLLKRTIYLWGVKDLPSYLFEKTEITF-LIILIPMDGFVLITVALLFIRCLSNQIIGGKT 198
            ++    Y+  +     Y    + +   LI ++ +     ITV  L +  L N I+  KT
Sbjct: 187 SIVA---YIRSITR--DYRGHGSHLNGNLIAILILTTLFWITVTSLLLTQL-NCIVKNKT 240

Query: 199 QIESWELER 207
            IE  E  R
Sbjct: 241 SIEVMERRR 249

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P K ++     +  +C  CQ  K ER+HH      C+   DH+C W    +G  N+  F+
Sbjct: 116 PPKCYQSDPNGYPIWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFV 175

Query: 125 RF 126
           +F
Sbjct: 176 QF 177

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWV-- 130
           K +  +FC +    KP R+ +    N  V   DH CPW  N VG KN  +F+ F+  V  
Sbjct: 467 KFDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEA 526

Query: 131 -VVTTGFLLYQLLKR-----------TIYLWGVKDLPSYLFEKTEITFLII 169
            ++T   L ++               + +L G  DL  Y F    +TFLI+
Sbjct: 527 GIITFASLCFEYFDELKDHFEVNENTSCFLLGDNDL-CYGFTYDRLTFLIL 576

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  HFC +  + KP R+         +   DH+CPW  N VG KN   FL F+  + V
Sbjct: 455 KYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEV 514

Query: 133 T 133
            
Sbjct: 515 A 515

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%)

Query: 52  ISYALAIFTNPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWT 111
           +S   A+  N   P   +   ++ +  +C  CQ  K  R HH      CV   DH+C W 
Sbjct: 100 VSSESAVPDNSIAPPDIYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWI 159

Query: 112 MNCVGFKNFPHFLRFLFWV 130
              +G  N+  F++F F++
Sbjct: 160 GTVLGRLNYKLFVQFTFYL 178

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K + ++FC +    KP R+ +    N  V   DH+CPW  N VG KN   FL F+  + +
Sbjct: 457 KYDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFI--LSM 514

Query: 133 TTGFLLYQLL 142
            TG  L+  L
Sbjct: 515 ETGIGLFTSL 524

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 82/205 (40%), Gaps = 29/205 (14%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  +FC +  + KP R+ +    +  V   DH CPW  N +G KN  H L  LF +++
Sbjct: 472 KFDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKN--HKLFVLFIILM 529

Query: 133 TTGFLLYQLLK-------------RTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLI 179
             G   Y  L               + +L G  +L + L   T  TF I++  +   + +
Sbjct: 530 VIGIWEYTYLAMEYFDELEDLYKDASCFLLGDDELCAGLTYGT-FTFFIMIWSLFQSIWV 588

Query: 180 TVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPEN-- 237
           ++ L+F++    Q+  G T   S+E  ++      +   P  + + +   P+  T  N  
Sbjct: 589 SI-LIFVQTF--QMFKGVT---SYEFSKIVKGSRVRNPKPSRVNDTFNTTPDGYTSGNDA 642

Query: 238 -----KVLAKKLQERGRKVRFENIV 257
                   A  LQ   R    E I 
Sbjct: 643 ENSATDAAASTLQPESRTGTLETIT 667

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P + ++     +  +C  CQ  K ER HH      CV   DH+C W    +G  N+  F+
Sbjct: 122 PPRCYQCDPHGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFV 181

Query: 125 RFLFW 129
           +F+ +
Sbjct: 182 QFVTY 186

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRF 126
           K +  HFC    +  P RA + +  +  +L  DH+CPW  N +GF+N   F+ F
Sbjct: 441 KYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 55/130 (42%), Gaps = 15/130 (11%)

Query: 48  TMLWISYALAIFTNPG-RPAKSFKPLKKEWTH------------FCKKCQLFKPERAHHC 94
           T+L + Y   IF++PG  P ++   L +                FC K  + KP R    
Sbjct: 360 TLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPVRCSLS 419

Query: 95  KTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDL 154
           K   Q V   DH+C W  N VG KN  H L   F +++ T  + + +L    +    K  
Sbjct: 420 KLNQQQVARFDHYCAWIYNDVGLKN--HKLYIFFLILLETFLMTFGVLNWRYFGLMEKTA 477

Query: 155 PSYLFEKTEI 164
             +LF +T I
Sbjct: 478 ECFLFNRTII 487

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 67/160 (41%), Gaps = 41/160 (25%)

Query: 7   YPWMGVVIPCLLTS--FIG-YSAHIFVLANFMSWKLQLW----------------FQSSL 47
           YP +GV    LL S  ++G ++A I        W + +W                F   +
Sbjct: 364 YPVVGVTSASLLRSPLYLGLFTASII-------WPMLIWISRVIPVTIQDQYTANFLLMI 416

