Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021306.29ON1434143469120.0
KAFR0A051206.29ON1479126238160.0
NDAI0C026606.29ON1657136637860.0
KNAG0F029206.29ON1492127737200.0
SAKL0E01540g6.29ON1415125036460.0
ACL004W6.29ON1377123936430.0
CAGL0E02475g6.29ON1493125935560.0
KLTH0C10956g6.29ON1433129635130.0
ZYRO0C07524g6.29ON1670112534910.0
Kpol_1037.226.29ON1496115934500.0
TPHA0J004006.29ON1512117732400.0
KLLA0C06182g6.29ON1519111731490.0
Ecym_30336.29ON1474110431300.0
YOL004W (SIN3)6.29ON153695930610.0
Skud_15.1586.29ON155596030170.0
Suva_15.1716.29ON156195430130.0
Smik_15.1666.29ON156696030110.0
TBLA0E031606.29ON173987428600.0
Kwal_56.224626.29ON154185324270.0
CAGL0J11594g6.29ON9373666013e-63
TDEL0G044006.29ON14901024746e-47
TDEL0B071302.620ON312109890.083
Suva_1.247.32ON84963791.6
ZYRO0D04950g7.32ON77697791.7
TBLA0A056201.99ON796115782.2
KAFR0K004807.32ON82168764.3
Suva_8.2618.623ON756158754.4
Skud_2.663.325ON102563738.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02130
         (1434 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  2667   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1474   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1462   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1437   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1409   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1407   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1374   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1357   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1349   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1333   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1252   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1217   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1210   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1183   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...  1166   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1165   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1164   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1106   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...   939   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   236   3e-63
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....   187   6e-47
TDEL0B07130 Chr2 complement(1259210..1260148) [939 bp, 312 aa] {...    39   0.083
Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)    35   1.6  
ZYRO0D04950g Chr4 complement(416099..418429) [2331 bp, 776 aa] {...    35   1.7  
TBLA0A05620 Chr1 complement(1394838..1397228) [2391 bp, 796 aa] ...    35   2.2  
KAFR0K00480 Chr11 (99311..101776) [2466 bp, 821 aa] {ON} Anc_7.3...    34   4.3  
Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W ...    33   4.4  
Skud_2.66 Chr2 (130986..134063) [3078 bp, 1025 aa] {ON} YBL037W ...    33   8.7  

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 2667 bits (6912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1314/1434 (91%), Positives = 1314/1434 (91%)

Query: 1    MSNAWNQHQTESETHNVDSVNLNQVDQTAERDHIPQETNFANQEQQQTNMKAEPSSEHVI 60
            MSNAWNQHQTESETHNVDSVNLNQVDQTAERDHIPQETNFANQEQQQTNMKAEPSSEHVI
Sbjct: 1    MSNAWNQHQTESETHNVDSVNLNQVDQTAERDHIPQETNFANQEQQQTNMKAEPSSEHVI 60

Query: 61   LPSLSSIGGVQTSSENNITNPTQNQIPTTGVNTAXXXXXXXXXXXXXXXXFATPPNSTNI 120
            LPSLSSIGGVQTSSENNITNPTQNQIPTTGVNTA                FATPPNSTNI
Sbjct: 61   LPSLSSIGGVQTSSENNITNPTQNQIPTTGVNTATTSQSSSQMLPSVSSTFATPPNSTNI 120

Query: 121  TVPAQNQEQPKRNSASTGFSVASFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            TVPAQNQEQPKRNSASTGFSVASFD                                   
Sbjct: 121  TVPAQNQEQPKRNSASTGFSVASFDNPLPAVQNQQPLPVQPQPQPQPHPQPQPQPQSQQS 180

Query: 181  XXXXXXXXXXXXXXXXREQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIM 240
                            REQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIM
Sbjct: 181  QQAQQAQQAQPQPQQPREQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIM 240

Query: 241  KDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTS 300
            KDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTS
Sbjct: 241  KDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTS 300

Query: 301  TLSGGPAMEAPSSSESNLQQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEF 360
            TLSGGPAMEAPSSSESNLQQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEF
Sbjct: 301  TLSGGPAMEAPSSSESNLQQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEF 360

Query: 361  SQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFK 420
            SQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFK
Sbjct: 361  SQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFK 420

Query: 421  KFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQQNLPPIGSF 480
            KFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQ              QQNLPPIGSF
Sbjct: 421  KFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQYGYPNNYYPNGTGTQQNLPPIGSF 480

Query: 481  APPNGTASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLT 540
            APPNGTASREYAPGNQFVGPGGLPSMIPNDQAL     PGLVHGYTNEAIPVSNLRSPLT
Sbjct: 481  APPNGTASREYAPGNQFVGPGGLPSMIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLT 540

Query: 541  DQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLE 600
            DQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLE
Sbjct: 541  DQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLE 600

Query: 601  YNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELF 660
            YNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELF
Sbjct: 601  YNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELF 660

Query: 661  TWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 720
            TWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV
Sbjct: 661  TWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 720

Query: 721  LNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANK 780
            LNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANK
Sbjct: 721  LNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANK 780

Query: 781  IGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKR 840
            IGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKR
Sbjct: 781  IGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKR 840

Query: 841  LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKV 900
            LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKV
Sbjct: 841  LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKV 900

Query: 901  DQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVF 960
            DQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVF
Sbjct: 901  DQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVF 960

Query: 961  VSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIP 1020
            VSLFFSIPLDKVNEALSDRSHWLQEKEKKTKE                  KKRPLNIDIP
Sbjct: 961  VSLFFSIPLDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIP 1020

Query: 1021 LADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQDENEIILEEIKRPWLL 1080
            LADILRKHKYQKIRK                NIVGDSNEELNEQDENEIILEEIKRPWLL
Sbjct: 1021 LADILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLL 1080

Query: 1081 GNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRI 1140
            GNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRI
Sbjct: 1081 GNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRI 1140

Query: 1141 SQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAF 1200
            SQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAF
Sbjct: 1141 SQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAF 1200

Query: 1201 KLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNT 1260
            KLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNT
Sbjct: 1201 KLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNT 1260

Query: 1261 ENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKI 1320
            ENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKI
Sbjct: 1261 ENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKI 1320

Query: 1321 PFLEKTLELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPT 1380
            PFLEKTLELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPT
Sbjct: 1321 PFLEKTLELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPT 1380

Query: 1381 YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSKATGEQI 1434
            YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSKATGEQI
Sbjct: 1381 YSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSKATGEQI 1434

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1474 bits (3816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/1262 (60%), Positives = 921/1262 (72%), Gaps = 87/1262 (6%)

Query: 204  DLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRG 263
            D +YRPLNVKDALSYLEQVK QF+ RPDIYNQFLDIMKDFKSQ+IDTPGVIERVS LFRG
Sbjct: 207  DASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRG 266

Query: 264  YPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQQH 323
            YP L+QGFNTFLP GYRI+C ++P+ PI+VTTP+G+STL       +   + SNLQQQQ 
Sbjct: 267  YPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHE--MTRSVQRANSNLQQQQA 324

Query: 324  ------HQSPTIPSLAASTFQESNFQQTPQPEDQSAKNA-----EVEFSQAINYVNKIKN 372
                   Q   IP    S    +N     Q  D  AK A     +VEFSQAINYVNKIKN
Sbjct: 325  LSQNNMMQQAQIP--IGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKN 382

Query: 373  RFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTS- 431
            RFADQPDIYK FLEILQTYQREQKPINEVY+QVT+LFQ+APDLLDDFKKFLP+SS     
Sbjct: 383  RFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSSKEQQY 442

Query: 432  TSELPQNAGIQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQQNLPPIGSFAPPNGTASREY 491
            T +LPQ    Q++        +                 QQ+LPPIGSF+PP  T    +
Sbjct: 443  TGQLPQQIPNQEQLE------EFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMH 496

Query: 492  APGNQFVGPGGLPSMIPNDQALXXXXXPG---LVHGYTNEAIPVSNLRSPLTDQQYPN-- 546
               +Q      LPSM+ ++Q +     P       G +N+ IPVS++R      QYPN  
Sbjct: 497  D-QSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRM----AQYPNGA 551

Query: 547  LLNMQNQMTPGQMDINNATAPMAQQYTN-------------------------EAPIRPE 581
            + +     T  QM  + AT     Q                            EAP+RPE
Sbjct: 552  VPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELLEQQQQQYVEAPVRPE 611

Query: 582  IDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLT 641
            IDLDPSIVPV+PEPTEP+E N +L+EET+FF+KAKKFI  KQ+YTEFLK+LNL+SQDL++
Sbjct: 612  IDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLIS 671

Query: 642  TDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKL 701
             D+L  KVEYY+GS++ELF WF+NFVG+Q  P IIENIVHEKH+LDLDLCEACGPSYK+L
Sbjct: 672  VDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRL 731

Query: 702  PKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYD 761
            PK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYD
Sbjct: 732  PKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 791

Query: 762  FCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFE 821
            + IESNLRTIQTLE I NKI NM+ EEKKNFKL PGLGHTS TIYKKVIRKVYDK+RGFE
Sbjct: 792  YYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFE 851

Query: 822  IIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQA 881
            IID LHE PA+  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQA
Sbjct: 852  IIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQA 911

Query: 882  DKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINH 941
            DKKLLT KQL+SEISSIKVDQ NKRIHWLTPKPKSQL F   D +I  DIL L+  FINH
Sbjct: 912  DKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINH 971

Query: 942  SSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXX 1001
            SSTYS  +KER+ DFL+ F+SLFFS+PL+++N AL  R++  Q+  +K  +         
Sbjct: 972  SSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNN--QKNSEKVTD--------S 1021

Query: 1002 XXXXXXXXXKKRPL-NIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEE 1060
                     KKR + +I++ ++DIL + KYQK+ K                 I  +S+E 
Sbjct: 1022 ALPDGTENQKKRSIHDIELSMSDILHRTKYQKM-KLSNRGSDSQEENNIDTIIDEESDER 1080

Query: 1061 LNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYER 1120
            L E  E ++I ++ KRPWLLG+II+  +  G I++RK FN+FANTNIYVF R WT +YER
Sbjct: 1081 LAE--EADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYER 1138

Query: 1121 LYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQN 1180
            L E+K++N +VTKE+N+R+  +FA+DL L+STQLK+MGLDFV  +SY+ELL LSKRLI+N
Sbjct: 1139 LLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIEN 1198

Query: 1181 DIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSS 1240
            DIEHQWFEESLRQA+NN+AFKLYTVDKV+Q+LVKH HT++ D KT+E+M LFEKDRL S+
Sbjct: 1199 DIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSA 1258

Query: 1241 TSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYY 1300
            TSAK+QILYRLQ R+HM+NTE MFRIE+N++  ++CIQYIAL+DLT+K+  + E+ W+YY
Sbjct: 1259 TSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYY 1318

Query: 1301 VTSYSLPHPTEGVPQDELKIPFLEKTLELE--------VDEEGDNKSSPEGVSSSKLKIK 1352
            VTSYSLPHPTEG+  + L+IPFL+K LE +         + + + K SPEGVS+S  KIK
Sbjct: 1319 VTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIK 1378

Query: 1353 IDPKSYALEIEPGSFDLFSRKSMNVYPTYSDE------TKKRKSIDQMTKFLDGKNGWKK 1406
            I P +YAL+I+ GSFD+FSRKS+N YP   +E        K+K+I  +  FL+  NGWKK
Sbjct: 1379 IHPGNYALDIQTGSFDIFSRKSLNKYPVKVNEDHESLKLNKKKNI--LNTFLESNNGWKK 1436

Query: 1407 NL 1408
            +L
Sbjct: 1437 HL 1438

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1462 bits (3786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/1366 (57%), Positives = 933/1366 (68%), Gaps = 190/1366 (13%)

Query: 203  QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262
            +D  YRPLNVKDALSYLEQVK QF+ +P IYNQFLDIMKDFKSQ+IDTPGVIERVS LF+
Sbjct: 266  EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

Query: 263  GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQQ 322
            GYP+L+QGFNTFLPQGY I C+ +PD P+RVTTPMGTST +  P ++      +N+    
Sbjct: 326  GYPVLIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGTSTYTNLPNVD-----NTNV---- 376

Query: 323  HHQSPTIPSL------------------------------AASTFQESNFQQTPQPEDQS 352
               SPT+P++                              A +  QE    QTP   D  
Sbjct: 377  ---SPTLPTVQPLLQQPQPQGNNDTTNVINNAANQPQQVHAQTHLQEQTQAQTPADADAQ 433

Query: 353  AK--------------------------NAEVEFSQAINYVNKIKNRFADQPDIYKRFLE 386
            A+                          N EVEFSQAINYVNKIK R+ADQP IYK FLE
Sbjct: 434  AQAEVQAQVQAHAQAQAQAQAQMQAQNQNPEVEFSQAINYVNKIKTRYADQPFIYKHFLE 493

Query: 387  ILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAA 446
            ILQTYQRE+KPI+EVY QVTVLF  APDLL+DFKKFLPE+           N  +QQ   
Sbjct: 494  ILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKFLPETPA--------NNQPVQQ--- 542

Query: 447  IPTPNPKHQQXXXXXXXXXXXXXX--------------------QQNLPPIGSFAPPN-- 484
             P  +P+ QQ                                  QQNLPPIGSF+PP   
Sbjct: 543  -PHAHPQLQQLQPRIPSISQQQQPSQLYPFSNNGPVPSGFYQIPQQNLPPIGSFSPPTAT 601

Query: 485  ----------GTASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSN 534
                      GT    +  G        LPSM+  D                 EAIP+SN
Sbjct: 602  NANATTTPAAGTVVNNFRHG--ISMQTALPSMMTPD----------------TEAIPISN 643

Query: 535  LRS------------PLTDQQYPNLLN--------MQNQMTPGQMDINNATAPMAQQ--- 571
            LRS            P+ + Q  +           + N++ P Q  ++   +   Q    
Sbjct: 644  LRSVDGFPPSSGGVIPMPNNQTADFQYQQQQPQPPLTNRL-PDQFPLDQQQSQQQQAQQQ 702

Query: 572  -------YTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQV 624
                     +EAP RPEIDLDPSIVP+IPEPTEP+E N++LVEET+FFEK KKFI +K +
Sbjct: 703  AQQQQQQLISEAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPI 762

Query: 625  YTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKH 684
            Y EFLK+LNLYSQDLL+T+EL  +V+YY+GSN+ELF WFK FVG+ E P  IENI+HEKH
Sbjct: 763  YMEFLKVLNLYSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKH 822

Query: 685  KLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKN 744
            KLDLDLCEA GPSYKKLPKTDTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKN
Sbjct: 823  KLDLDLCEAYGPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKN 882

Query: 745  QYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSST 804
            QYEE+LFK EEERHEYDF IESNLRTIQTLETIANKI NMT EEKKNFKLP GLGHTSST
Sbjct: 883  QYEETLFKIEEERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSST 942

Query: 805  IYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQ 864
            IYKKVIRKVYDK+RGFEIID LHE PA  VP++L+RLK+KDEEWRRAQREWNKVWRELEQ
Sbjct: 943  IYKKVIRKVYDKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQ 1002

Query: 865  KVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDD 924
            KVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSI+VDQ NKRIHWLTPKPKSQL+F F+D
Sbjct: 1003 KVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFND 1062

Query: 925  NDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQ 984
            +DI VDIL L +VFI+H+STYSN EKER+KDFLRVF+ LFFSIP  ++++ LS ++    
Sbjct: 1063 HDILVDILDLANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKF 1122

Query: 985  EKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXX 1044
            EK   +                    KKR L +DIPLAD+LRK+KYQKI++         
Sbjct: 1123 EKGSSSSS---------STSNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENN 1173

Query: 1045 XXXXXXXNIVGDS---NEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNM 1101
                   +   D     ++  +++E+ +I EE+K+PWLLG++I+  S HG I NR +FN+
Sbjct: 1174 SNEYDERDEEFDEELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNL 1233

Query: 1102 FANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDF 1161
            FANTNIYVFFR WT IYERL E+KQIN+KVT+E+NSR+++ FAKDL LISTQL  MGLDF
Sbjct: 1234 FANTNIYVFFRHWTTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDF 1293

Query: 1162 VGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILG 1221
               +SY+ELL L+KRLI+NDIEHQWFEESLRQA+NNKAFKLYT DKVIQ+LVKHA++IL 
Sbjct: 1294 KTSDSYKELLNLTKRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILT 1353

Query: 1222 DVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIA 1281
            D K SEIM LFEKDRL SST+ ++QI+YRLQTR HMTNTENMFRIEFNE  NHVCIQYIA
Sbjct: 1354 DSKASEIMALFEKDRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIA 1413

Query: 1282 LEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGD----- 1336
            +EDLT+K   + ++ WEYYVTSY+LPHPTEGVPQ+ LK+PFLEK L LE++   D     
Sbjct: 1414 VEDLTLKPSPTTKETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNET 1473

Query: 1337 ------NKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSD--ETKKR 1388
                   K SPEG+S+SKLKIKID ++Y L++EPGSFD+FSRKS+N +PT +   E+  +
Sbjct: 1474 EKNEFIEKISPEGISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESSIK 1533

Query: 1389 KSIDQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSKATGEQI 1434
            +  +   KFL  K GW           IE+  KK +E    TGE I
Sbjct: 1534 EKSEAFNKFLSSKRGWNNQFKPDQVAGIEEGWKKFQE----TGEFI 1575

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1437 bits (3720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 741/1277 (58%), Positives = 917/1277 (71%), Gaps = 99/1277 (7%)

Query: 204  DLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRG 263
            D  YRPLNVKDALSYLEQVK QF+ RP IYNQFLDIMKDFKSQ+IDTPGVIERVS LF+G
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 264  YPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGT--------STLSGGPAMEAPSSSE 315
            +P L+QGFNTFLPQGYRIEC+++P+ PI+VTTPMG          T    PA+    +++
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQ 334

Query: 316  SNLQ------QQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNK 369
            S +Q      Q  H   P+  + A +  Q +N     +P+    K  +VEFSQAI+YVNK
Sbjct: 335  SPIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPK----KANDVEFSQAISYVNK 390

Query: 370  IKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGT 429
            IKNRF+DQPDIYK FLEILQTYQREQKPINEVY+QVTVLF +APDLLDDFKKFLP+SS +
Sbjct: 391  IKNRFSDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSAS 450

Query: 430  TST--SELPQNAGIQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQQNLPPIGSFAPP-NGT 486
                  + P +  +   A +      +                Q NLPPIGSF+PP NG 
Sbjct: 451  NEQQPKQSPYSPQVYSGADMAR---GYMYNNTGVYYPPQVNQPQSNLPPIGSFSPPANGV 507

Query: 487  A-----SREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLTD 541
            A     +  +A     V   G+P+M P++Q       P +++   N+ I +SN+R   T 
Sbjct: 508  APTTGTAIPHADEQHVVA--GVPAMAPHEQ----QHAPSMIN---NDGIQISNMRGGGT- 557

Query: 542  QQYPNLLNMQNQMTPGQMDINNATAPMAQQY-----------------TNEAPIRPEIDL 584
               P  LN    ++P       A      Q                  + +  +RPEIDL
Sbjct: 558  --VP-ALNQYGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDL 614

Query: 585  DPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDE 644
            DPSIVPV+PEPTEP+E N+SL EET+FFEK KK IG +Q+Y EFLK+LNL+SQDL+  DE
Sbjct: 615  DPSIVPVVPEPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDE 674

Query: 645  LCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKT 704
            L  KVE YL    ELF WFKNFVG+Q+KP IIEN++HEKH+LDLDLCEA GPSYKKLPK+
Sbjct: 675  LVTKVENYLAGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKS 734

Query: 705  DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCI 764
            DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF I
Sbjct: 735  DTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYI 794

Query: 765  ESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIID 824
            ESNLRTIQTLETIA+KI NMT EEK  FKLPPGLGHTS TIYKK+IRKVYDK+RGFEIID
Sbjct: 795  ESNLRTIQTLETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIID 854