Query: 48  TMLWISYALAIF--TNPGR-PAK--------SFKPL----KKEWTHFCKKCQLFKPERAH 92
            +L +SY L +   ++PGR P +        + K L    K +  +FC +  + KP R+ 
Sbjct: 417 IILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGKFDSKNFCIETWVKKPLRSR 476

Query: 93  HCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
                N  V   DH+CPW  N +G +N   FL  +  V +
Sbjct: 477 FSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  +FC +  + KP R+      N  V   DH+CPW  N +G KN  H +   F + V
Sbjct: 456 KFDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKN--HKIFIFFIISV 513

Query: 133 TTGFLLYQLL 142
             G L++  L
Sbjct: 514 EIGILIFVCL 523

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 79  FCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           FC +    KP R+ +    N  V   DH+CPW  N VG KN   F+ F+
Sbjct: 471 FCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 13/98 (13%)

Query: 47  LTMLWISYALAIFTNPGRPAKS--FKPL-----------KKEWTHFCKKCQLFKPERAHH 93
           LT+    +   + ++PGR  K    +P+           K +  HFC      KP R+  
Sbjct: 408 LTVCLGLFGSLVLSDPGRITKEQELEPVRIAIKELLRIGKFDTRHFCVDTYKRKPLRSKF 467

Query: 94  CKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVV 131
            +     ++  DH CPW  N VG  N   F+ FL  +V
Sbjct: 468 SRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLV 505

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 57/133 (42%), Gaps = 17/133 (12%)

Query: 28  IFVLANFMSWKLQLW--FQSSLTMLWISYALA--IFTNPG---------RPAKSFKPL-- 72
           IF +A F  +K +L   F   L ++ I Y     IF++PG             + K L  
Sbjct: 388 IFKIAPFTIFKSRLLTNFFMFLILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLD 447

Query: 73  --KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWV 130
             K +  +FC +  + KP R+H        V   DH CPW  N +G KN  +F+ F+   
Sbjct: 448 TGKFDIKNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLT 507

Query: 131 VVTTGFLLYQLLK 143
            V   F +   +K
Sbjct: 508 EVGIWFFISLTMK 520

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           K +  +FC +  + KP R+      N  V   DH+CPW  N VG KN   F+ F+
Sbjct: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           K +  +FC +    KP R+      N  V   DH+CPW  N VG KN   F+ F+
Sbjct: 464 KFDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 59/151 (39%), Gaps = 22/151 (14%)

Query: 40  QLWFQSSLTMLWISYALAIFTNPGRPAKS-------------FKPLKKEWTHFCKKCQLF 86
            L F + L  +  S  L  F++PG                   K  K +   FC +  + 
Sbjct: 403 NLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLETWVR 462

Query: 87  KPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLF--------WVVVTTGFLL 138
           KP R+ +    +  +L  DH+CPW  N VG KN   F+ F+         +V V   +  
Sbjct: 463 KPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVCLKYFD 522

Query: 139 YQLLKRTIYLWGVKDLPSYLFEKTEITFLII 169
              +    ++ G  DL S L      TFLI+
Sbjct: 523 ELDMDGDCFILGDDDLCSGLI-GDRFTFLIM 552

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           K +  +FC +    KP R+      N  V   DH+CPW  N VG KN   F+ F+
Sbjct: 465 KFDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 69/162 (42%), Gaps = 19/162 (11%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  +FC +    KP R+ +       V   +H+CPW  N +G KN   F+ F F V  
Sbjct: 424 KYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQY 483

Query: 133 TTGFLLY---QLLKRTIYLW-GVKDLPSYLFEKTEIT-----------FLIILIPMDGFV 177
                ++   +  K+T +++  V++     F K E             FL I I M+ FV
Sbjct: 484 EMFLFMWLCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISMN-FV 542

Query: 178 LITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLP 219
            +   +L ++C   QI  G T  E + L + E       L+P
Sbjct: 543 WLG-GMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 59/140 (42%), Gaps = 14/140 (10%)

Query: 5   LKYPWM-GVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFTNPG 63
           LK P M GV    LL   I +   +F    F    L + F + L  + + +   ++++PG
Sbjct: 371 LKSPLMAGVFYGSLLWVSIVFLLVLFPTVIFEEPMLSILFVAVLGCVHLLFFQLVYSDPG 430

Query: 64  --RPAKSFKPLKKEWT-----------HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPW 110
              P   F  ++ + +           +FC +    KP R       ++ VL  DH+CPW
Sbjct: 431 VLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPW 490

Query: 111 TMNCVGFKNFPHFLRFLFWV 130
             N VG  N   F+ ++  V
Sbjct: 491 VYNDVGLLNHKKFMYYVMSV 510

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  HFC    +  P R+ +    N  +   DH+CPW  N +GF N   FL F+ ++ +
Sbjct: 449 KFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQI 508

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%)