Query: 825  LLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKK 884
             LHE PA+TVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKK
Sbjct: 855  ELHEHPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKK 914

Query: 885  LLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSST 944
            LLTTKQL+SEISSIKVDQ NKR+HWLTPKPK QL++QF+D DI  DI+GLT VF++H ST
Sbjct: 915  LLTTKQLISEISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCST 974

Query: 945  YSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXX 1004
            YSNP+KER+KD  RVF+SLFF IP D ++ AL  +S   +  + K ++            
Sbjct: 975  YSNPDKERLKDLFRVFISLFFFIPRDLISAALDTKSDEGKSTDTKFEK------------ 1022

Query: 1005 XXXXXXKKRPL-NIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNE 1063
                  KKRP  ++++ L+DIL + KYQK++                  +  D +EE   
Sbjct: 1023 --ADDSKKRPRPDVELSLSDILHRAKYQKLKN------------GEGLGMSEDDDEEKLA 1068

Query: 1064 QDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYE 1123
            ++  E+  +   +PWL+G+I+E A++HG +++R V+N+F NTN+Y+F R W+ +Y RL E
Sbjct: 1069 KEAEEMSEKNASKPWLVGDIVERANSHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLE 1128

Query: 1124 MKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIE 1183
            +KQ++E+VTKE+N+R++ QFA+DLNL+STQL+DMGLDF G N+YQE L LSKRLI+N++E
Sbjct: 1129 LKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELE 1188

Query: 1184 HQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSA 1243
            HQWFEESLRQA+NNKAFKLYTVDKV+ SLVKHAHT++ D K+SE+M LFEKDRL SST  
Sbjct: 1189 HQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCV 1248

Query: 1244 KEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTS 1303
            K+QILYRL TR+HM++TENMFR+++N++  HV IQYI L+D+T++  K   + W YY+TS
Sbjct: 1249 KDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTS 1308

Query: 1304 YSLPHPTEGVPQDELKIPFLEKTLELEVD----EEGDNKSSPEGVSSSKLKIKIDPKSYA 1359
            Y+LPHPTEG+ QD+L +PFLE+ LE E D    E G ++ +P G S SKLKI IDPK+Y 
Sbjct: 1309 YALPHPTEGIMQDKLVVPFLERILEFENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYK 1368

Query: 1360 LEIEPGSFDLFSRKSMNVYPTYSDE------TKKRKSIDQMTKFLDGKNGWKKNLTTADS 1413
            L I+ GS+D+FSR S+N YP   D        +KRK   Q  KFLDG+ GWKK+L+  D 
Sbjct: 1369 LIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEKRKETAQ--KFLDGRFGWKKDLSD-DV 1425

Query: 1414 TNIEDLVKKSRELSKAT 1430
             N  +  KK   LS+ T
Sbjct: 1426 INTVEPTKKIALLSEET 1442

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1409 bits (3646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 748/1250 (59%), Positives = 908/1250 (72%), Gaps = 110/1250 (8%)

Query: 203  QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262
            QD +YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF+
Sbjct: 154  QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 263  GYPMLVQGFNTFLPQGYRIECTTDPDGP--IRVTTPMGTS---TLSGGPAMEAPSSSES- 316
            GYP L+QGFNTFLPQGY+IEC+++P+ P  I+VTTP GT+   TL+  P  +   S+E+ 
Sbjct: 214  GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENV 273

Query: 317  -----NLQQQQHHQ----------------SPTIPSLAASTFQESNFQQTPQPEDQ---S 352
                 +LQ QQHH                           T  ++  Q  P  +DQ   +
Sbjct: 274  LLSPDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPDQQDQHYLA 333

Query: 353  AKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHA 412
             K  +VEFS AI+YVNKIK RFA+QPDIYK FLEILQTYQREQKPINEVY+QVTVLFQ+A
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 393

Query: 413  PDLLDDFKKFLPESSGTTSTSE-LPQNAGIQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQ 471
            PDLLDDFKKFLP++S   ST+   P N G     A P                      Q
Sbjct: 394  PDLLDDFKKFLPDASAPQSTTTPAPVNGGTFYPQAAP----------------------Q 431

Query: 472  QNLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLV-HGYTNEAI 530
            QNLPP+GSF+PP+  ++RE   G       GLP++ P    +       ++  G +N+ I
Sbjct: 432  QNLPPLGSFSPPSSGSARE---GEHV----GLPAVQPPSMDISGQPQQHIITQGMSNDDI 484

Query: 531  PVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVP 590
            P+S +R+   D  Y             + D+ N+      QY  E   RPEIDLDPS+VP
Sbjct: 485  PISEVRN-TADGAY-------------RSDLRNSGE---VQYM-EPVARPEIDLDPSLVP 526

Query: 591  VIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVE 650
            VIPEP EP+E  VSLVEET+FF+KAKKFIG KQ+YTEFLKILNLYSQDLL  DEL  KVE
Sbjct: 527  VIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLDRDELVEKVE 586

Query: 651  YYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPC 710
            YYLG N+ELF WFKNFVG+++KP  IENIVHEKH+LDLDLCEACGPSYKKLPK DTFMPC
Sbjct: 587  YYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKADTFMPC 646

Query: 711  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRT 770
            SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE+NLRT
Sbjct: 647  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIEANLRT 706

Query: 771  IQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEP 830
            IQTLETIANKI NMT EEK  FKL PGLGHTS TIYKKVIRKVYDKDRGFEIID LHE P
Sbjct: 707  IQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHETP 766

Query: 831  ALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ 890
            ++ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ
Sbjct: 767  SIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQ 826

Query: 891  LLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEK 950
            L+SEIS+IKVDQ NKRIH LTPKPKSQL++ F D ++  DIL L  VFI+ ++TYSNP+K
Sbjct: 827  LVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDCNTTYSNPDK 886

Query: 951  ERMKDFLRVFVSLFFSIPLDKVNEALSDRSH--WLQEKEKKTKEXXXXXXXXXXXXXXXX 1008
            E+M DFL+ F+ LFFS P+ +V  A + R     +Q+ E+ + +                
Sbjct: 887  EKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQ------------ENSD 934

Query: 1009 XXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQDENE 1068
              +KR    +  L D+LR++KYQK R                      + + + E++E E
Sbjct: 935  LSRKRTREEENLLKDVLRRNKYQKGRNFAEEEPIPEESEF--------AEKTVEEKEEEE 986

Query: 1069 IILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQIN 1128
            II +E K+PWLLG+I++ A+ HG + NRK FNMFANTNIYVFFR    +Y RL E+K IN
Sbjct: 987  IIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDIN 1046

Query: 1129 EKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFE 1188
            E VT+E+ +R++ QFAKDLNLISTQL DMGLDF G ++Y ++L LSKRLI+ DIEHQWFE
Sbjct: 1047 EAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFE 1106

Query: 1189 ESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQIL 1248
            ESLRQA+ NKAFK+YT+DKV+QSLVKHAHTI+ D KT EIM+LFEKDR C +TSAKEQIL
Sbjct: 1107 ESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQIL 1166

Query: 1249 YRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPH 1308
            YRLQ R+HMT  ENMFRIE+N +  H  IQ++A++DLT+++PKS+E  W+YYVTSYSL H
Sbjct: 1167 YRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSH 1226

Query: 1309 PTEGVPQDELKIPFLEKTLELEVDEEGDN-KSSPEGVSSSKLKIKIDPKSYALEIEPGSF 1367
            PTEG+  +EL+ PFLEK LE E + + +N + SPEGVSSS LK+KI+P++Y+L+++PGS+
Sbjct: 1227 PTEGISHEELQPPFLEKILEKEEEFQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSY 1286

Query: 1368 DLFSRKSMNVYP------TYSDETKKRKSIDQMTKFLDGKNGWKKNLTTA 1411
            D FSRKS+N +P      TY  ++K+ +    +T +L+G  GWK+ L  +
Sbjct: 1287 DFFSRKSINKFPIEINNDTY--KSKRGEKAKCLTSYLNGAKGWKRGLVAS 1334

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 348 PEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTV 407
           P+D S +   V+   A++Y+ ++K +F ++PD+Y  FL+I++ ++ +      V  +V+ 
Sbjct: 153 PQDPSYRPLNVK--DALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSN 210

Query: 408 LFQHAPDLLDDFKKFLPES 426
           LFQ  P+L+  F  FLP+ 
Sbjct: 211 LFQGYPNLIQGFNTFLPQG 229

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1407 bits (3643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1239 (58%), Positives = 886/1239 (71%), Gaps = 94/1239 (7%)

Query: 206  AYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYP 265
            AYRPLNVKDALSYLEQVK+QFS RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF GYP
Sbjct: 128  AYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYP 187

Query: 266  MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTS-----TLSGGPAMEAPSSSESNLQQ 320
             L+QGFNTFLP GY IEC +DP+ PI+VTTP GT      T +GG      +++E  LQ 
Sbjct: 188  ALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHG-ANTEPRLQS 246

Query: 321  QQHHQSPTIPSLAASTFQESNFQQTPQPEDQSA--KNAEVEFSQAINYVNKIKNRFADQP 378
             Q+   PT+   A  +        T Q +  +   K  +VEFS AI+YVNKIK RFA+QP
Sbjct: 247  TQN--VPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQP 304

Query: 379  DIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQN 438
            DIYK FLEILQTYQREQKPINEVY+QVTVLFQ+APDLLDDFKKFLP+SS        PQ 
Sbjct: 305  DIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSA-------PQL 357

Query: 439  AGIQQ-RAAIPTPNPKHQQXXXXXXXXXXX-XXXQQNLPPIGSFAPPNGTASREYAPGNQ 496
               QQ   A+  P   H Q               QQNLPP+G+F+           PG+ 
Sbjct: 358  QSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFS----------TPGDH 407

Query: 497  FVGPGGLPSMIPNDQALXXXXXPGLV-HGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMT 555
               P  LPS+   +  L       +V  G +N+ IPVS+LR                   
Sbjct: 408  H--PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLR------------------- 446