Query: 65  PAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFL 124
           P   ++   + +  +C  CQ  K  R HH      CV  +DH+C W    +G +N+  F 
Sbjct: 107 PPDVYQCDTQGYPVWCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFN 166

Query: 125 RFLF 128
           +FL 
Sbjct: 167 QFLM 170

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127
           K +  HFC    + KP R+         V   DH CPW  N +G +N   FL F+
Sbjct: 445 KFDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFI 499

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 7/82 (8%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  +FC +    KP R+ +       V   DH+CPW  N VG KN  H L   F V V
Sbjct: 441 KFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKN--HKLFVFFAVTV 498

Query: 133 TTGFLLYQLL-----KRTIYLW 149
                L+  L     K+T Y++
Sbjct: 499 QYHMFLFMWLCLAYFKKTNYIY 520

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWV 130
           K +  +FC +    KP R+         V   DH CPW  N +G KN   FL F   V
Sbjct: 438 KFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTV 495

>NCAS0A01730 Chr1 (335930..338284) [2355 bp, 784 aa] {ON} Anc_4.97
          Length = 784

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 18/100 (18%)

Query: 23  GYSAHIFVLANFMSWKL---QLWFQSSLTMLWISYA---LAIFTNPGRPAKSFKPLKKEW 76
           G   H  VL+N M   L   Q   +S+ + L  SY    +++F++    +K+ +P  + W
Sbjct: 575 GSIPHQGVLSNAMDNLLLSSQSSVRSTTSSLVESYKSKIVSLFSHSNDSSKT-EPTHEHW 633

Query: 77  T-----HFCKKCQ---LFKPERAHHCKTCNQ--CVLMMDH 106
                   C+KCQ    F  ER HHC+ C +  C L + H
Sbjct: 634 VPDSERTSCRKCQKQFTF-IERKHHCRHCGEIYCALHLRH 672

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 73  KKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVV 132
           K +  HFC    +  P R+ + +     +   DH CPW  N +G  N  H L ++F V++
Sbjct: 461 KFDAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLN--HKLFYMFVVLL 518

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 2/62 (3%)

Query: 78  HFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFL 137
           +FC +    K  R+ +       V   DH+CPW  N +G KN  H L   F + V     
Sbjct: 440 NFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN--HKLSLFFAMTVQYHMF 497

Query: 138 LY 139
           L+
Sbjct: 498 LF 499

>TBLA0B01620 Chr2 complement(356040..359822) [3783 bp, 1260 aa] {ON}
           Anc_3.175 YAR042W
          Length = 1260

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 5/54 (9%)

Query: 45  SSLTMLWIS-YALAIFTN-PGRPAKSFKPLKKEWTHFCKKCQLFK---PERAHH 93
           SSL ML+++ ++LA +++ P R AK F PL  E   +C+  + F+    + +HH
Sbjct: 945 SSLRMLYVAVFSLAAYSSTPNRVAKPFNPLLGETFEYCRSDKHFRFLSEQVSHH 998

>Kwal_26.8561 s26 complement(839924..842077) [2154 bp, 717 aa] {ON}
           YOR206W (NOC2) -  [contig 63] FULL
          Length = 717

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 305 AAIEDLLLSLPWPPDGGRNFIQQKGTNVESITENGEQVIRQRNFENDNSYRKTWNNDWGE 364
           A +E  L+ LPW      +++Q        + E   ++IR+   E +   +KT++++  +
Sbjct: 646 AQVERFLIDLPWNKTPLGSYVQVH----REVKEEKARIIRESLAEEEEQNQKTYSDNSED 701

Query: 365 NLEDFGVDVDVE 376
           + +D   D DVE
Sbjct: 702 DHQDADSDKDVE 713

>KAFR0F03170 Chr6 complement(627907..629685) [1779 bp, 592 aa] {ON}
           Anc_4.97 YGL023C
          Length = 592

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 8/61 (13%)

Query: 53  SYALAIFTNPGRPAKSFKPLKKEWT-----HFCKKC--QLFKPERAHHCKTCNQCVLMMD 105
           SY      +   P  S +P KK W        CKKC  +    ER HHC+ C + +   D
Sbjct: 435 SYLKDYAASENEPIISIQPTKKHWVPDSQRTNCKKCGKKFTVVERKHHCRHCGE-IFCQD 493

Query: 106 H 106
           H
Sbjct: 494 H 494

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 3/30 (10%)

Query: 97  CNQCVLMMDH---HCPWTMNCVGFKNFPHF 123
           C+ C LM DH   HCP TM C    +  H+
Sbjct: 87  CSYCGLMDDHYSQHCPRTMRCSHCNDSGHY 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.469 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,532,371
Number of extensions: 2052307
Number of successful extensions: 7177
Number of sequences better than 10.0: 138
Number of HSP's gapped: 7208
Number of HSP's successfully gapped: 138
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)