Query: 556  PGQMDINNATAPMAQ----QYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNF 611
             G  D +   +   Q    QY  E  +RPEIDLDPS+VPVIPEP +PLE  ++LVEE  F
Sbjct: 447  -GAPDASFRASEYNQVQDVQYM-EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATF 504

Query: 612  FEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQE 671
            F+KAKKFIG KQ+YTEFLKILNLYSQDLL  ++L   V +YL  + ELF WFK+FVG+QE
Sbjct: 505  FDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQE 564

Query: 672  KPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVW 731
            +P  IEN++HEKH+LDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVW
Sbjct: 565  RPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVW 624

Query: 732  ASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKN 791
            ASEDSGFIAHRKNQYE++LFK EEERHEYDF IE+NLRTIQTLETIANKI NMT EEK  
Sbjct: 625  ASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAA 684

Query: 792  FKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRA 851
            FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIID LHE PA+TVP+VLKRLKQKDEEWRRA
Sbjct: 685  FKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRA 744

Query: 852  QREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLT 911
            QREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ+NKRIH LT
Sbjct: 745  QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLT 804

Query: 912  PKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDK 971
            PK KSQL + F + ++F DIL L  VF+ +++TYS  + ER+KDF + F+SLFFS PL +
Sbjct: 805  PKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHE 864

Query: 972  VNEALSDRSHW-----LQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADILR 1026
            + E L  RS         +  +K+KE                  K+   + +  L DIL 
Sbjct: 865  IEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSAR--------KRVRDDTEHLLRDILY 916

Query: 1027 KHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQ---DENEIILEEIKRPWLLGNI 1083
            ++K QK+ K                     S+EE  ++   +E EI+ +E K+PWLLG+I
Sbjct: 917  RNKQQKVNKGPQNDQ---------------SSEEFEKESDIEEKEIVRQEAKKPWLLGSI 961

Query: 1084 IETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQF 1143
            ++ A NHG +S+R  FNMFANTNIYVFFR  T +YERL E+K+IN +VTKE+++R++ QF
Sbjct: 962  VDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQF 1021

Query: 1144 AKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLY 1203
            AKDLNLISTQL DMGLDF G ++Y+ELL LS+ LI  ++EHQWFEESLRQA+ NKAFKLY
Sbjct: 1022 AKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLY 1081

Query: 1204 TVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENM 1263
            T+DKVIQ+LVKHAHTIL D KT EIM+LF+ DR  +STS K+QILYRLQ R++M+N ENM
Sbjct: 1082 TIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENM 1141

Query: 1264 FRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFL 1323
            FRIE+N   +H  IQ++A+EDLT+ +PKS+   W+YY+TSYSL HPTEG+  D L+ PFL
Sbjct: 1142 FRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFL 1201

Query: 1324 EKTLELEVD--EEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTY 1381
            EK +E +    ++GD + SPEGV+SS +K+KIDP +Y++E+EPG  D+FSRKS+N +PT 
Sbjct: 1202 EKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTR 1261

Query: 1382 SDETKKRKSID---QMTKFLDGKNGWKKNLTTADSTNIE 1417
             D  KK+KS +    +  FL+G+ GWK+ LTT  +   E
Sbjct: 1262 VD-VKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAE 1299

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1374 bits (3556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1259 (56%), Positives = 883/1259 (70%), Gaps = 85/1259 (6%)

Query: 199  QDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVS 258
            Q Q   ++YRPLNVKDALSYLEQVK+QF  RPDIYN FLDIMKDFKSQ+IDTPGVIERVS
Sbjct: 177  QTQGDPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVS 236

Query: 259  ALFRGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTST--LSGGPAME-APSSSE 315
            +LF+GYP L+QGFNTFLPQGYRIEC+ +P+ PI+VTTPMG+ST  L+  P    +PS  +
Sbjct: 237  SLFKGYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGSSTTVLNTAPQKSPSPSDIQ 296

Query: 316  SNLQQQQHHQSPTIPSLAASTFQESNFQQ--TPQPEDQ--------SAKNAEVEFSQAIN 365
            +N QQ Q            +  QE+  Q   TP P           + K A+VEFSQAI 
Sbjct: 297  TNNQQTQ------------AIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAIT 344

Query: 366  YVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPE 425
            YVNKIK RFADQPDIYK+FLEILQTYQREQKPI+EVY+QVT+LFQ+APDLLDDFKKFLP+
Sbjct: 345  YVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPD 404

Query: 426  SSGTTS----------TSELPQNAGIQQRAAIPTPNPKHQQXX-------XXXXXXXXXX 468
            SS + S             L    G    AA    +  + Q                   
Sbjct: 405  SSASGSEETQVQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYNTQQNQ 464

Query: 469  XXQQNLPPIGSFAPP-NG---TASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHG 524
              QQNLPPIGSF+PP NG     +++ A      G   LPSM+ N +A+         H 
Sbjct: 465  HQQQNLPPIGSFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQ-AHS 523

Query: 525  --------------------YTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNA 564
                                ++N+ IPVSNLR+ + +Q Y      Q Q    Q  ++  
Sbjct: 524  RLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGG 583

Query: 565  TAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQV 624
                     +E  +RPEIDLDPS+VPV+PEPTEP+E +++L+EETNFFE+ KK IG KQ+
Sbjct: 584  YVGTP----SELVVRPEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQI 639

Query: 625  YTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKH 684
            Y EFLKILNL+S DLLT DEL  KVEYY+G+N+ELF WFK FVG+Q+KP  IENIVHEKH
Sbjct: 640  YNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKH 699

Query: 685  KLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKN 744
            KLDLDLCEA GPSYKKLPKTDTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKN
Sbjct: 700  KLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKN 759

Query: 745  QYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSST 804
            QYEE+LFK EEERHEYD+ IESNLRTIQTLETIANKI NMT+ EK  F+LPPGLGHTS T
Sbjct: 760  QYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMT 819

Query: 805  IYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQ 864
            IYKKVIRKVYDK+RGFEIID LH  PA++VP++L+RLKQKDEEWRRAQREWNK+WR+LEQ
Sbjct: 820  IYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQ 879

Query: 865  KVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDD 924
            KVY+KSLDHLGLTFKQADKKLLTTKQL+SEI+ IKVDQ +KRIHWLTPKPK+QL++ F D
Sbjct: 880  KVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPD 939

Query: 925  NDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWL- 983
             DI  DI+ L  VF  +++ YSNP+KER+KD LRVFVS FFSIPL +V++AL  R     
Sbjct: 940  YDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDD 999

Query: 984  --QEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXX 1041
               + +K + +                  KKRP + D+ ++DIL K K QK +       
Sbjct: 1000 NNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTK----MNK 1055

Query: 1042 XXXXXXXXXXNIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNM 1101
                      ++  D N    E   +   L E ++ WL+G+++++A+    + NR ++N+
Sbjct: 1056 EMDGSKSPSEDLGTDRNVGTIEDSGS---LSEHRKQWLVGDVVDSANKETPMDNRNIYNL 1112

Query: 1102 FANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDF 1161
            FANTNIY+FFR    +YERL E+KQIN+++ KE+ SRR++ FAKDL LISTQL ++GLDF
Sbjct: 1113 FANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDF 1172

Query: 1162 VGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILG 1221
               ++YQ+LL LSKRLI+ DIEHQWFEES+RQA+NN+AFKLYT+DKV+QS VKHAHT++ 
Sbjct: 1173 NSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLIS 1232

Query: 1222 DVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIA 1281
            D KTSEIM+LFE  R  + T+ K+QILYR+Q R+HM++TENMFRIE+  EK H  IQYIA
Sbjct: 1233 DSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIA 1292

Query: 1282 LEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDNKS-- 1339
            L+DLT+K  KS E+ W YYVTSYSL +PTEGVP + L++PFLEK +E + +   DN +  
Sbjct: 1293 LDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNS 1352

Query: 1340 --SPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMTK 1396
              S  G+S S L I ID + Y L ++ GS D++SR ++  YP  + +  +  +I + T+
Sbjct: 1353 TYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQ 1411

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 81/196 (41%), Gaps = 35/196 (17%)

Query: 266 MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSG----------GPAMEAPSSSE 315
           +++  F++   +  RI+ + +P GP  +TT   T    G           PA + P    
Sbjct: 61  IILPSFSSLKTEDNRIDTSMNPIGPKSITTSSSTPASVGFSVASLDNPLPPATKKPEIKL 120

Query: 316 SNLQQQQHHQSPTIPSL-------------------AASTFQESNFQQTP------QPED 350
             L QQQ  +  T                        ++   E++  Q+P      Q + 
Sbjct: 121 HPLPQQQQPRIYTQQQPQQQQILQQDQQEILQNQRQGSTGASETSTTQSPLVSGPAQTQG 180

Query: 351 QSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQ 410
                  +    A++Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 181 DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 411 HAPDLLDDFKKFLPES 426
             P+L+  F  FLP+ 
Sbjct: 241 GYPNLIQGFNTFLPQG 256

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1357 bits (3513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/1296 (55%), Positives = 891/1296 (68%), Gaps = 155/1296 (11%)

Query: 200  DQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSA 259
            +  QD +YRPLN KDALSYLEQVK+QF+ RPD+YN FLDIMKD+KSQ+IDT GVIER+S 
Sbjct: 135  EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIST 194

Query: 260  LFRGYPMLVQGFNTFLPQGYRIECTTDPDGP--IRVTTPM-------------GTSTLSG 304
            LF+GYP+L+QG NTFLPQGY+IECT +P+ P  I+VTTP              G   + G
Sbjct: 195  LFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEG 254

Query: 305  GPAMEAPSSSESNLQQQQHHQSPTIPSL--------AASTFQESNFQQTPQPEDQSAKN- 355
             P++  PS   S  +   H  +   P L          +TF     Q  PQ E Q+ ++ 
Sbjct: 255  HPSL-MPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFN----QNLPQHEQQNQQHG 309

Query: 356  ----------------------AEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQR 393
                                   +VEFS AI+YVNKIK RFADQP+IYK FLEILQTYQR
Sbjct: 310  SQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQR 369

Query: 394  EQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELP----------------- 436
            EQKPI+EVY+QVT LFQ+APDLLDDFKKFLP+++      +L                  
Sbjct: 370  EQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQQQLQQQQIQ 429

Query: 437  ------QNAG--IQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQQNLPPIGSFAPP-NGTA 487
                  QNA   + QR         HQ                QNLPP+GSF+PP NG  
Sbjct: 430  QHQSHYQNASQDLDQRQ-----QHTHQPFGNTVPFYQTQQGRPQNLPPLGSFSPPING-- 482

Query: 488  SREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLTDQQYPNL 547
             RE  P         LP++ P          P        + IP   L  PL+D +    
Sbjct: 483  -RENDPQ------LNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTL--PLSDLR---- 529

Query: 548  LNMQNQMTPGQMDINNATAPMAQQYTN--EAPIRPEIDLDPSIVPVIPEPTEPLEYNVSL 605
                     G MD N A  P+  Q     E   RPEIDLDPS+VPVIPEP +PLE +++L
Sbjct: 530  ---------GAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTL 580

Query: 606  VEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKN 665
            +EET+FF++AKK++G KQVYTEFLKILNL+SQDL+ T+EL  KVE+YLG + ELF WFK+
Sbjct: 581  IEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKS 640

Query: 666  FVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEW 725
            FV + EKP  IEN++HEKH+LDLDLCEAC PSYKKLPK DTFMPCSGRDEMCWEVLNDEW
Sbjct: 641  FVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEW 700

Query: 726  VGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMT 785
            VGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYD+ IE+NLRTIQ LETIANKI NMT
Sbjct: 701  VGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMT 760

Query: 786  NEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKD 845
             EEK+ FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIID LHE PA++VP++LKRLKQKD
Sbjct: 761  PEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKD 820

Query: 846  EEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNK 905
            EEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQTNK
Sbjct: 821  EEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNK 880

Query: 906  RIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFF 965
            RI+  TPKPKSQL++   D  +  DIL L + FI+HSSTYSNP+KE++  F + F+S+FF
Sbjct: 881  RIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFF 940

Query: 966  SIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADIL 1025
            SI   ++  +    S  +                           +KR    + PL ++L
Sbjct: 941  SISYQEIENSTPADSDAVSNSNP----------------------RKRLWESEQPLKELL 978

Query: 1026 R-KHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSN---EELNEQDENEIILEEIKRPWLLG 1081
            R KHK+ K R                 +I  D N   +   E ++ E+I +E K+PWLLG
Sbjct: 979  RSKHKHHKKRD----------TSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLG 1028

Query: 1082 NIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRIS 1141
            NI++ A++HG +SNRK+FN+FANTN+YVFFR  T +Y+RL E+K +NE+VT+E+NSR + 
Sbjct: 1029 NILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVV 1088

Query: 1142 QFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFK 1201
            QFAKDLNL+STQL DMGLDF G ++Y +LL L KRLI+ND++HQWFEESLRQA+ NKAFK
Sbjct: 1089 QFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFK 1148

Query: 1202 LYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTE 1261
            +YTVDKVIQSLVKHAH+I+ D K++EIM+LFEKDR C++TS KEQILYRLQ R++M  TE
Sbjct: 1149 IYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTE 1208

Query: 1262 NMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIP 1321
            NMFR+E N++  HVCIQY+A++DLT+K+P+S++  W YY+TSY+L HPTEG+P +E+K+P
Sbjct: 1209 NMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVP 1268

Query: 1322 FLEKTL-ELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPT 1380
            FLEKTL + E  +EG  + SP G S S L+I+++P+SY L+IEPGS D+F+R ++N +  
Sbjct: 1269 FLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLN 1328

Query: 1381 YSD-------ETKKRKSIDQMTKFLDGKNGWKKNLT 1409
             S+       + +KRK++  M++ LDG  GWKK ++
Sbjct: 1329 SSENNSNTDLKEEKRKTL--MSQ-LDGSRGWKKGMS 1361

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1349 bits (3491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1125 (61%), Positives = 830/1125 (73%), Gaps = 87/1125 (7%)

Query: 346  PQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQV 405
            PQ  DQ+ K A+VEFSQAI+YVNKIKNRF+DQPDIYK FLEILQTYQREQKPINEVY+QV
Sbjct: 508  PQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQV 567

Query: 406  TVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQXXXXXXXX- 464
            TVLFQ+APDLLDDFKKFLP+SS + +  +  Q   + Q          HQQ         
Sbjct: 568  TVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQ----------HQQAAAATGYGY 617

Query: 465  --XXXXXXQQNLPPIGSFAPP-NGTASREY--APGNQFVGPGGLPSM--IPNDQALXXXX 517
                    +QNLPP+GSF+PP NGTA R+Y   P         LP M  +    A     
Sbjct: 618  YGENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQGM----ALPPMTHLETQAAKVTPS 673

Query: 518  XPGLVHGYTNEAIPVSNLRSPLTDQ---QYPNLLNMQNQMTPGQM--------------- 559
               +  G +N+AIP+SN+RSP       Q P     Q+                      
Sbjct: 674  HYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQQYSPQQAPQPQLPQQQLPPQ 733

Query: 560  ----DINNATAPMAQ----------QYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSL 605
                 +   T P+ Q          QY + A +RPEIDLDPSIVPV+PEPTEP+E ++SL
Sbjct: 734  QQEQSLPPQTIPLTQPSQLGPQQEVQYVDIA-VRPEIDLDPSIVPVVPEPTEPIEDSLSL 792

Query: 606  VEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKN 665
            VEET+FF+KAKKFIG KQ+YTEFLKILNLYSQDLL  D L  KVE+YLG ++ELFTWFKN
Sbjct: 793  VEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTWFKN 852

Query: 666  FVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEW 725
            FVG+Q++P  IEN++HEKH+LDLD+CEA GPSYKKLPK+DTFMPCSGRDEMCWEVLNDEW
Sbjct: 853  FVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLNDEW 912

Query: 726  VGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMT 785
            +GHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIA+KI NMT
Sbjct: 913  IGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIANMT 972

Query: 786  NEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKD 845
             EEK NFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID LHE PA+ VPVVLKRLKQKD
Sbjct: 973  EEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLKQKD 1032

Query: 846  EEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNK 905
            EEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK
Sbjct: 1033 EEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNK 1092

Query: 906  RIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFF 965
            RIHWLTPKPKSQL++ F D +IF DIL LT VF+NH+  YSN +KER+KDFL+ F+SLFF
Sbjct: 1093 RIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLSLFF 1152

Query: 966  SIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADIL 1025
            SIP+ +VN+ L  RS   +E+ +  K+                   KRP  I++PL DIL
Sbjct: 1153 SIPVSEVNDGLRRRSPSNKEEHEANKK----------ENGTALAHGKRPREIELPLRDIL 1202

Query: 1026 RKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEEL----NEQDENEIILEEIKRPWLLG 1081
             ++KYQK++                   +G S E L       +E EII +E K+PWLLG
Sbjct: 1203 HRNKYQKLK----------LRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLG 1252

Query: 1082 NIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRIS 1141
            NI+E A+  G ISNRK FN+FANT+IYVFFR  T +YERL E+K I+++VT+E+NSR++S
Sbjct: 1253 NIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVS 1312

Query: 1142 QFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFK 1201
            QFAKDLNLIS QLK+MGLDF G+++Y++LL LSKRLI+ DIEHQWFEESLRQA+NN+AFK
Sbjct: 1313 QFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFK 1372

Query: 1202 LYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTE 1261
             YTVDKV+Q+LVKHAHTIL D+K SEIMVLFEKDR  ++TSAK+QILYR+Q R+HM+NTE
Sbjct: 1373 FYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTE 1432

Query: 1262 NMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIP 1321
            NMFRIEFN    HVCIQYIA++DLT+ + KS+E  W+YYVTSYSL HPTEG+  ++L++P
Sbjct: 1433 NMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVP 1492

Query: 1322 FLEKTLELEV----DEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNV 1377
            FLEK +E E     D  GD K SPEGVS S L+IKIDP++Y LE+EPGS D+FSRK++N 
Sbjct: 1493 FLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNK 1552

Query: 1378 YP----TYSDETKKRKSIDQMTKFLDGKNGWKKNLTTADSTNIED 1418
            +P    + S +TK  K  + +  +LD + GWKKNL      ++E+
Sbjct: 1553 FPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEE 1597

 Score =  186 bits (472), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 100/126 (79%)

Query: 202 FQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALF 261
             D  YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF
Sbjct: 272 LHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF 331

Query: 262 RGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQ 321
           RGYP L+QGFNTFLPQGYRI+C+ +PD PI+VTTPMG+ST++G   M   +  +    + 
Sbjct: 332 RGYPNLIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGSSTVAGVAEMNQAALFQGQQPRI 391

Query: 322 QHHQSP 327
           Q H  P
Sbjct: 392 QQHLQP 397

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 199 QDQFQDLAYRPLNVK--DALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIER 256
           Q Q  D   +  +V+   A+SY+ ++K +FS +PDIY  FL+I++ ++ +      V  +
Sbjct: 507 QPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQ 566

Query: 257 VSALFRGYPMLVQGFNTFLP 276
           V+ LF+  P L+  F  FLP
Sbjct: 567 VTVLFQNAPDLLDDFKKFLP 586

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 40/64 (62%)

Query: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPNLIQGFNTF 344

Query: 423 LPES 426
           LP+ 
Sbjct: 345 LPQG 348

 Score = 32.7 bits (73), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 7/74 (9%)

Query: 212 VKDALSYLEQVKY-----QFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266
           ++D+LS +E+  +     +F     +Y +FL I+  +    +D  G++E+V     G   
Sbjct: 786 IEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKE 845

Query: 267 LVQGFNTFLPQGYR 280
           L   F  F+  GY+
Sbjct: 846 LFTWFKNFV--GYQ 857

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1333 bits (3450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1159 (58%), Positives = 845/1159 (72%), Gaps = 113/1159 (9%)

Query: 326  SPTIPS-LAASTFQESNFQQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRF 384
            S TIP+     T   +N Q T Q E    K A+VEFSQA++YVNKIKNRFADQPDIYK F
Sbjct: 332  SSTIPAGTVPGTTVANNIQGTTQIE----KPADVEFSQAVSYVNKIKNRFADQPDIYKHF 387

Query: 385  LEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQ------- 437
            LEILQTYQREQKPI+EVY+QVTVLFQ+APDLLDDFKKFLP+SS + +T +  Q       
Sbjct: 388  LEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSSPSVTTQQPVQPQQQALP 447

Query: 438  ---------NAGIQQRAAIPTPNPKHQQXXXXXXXXXXXXXXQQNLPPIGSFAPPNGTAS 488
                     N G  Q   IP+ N                    QNLPP+G+F+PP+  A 
Sbjct: 448  QQQQPMYGVNNGYYQAGKIPSAN--------------------QNLPPLGNFSPPSNGA- 486

Query: 489  REYAPGN--QFVGPG-----GLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLTD 541
                PG   +F          LPSM+              +   TNEAIP+S+LRS + D
Sbjct: 487  ---VPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAPMTNEAIPISDLRSQIID 543

Query: 542  QQYPNLLNMQNQMTPGQM---------------DINNATAPMAQQYTNEAPIRPEIDLDP 586
                   N  +  TP ++                       +   Y  E  +RPEIDLDP
Sbjct: 544  N------NHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDP 597

Query: 587  SIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELC 646
            SIVPVIPEPTEP+E ++SLVEE NFF+KAKKFIG KQVY EFLKILNLYSQD+L+ D+L 
Sbjct: 598  SIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLI 657

Query: 647  VKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDT 706
             KV+YYLGSN+ELF WFKNFVGFQ+KP  IEN+VHEKHKLDLDLCEACGPSYKKLPKTDT
Sbjct: 658  EKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDT 717

Query: 707  FMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIES 766
            FMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IES
Sbjct: 718  FMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIES 777

Query: 767  NLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLL 826
            NLRTIQTLETIA+KI NMT EEK+ FKLP GLGHTS+TIY+KVIRKVYDK+RGFEIID L
Sbjct: 778  NLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDAL 837

Query: 827  HEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLL 886
            HE P++ VPVVLKRLKQKD+EWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQ+DKKLL
Sbjct: 838  HEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLL 897

Query: 887  TTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYS 946
            TTKQLL+EISSIKVDQTNKRIHWLTPKPKSQL+++  D  +  DIL L  VFINH+S+YS
Sbjct: 898  TTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYS 957

Query: 947  NPEKERMKDFLRVFVSLFFSIPLDKVNEALS---DRSHWLQEKEKKTKEXXXXXXXXXXX 1003
            NP+KER++DFL+ ++ LFFSIP+ ++ +A+    D    L E E+ + +           
Sbjct: 958  NPDKERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDENEQNSSK----------- 1006

Query: 1004 XXXXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNE 1063
                    KRP +++I L+DIL + +YQ+++                   +G  +   NE
Sbjct: 1007 ----KNSNKRPRDVEICLSDILNRSRYQRLKHSLDSSEAS----------LGAVSPGQNE 1052

Query: 1064 QDE-NEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLY 1122
            QD+ +E+I +E K+PWLLG+++E A++ G I NRK++NMFAN N+YVF R    IY+RL+
Sbjct: 1053 QDDMDEMIRQEAKKPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLH 1112

Query: 1123 EMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDI 1182
            E+K IN+ VTKE+N R++ QFAKDLNLIS QLK+MGLDF G +SY +LL+LSKRLI+ D+
Sbjct: 1113 EVKDINDVVTKEINGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDL 1172

Query: 1183 EHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTS 1242
            EHQWFEESLRQA+ N+AFKLYT+DKVIQSLVKHAH I+ D K+S++M LFEKDR+ SST+
Sbjct: 1173 EHQWFEESLRQAYRNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTT 1232

Query: 1243 AKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVT 1302
            +K+QILYRLQTR+HM+ TE+MFRIE+N +K+ + IQYIAL+DLT+++PK++E  W+YY+T
Sbjct: 1233 SKDQILYRLQTRSHMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYIT 1292

Query: 1303 SYSLPHPTEGVPQDELKIPFLEKTLELE---VDEEGDN-KSSPEGVSSSKLKIKIDPKSY 1358
            SYSL HPTEG+PQ+E+KIPFL+K +E E   +++E DN K SPEGVS S L IKIDP++Y
Sbjct: 1293 SYSLSHPTEGIPQEEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETY 1352

Query: 1359 ALEIEPGSFDLFSRKSMNVYP----TYSDETKKRKSIDQMTKFLDGKNGWKKNLTTADST 1414
             LE+EPGSFD+FSRKS+N +P    + S + KK+   ++   FL+GK+GWK+ L++   +
Sbjct: 1353 RLEVEPGSFDIFSRKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAIS 1412

Query: 1415 NIEDLVKKSRELSKATGEQ 1433
             IE   +K  +L   T +Q
Sbjct: 1413 KIE---QKFNDLKNGTFQQ 1428

 Score =  176 bits (446), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 88/97 (90%)

Query: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266
           YRPLNVKDAL+YLEQVK QF+ RPDIYN FLDIMKDFKSQSIDTPGVIERVS LFRGYP 
Sbjct: 121 YRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPN 180

Query: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS 303
           L+QGFNTFLPQGY IEC+++PD PI+VTTP+G+  ++
Sbjct: 181 LIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGSQIVT 217

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTF 274
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 275 LP 276
           LP
Sbjct: 426 LP 427

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%)

Query: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422
           A+ Y+ ++K +F  +PDIY  FL+I++ ++ +      V  +V+ LF+  P+L+  F  F
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTF 188

Query: 423 LPES 426
           LP+ 
Sbjct: 189 LPQG 192

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1252 bits (3240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1177 (56%), Positives = 822/1177 (69%), Gaps = 100/1177 (8%)

Query: 304  GGPAMEAPSSSESNLQQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAEVEFSQA 363
            G P+    + SES +Q   +  +P  P++   T       + P         A+VEFSQA
Sbjct: 309  GTPSHTEVTKSESVIQSSAN--APIQPNMHNMTQDTMKITEKP---------ADVEFSQA 357

Query: 364  INYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFL 423
            ++YVNKIKNRF D+PDIYK FLEILQTYQ+EQKPI+EVYSQVT+LFQ+APDLLDDFKKFL
Sbjct: 358  VSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFL 417

Query: 424  PE---SSGTTSTSELPQNAGIQQR-----AAIPTP----NPKHQQXXXXXXXXXXXXXXQ 471
            P+   S+G  +   +  NA   Q+      AIP      N  +Q                
Sbjct: 418  PDNNNSAGAETNQNIQANAMQYQQLHQNNVAIPQHIYENNTYYQNNVPTAAAAAANAAGN 477

Query: 472  ----QNLPPIGSFAPPNGTASREYAPGNQFVGPGGLPSMIPN-DQALXXXXXPGLVHGYT 526
                Q+LPP+G+F PP+   +   A  N  +G   +  M P  D              YT
Sbjct: 478  VVTIQSLPPLGNFLPPSNKNNNTTAVNNNLMGISSI--MHPKVDHIQSQQYIADQKQAYT 535

Query: 527  -----------NEAIPVSNLR-SPLTDQQYP-NLLNMQNQMTPGQMDINNATAPMA---- 569
                       NEA+ +S LR SP+ D Q   NL N+    +P +++   A   ++    
Sbjct: 536  PAQQQSTTQLTNEAMQISELRGSPMMDGQTARNLANVN--YSPAELNQLQAQQHISIQQQ 593

Query: 570  --------------------QQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEET 609
                                  Y  +  +RPEIDLDPSIVPVIPEP EP+E ++SLVEET
Sbjct: 594  QQQQQQQQQQLQMQMQMQMDGGYPQDISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEET 653

Query: 610  NFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGF 669
            NFF+KAKKFI  KQ+Y EFLKILNLYSQ++L  +EL  KV+YYLGSN+ELF WFK FVG+
Sbjct: 654  NFFDKAKKFINNKQIYMEFLKILNLYSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGY 713

Query: 670  QEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHP 729
            Q+KP  IENIVHEKHKLDLDLCEA GPSYKKLPKTDTFMPCSGRDEMCWEVLND+WVGHP
Sbjct: 714  QDKPKHIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHP 773

Query: 730  VWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEK 789
            VWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IESNLRTIQTLETIA+KI NMT EE+
Sbjct: 774  VWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIASKIANMTEEER 833

Query: 790  KNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWR 849
             NFKLP GLGHTS TIY+KVIRKVY K+RGFE+ID LHE PA+ VP++LKRLKQKDEEWR
Sbjct: 834  ANFKLPIGLGHTSVTIYQKVIRKVYGKERGFELIDALHEYPAVAVPIILKRLKQKDEEWR 893

Query: 850  RAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHW 909
            RAQREWNKVWREL+QKVYYKSLDHLGLTFKQADKKLLTTKQL+SEISSIKVDQTNK++HW
Sbjct: 894  RAQREWNKVWRELQQKVYYKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHW 953

Query: 910  LTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPL 969
            LTPKPKSQL+++  D  I  DIL LT VFINH+S YSNP+KER++DFL+ F+SLFF IPL
Sbjct: 954  LTPKPKSQLDYKVADRQILYDILKLTDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPL 1013

Query: 970  DKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPL-NIDIPLADILRKH 1028
              +  A+  RS  L + +  ++E                  KKR + + DI   DIL K 
Sbjct: 1014 ADIKAAIKIRSP-LDDTKTDSEE---------SSGDSDKFPKKRSIEDDDISFHDILDKV 1063

Query: 1029 KYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETAS 1088
            KYQK+++                ++           D++E+I +E ++PWLLG+I++ A+
Sbjct: 1064 KYQKVKQGLDKNETFSNDISSATSV-----------DDDELIRQEAQKPWLLGSIVDDAN 1112

Query: 1089 NHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLN 1148
            + G I NR  +N+F NTNIYVF R    +YERL E KQ+N +VT+E+ +R I  FAKDLN
Sbjct: 1113 SLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEEIKNRSIVPFAKDLN 1172

Query: 1149 LISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKV 1208
            L+STQLK+MGLDF G +SY++LL LS RLI+ ++EH WFEESLRQAF NKAFKLYT+DKV
Sbjct: 1173 LVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQAFRNKAFKLYTIDKV 1232

Query: 1209 IQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEF 1268
             QS+VKHAHTI+ D KT+EIM+L EKDR C++TS+K+QILYRLQ R+HM+ T+NMFRIEF
Sbjct: 1233 TQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQARSHMSTTDNMFRIEF 1292

Query: 1269 NEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLE 1328
            N+  +++ IQYI ++DLT+ +PK+ E+ W+YY+TSY+L HPTEGVPQ+E++IPFLEK LE
Sbjct: 1293 NKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVPQEEIQIPFLEKILE 1352

Query: 1329 LEVDEEG-----DNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYP--TY 1381
             E          ++K SP+GVS S LKIKI P++YALEIEPGSFD FSR SMN YP    
Sbjct: 1353 TEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDTFSRLSMNKYPIDVT 1412

Query: 1382 SDETKKRK--SIDQMTKFLDGKNGWKKNLTTADSTNI 1416
            SD+ K +K  SID++  FL+GK GWK++L+  +  NI
Sbjct: 1413 SDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNI 1449

 Score =  178 bits (451), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (90%)

Query: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266
           YRPLNVKDAL+YLEQVK QFS RPDIYN FLDIMKDFKSQSIDTPGVIERVS LFRGYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTL 302
           L+QGFNTFLPQGY IECT +P+ PI+VTTP+G+ T+
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGSETI 237

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 39/64 (60%)

Query: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422
           A+ Y+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQGFNTF 209

Query: 423 LPES 426
           LP+ 
Sbjct: 210 LPQG 213

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%)

Query: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTF 274
           A+SY+ ++K +F   PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 275 LP 276
           LP
Sbjct: 417 LP 418

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1217 bits (3149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/1117 (57%), Positives = 784/1117 (70%), Gaps = 90/1117 (8%)

Query: 354  KNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAP 413
            K  EVEFS AI+YVNKIK RFADQPDIYK+FLEILQTYQREQKPI+EVY+QVT+LFQ+ P
Sbjct: 421  KTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNP 480

Query: 414  DLLDDFKKFLPESSGTTSTSE-------------------------------LPQNAGIQ 442
            DLLDDFKKFLP+SS +    E                               LPQ+    
Sbjct: 481  DLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLPQDQN-- 538

Query: 443  QRAAIPTPNPKHQQXXXXXXX----XXXXXXXQQNLPPIGSFAPPNGTASREYAPGNQFV 498
            Q+A +P P P  QQ                    NLPP+G+F     +AS + +P     
Sbjct: 539  QQAMLP-PQPYLQQNQSMQGQGFYPQSGVLMQPTNLPPLGNF-----SASGQASPAE--- 589

Query: 499  GPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQ 558
                LPSM  +           +  G +N+ IPVS +RS + +  Y  +  +Q    PG 
Sbjct: 590  NSHMLPSMHQHIAGGHVIPQHVVTQGMSNQDIPVSEMRSTM-NGTYNQVEYIQG--APG- 645

Query: 559  MDINNATAPMAQQYTNEAPI-RPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKK 617
                    P+      EAP+ RPEIDLDPS+VPV+PEP +P E  ++L +E  FFE+ K+
Sbjct: 646  -----YPQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKR 700

Query: 618  FIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIE 677
            FIG KQVY EFLKILNLYSQDLLTT EL  KVE+YL S++ELF WFK+FVG+QEKP  IE
Sbjct: 701  FIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIE 760

Query: 678  NIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 737
            NIVHEKH+LDLDLCEACGPSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG
Sbjct: 761  NIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSG 820

Query: 738  FIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPG 797
            FIAHRKNQYE++LFK EEERHEYDF IESNLRTIQTLETIANKI NMTNEEK NFKLPPG
Sbjct: 821  FIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPG 880

Query: 798  LGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNK 857
            LGHTS TIYKKV+RKVYDKDRGFEIID LHE PA+TVP+VLKRLKQKDEEWRRAQREWNK
Sbjct: 881  LGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNK 940

Query: 858  VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQ 917
            VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH LTPKPKSQ
Sbjct: 941  VWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQ 1000

Query: 918  LEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALS 977
            L+F+ +D ++  DIL L   F+  +++YSN +K ++  F + F+SLFFS P+  VNEA+S
Sbjct: 1001 LDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVS 1060

Query: 978  DRSHWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNID--IPLADILRKHKYQKIRK 1035
            +RS  + ++E   ++                   KR L+ +    + DILR+ K  K   
Sbjct: 1061 ERSS-ITDQENGEEDSNKSDSEKS---------NKRTLSDEDSYLMKDILRRTKNAKTSN 1110

Query: 1036 XXXXXXXXXXXXXXXXNIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETASNHGTISN 1095
                                 S+ + NE+DE E++ +E  +PWLLG++I+ A+N G +S+
Sbjct: 1111 SEENQ--------------NSSSVKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSD 1156

Query: 1096 RKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLK 1155
            R +FN+F NT IYVFFR    +YERL E+K+I+ +VT E+ +R+I QFA DLNLISTQL 
Sbjct: 1157 RHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLA 1216

Query: 1156 DMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKH 1215
            DMGL F    +Y ELL LSKRLI  D++HQWFEESLRQA+ NKAFK+YT+DKV+QSLVKH
Sbjct: 1217 DMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKH 1276

Query: 1216 AHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHV 1275
            AH+I+ D K + +MVLFE+DRL   T+AK+QILYRL+ R  M  +ENMFRIE+N + +HV
Sbjct: 1277 AHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHV 1336

Query: 1276 CIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEV---- 1331
             IQY+A++DLT+K+P++M++ W+YYVTSYSL HPTEG+ Q+++  PFL K +E E     
Sbjct: 1337 SIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLD 1396

Query: 1332 DEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKSI 1391
            DEE ++K SPEGVS SKLK+ I P++Y L  E GS D+F+RKS+N +P+    ++  +  
Sbjct: 1397 DEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPS----SQSTQPA 1452

Query: 1392 DQMTKFLDGKNGWKKNLTTADSTNIEDLVKKSRELSK 1428
             +M KFL+   GWKKNL+T      E  +K  +E  K
Sbjct: 1453 SKMDKFLNSSKGWKKNLSTEIIGRAESKMKILKEQGK 1489

 Score =  176 bits (447), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 106/135 (78%), Gaps = 8/135 (5%)

Query: 201 QFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSAL 260
           Q Q  +YRPLNVKDALSYLEQVK+QFS RPD+YN FLDIMKDFKSQ+IDTPGVI+RV+ L
Sbjct: 195 QAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTL 254

Query: 261 FRGYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTST-LSGGPAME---APSSSES 316
           F+G+P L+QGFNTFLP GY+IEC+T+P+ PI+VTTP GT+  +S GP  +   AP + ++
Sbjct: 255 FQGFPNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEVSAGPPTQYQLAPVAGQN 314

Query: 317 ----NLQQQQHHQSP 327
               N++ QQ    P
Sbjct: 315 VENQNIEMQQQVSQP 329

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 10/140 (7%)

Query: 295 TPMGTSTLSGGPAM-----EAPSSSESNLQQQQH--HQSPTIPSLAASTFQESN---FQQ 344
           TP+ ++  S GP         P+ S +N+ QQ    HQ      L     Q  N     Q
Sbjct: 131 TPINSAAGSNGPVSTNSEGAIPTPSINNIVQQPDITHQQQQQQLLQGHNVQVENAMTVGQ 190

Query: 345 TPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQ 404
            P  + Q +    +    A++Y+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +
Sbjct: 191 DPLQQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQR 250

Query: 405 VTVLFQHAPDLLDDFKKFLP 424
           VT LFQ  P+L+  F  FLP
Sbjct: 251 VTTLFQGFPNLIQGFNTFLP 270

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 40/62 (64%)

Query: 215 ALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQGFNTF 274
           A+SY+ ++K +F+ +PDIY QFL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 275 LP 276
           LP
Sbjct: 490 LP 491

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 348 PEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTV 407
           PED  A   EV F + +        RF     +Y  FL+IL  Y ++    +E+ S+V  
Sbjct: 682 PEDAIALGDEVTFFERVK-------RFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEF 734

Query: 408 LFQHAPDLLDDFKKFL 423
               + +L D FK F+
Sbjct: 735 YLHSSKELFDWFKSFV 750

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1104 (57%), Positives = 777/1104 (70%), Gaps = 78/1104 (7%)

Query: 347  QPEDQ----SAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVY 402
            QP+DQ      K  +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY
Sbjct: 337  QPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 396

Query: 403  SQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNAGIQQRAAIPTPNPKHQQXXXXXX 462
            +QVTVLFQ+APDLLDDFKKFLP++S   +  +    +  Q   A+   +  H Q      
Sbjct: 397  AQVTVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHPQLNGALTPSSFYHSQQQQGPQ 456

Query: 463  XXXXXXXXQQ---------------------NLPPIGSFAPPNGTASREYAPGNQFVGPG 501
                    Q                      NLPP+GSF+           PG+    P 
Sbjct: 457  PQQDQSQSQHPVQQQQQQQQQQQQQTVIHQQNLPPLGSFS----------TPGDHH--PM 504

Query: 502  GLPSM-IPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMD 560
             LP +  PN           +  G +N+ IP+S+LR+   D  Y      Q Q T     
Sbjct: 505  NLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRT-TADTSYRPAEYSQGQDT----- 558

Query: 561  INNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIG 620
                      QY  E   RPEIDLDPS+VPVIPEP +PLE  ++LVEE +FF+KAKK+IG
Sbjct: 559  ----------QYM-ETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIG 607

Query: 621  TKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIV 680
             KQ+YTEFLKILNLYSQDLL  + L  KV +YL    ELF WFK+FVG+QEKP  IENIV
Sbjct: 608  NKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIV 667

Query: 681  HEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 740
            HEKH+LDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA
Sbjct: 668  HEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIA 727

Query: 741  HRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGH 800
            HRKNQYE++LFK EEERHEYDF IE+NLRTIQTLETIANKI NMT EEK  FKLPPGLGH
Sbjct: 728  HRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGH 787

Query: 801  TSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWR 860
            TS TIYKKVIRKVYDKDRG+EIID LHE PA+TVP+VLKRLKQKDEEWRRAQREWNKVWR
Sbjct: 788  TSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWR 847

Query: 861  ELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEF 920
            ELEQKV++KSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ NKRIH LTPK KSQL+ 
Sbjct: 848  ELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDH 907

Query: 921  QFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRS 980
             F D ++F DIL L  VF+ +++TYS P+KER+KDF + F+SLF S P+ ++ +AL+ R 
Sbjct: 908  DFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRD 967

Query: 981  HWLQEKEKKTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXX 1040
                 +   +                    + R  + D  L D+L ++K QK  +     
Sbjct: 968  AASSSQSSNSNTETYSEKQQEDGDMKLPKKRNRE-DSDRLLRDVLFRNKQQKGGRNSPR- 1025

Query: 1041 XXXXXXXXXXXNIVGDSN---EELNEQDENEIILEEIKRPWLLGNIIETASNHGTISNRK 1097
                          GDS+   E+ ++ +E EII +E K PWLLG+I++ A NHG + NRK
Sbjct: 1026 --------------GDSSISAEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRK 1071

Query: 1098 VFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDM 1157
             FN+FANTNIYVFFR    IYERL E+K++N++VTKE+ +R++ QFAKDLNLISTQL DM
Sbjct: 1072 TFNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDM 1131

Query: 1158 GLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAH 1217
            GLDF G ++Y++LL LS+ LI  D+EHQWFEESLRQA+ NKAFK+YTVDKVIQ+LVKHAH
Sbjct: 1132 GLDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAH 1191

Query: 1218 TILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCI 1277
             I+ D KT EIM+LFEKDR   STS K+QILYRLQ R++M+N ENMFRIE+N    HVCI
Sbjct: 1192 AIITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCI 1251

Query: 1278 QYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEG-- 1335
            Q++A++DLT+++PKS++  W+YY+TSYSL HPTEG+  D L+ PFLEK +E E D     
Sbjct: 1252 QFVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDK 1311

Query: 1336 DNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKKRKS--IDQ 1393
            D K SPEGV++S LK+KIDP +Y++E+E GS D+FSRK++N +P   D  KK+ S    +
Sbjct: 1312 DEKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKFPVRVDIRKKKSSELKLE 1371

Query: 1394 MTKFLDGKNGWKKNLTTADSTNIE 1417
            + +FL+  +GWKK+L+      +E
Sbjct: 1372 LERFLNSNSGWKKDLSAKQIAEVE 1395

 Score =  176 bits (446), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 88/95 (92%)

Query: 206 AYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYP 265
           +YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF+GYP
Sbjct: 159 SYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYP 218

Query: 266 MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTS 300
            L+QGFNTFLPQGY IEC++DP+ PI+VTTP GT+
Sbjct: 219 TLIQGFNTFLPQGYNIECSSDPNDPIKVTTPFGTT 253

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 2/82 (2%)

Query: 199 QDQFQDLAYRPLNVK--DALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIER 256
           QDQF     +  +V+   A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +
Sbjct: 339 QDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQ 398

Query: 257 VSALFRGYPMLVQGFNTFLPQG 278
           V+ LF+  P L+  F  FLP  
Sbjct: 399 VTVLFQNAPDLLDDFKKFLPDA 420

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 42/72 (58%)

Query: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LFQ  P L+  F  F
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTF 227

Query: 423 LPESSGTTSTSE 434
           LP+      +S+
Sbjct: 228 LPQGYNIECSSD 239

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 210 LNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPMLVQ 269
           LN+ +  S+ ++ K     +  IY +FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAKKYIGNK-QIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 270 GFNTFLPQGYR 280
            F +F+  GY+
Sbjct: 649 WFKSFV--GYQ 657

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/959 (61%), Positives = 721/959 (75%), Gaps = 47/959 (4%)

Query: 471  QQNLPPIGSFAPP-NGTASREYAPGNQFVGPGG---LPSMIPNDQALXXXXXPGLVH-GY 525
            QQNLPPIGSF+PP NG+   E     Q + P     LPS++ +         P +VH G 
Sbjct: 538  QQNLPPIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHG--------PNMVHQGI 589

Query: 526  TNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLD 585
             NE  P+S+LR+ LT+Q  P+ +  Q Q          + +P+A     + P+RPEIDLD
Sbjct: 590  ANENPPLSDLRTSLTEQYAPSSIQHQQQHP-------QSISPIANTQYGDIPVRPEIDLD 642

Query: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645
            PSIVPV+PEPTEP+E N+SL EE  FFEKAK++IG K +YTEFLKILNLYSQD+L  D+L
Sbjct: 643  PSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 702

Query: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705
              KV++YLGSN+ELFTWFKNFVG+QEK   IENIVHEKH+LDLDLCEA GPSYK+LPK+D
Sbjct: 703  VEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSD 762

Query: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765
            TFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE
Sbjct: 763  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 822

Query: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825
            SNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID 
Sbjct: 823  SNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 882

Query: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885
            LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKL
Sbjct: 883  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL 942

Query: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945
            LTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQL+F F D +IF DIL L   FI H++ Y
Sbjct: 943  LTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFYDILCLADTFITHTTAY 1002

Query: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXX 1005
            SNP+KER+KD L+ F+SLFFSI  +K+ E+L      + E                    
Sbjct: 1003 SNPDKERLKDLLKYFISLFFSISFEKIEESLYSHKQNVSESSGSDDG------------- 1049

Query: 1006 XXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQD 1065
                 +KRP   ++ L DIL + +YQK+++                 +     EE N  +
Sbjct: 1050 SSIASRKRPYQQEMSLLDILHRSRYQKLKR-------SNDEDGKVPQLSEPPEEEPNTIE 1102

Query: 1066 ENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMK 1125
            E E+I EE K PWL GN++E A++ G I NR +FN+FANTNIY+FFR WT IYERL E+K
Sbjct: 1103 EEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIK 1162

Query: 1126 QINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQ 1185
            Q+NE+VTKE+N+R    FAKDL+L+S+QL +MGLDFVG ++Y+++L LS+RLI  D+EHQ
Sbjct: 1163 QMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVLRLSRRLINGDLEHQ 1222

Query: 1186 WFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKE 1245
            WFEESLRQA+NNKAFKLYT+DKV QSLVKHAHT++ D KT+EIM LF KDR  S+TSAK+
Sbjct: 1223 WFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKD 1282

Query: 1246 QILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYS 1305
            QI+YRLQ R+HM+NTENMFRIEF++   HV IQYIAL+DLT+K+PK+ E  W+YYVTSY+
Sbjct: 1283 QIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKADEDKWKYYVTSYA 1342

Query: 1306 LPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSSPEGVSSSKLKIKIDPKSYALEI 1362
            LPHPTEG+P ++LKIPFLE+ +E   D +G   D + SPEG+S S LKIKI P +Y L I
Sbjct: 1343 LPHPTEGIPHEKLKIPFLERLIEFGQDIDGTEVDEEFSPEGISVSTLKIKIQPITYQLHI 1402

Query: 1363 EPGSFDLFSRKSMNVYPTYSDETKKRKSIDQ----MTKFLDGKNGWKKNLTTADSTNIE 1417
            E GS+D+F+RK+ N YPT +++  ++  + Q    ++KFLD   G + NL  A   +++
Sbjct: 1403 ENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAVGLRNNLDEAQKLSMQ 1461

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
            (REAL)
          Length = 1555

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/960 (60%), Positives = 719/960 (74%), Gaps = 47/960 (4%)

Query: 471  QQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGL---PSMIPNDQALXXXXXPGLVH-GY 525
            QQNLPPIGSF+PP NG+   +     Q + P  L   PSM+ +         P +VH G 
Sbjct: 556  QQNLPPIGSFSPPTNGSTVHDNYQDQQHMQPPHLVPLPSMVQHG--------PNMVHQGI 607

Query: 526  TNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLD 585
             NE +P+S+LR+ LTDQ  P+    Q Q  P       + +P+      + P+RPEIDLD
Sbjct: 608  ANENLPISDLRTSLTDQYAPSTFQQQQQNPP-------SISPITDLQYGDVPVRPEIDLD 660

Query: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645
            PSIVPV+PEPTEP+E N+SL EE  FFEKAK++IG K +YTEFLKILNLYSQD+L  D+L
Sbjct: 661  PSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 720

Query: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705
              KV++YLGSN+ELF+WFKNFVG+QEK   IENIVHEKH+LDLDLCEA GPSYK+LPK+D
Sbjct: 721  VEKVDFYLGSNKELFSWFKNFVGYQEKTKCIENIVHEKHRLDLDLCEAFGPSYKRLPKSD 780

Query: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765
            TFMPCSGRD+MCWE+LNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE
Sbjct: 781  TFMPCSGRDDMCWEILNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 840

Query: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825
            SNLRTIQ LETI NKI NMT  EK +FKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID 
Sbjct: 841  SNLRTIQCLETIVNKIENMTESEKSDFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 900

Query: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885
            LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKL
Sbjct: 901  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL 960

Query: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945
            LTTKQL+SEI+SIKVDQTNK+IHWLTPKPKSQL+F F D DIF DIL L   FI+H++ Y
Sbjct: 961  LTTKQLISEINSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFISHTTAY 1020

Query: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXX 1005
            SNP+KER+KD L+ F+SLFFSIPL+K+ +AL      + E                    
Sbjct: 1021 SNPDKERLKDLLKYFISLFFSIPLEKIEKALQFHKENVSESSGSDDG------------- 1067

Query: 1006 XXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQD 1065
                 +KRP   ++ L DIL +++YQK+++                      +EE N  +
Sbjct: 1068 GSSTSRKRPYQQEMSLLDILHRNRYQKLKRSNDEEGKIPQLSEPL-------DEESNTIE 1120

Query: 1066 ENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMK 1125
            E E+I EE + PWL GN++E A++ G I NR +FN+FANTNIY+FFR WT IYERL E+K
Sbjct: 1121 EEELISEEARNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFFRHWTTIYERLLEIK 1180

Query: 1126 QINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQ 1185
            Q+N K+TKEVN+R    FAKDL+L+S QL +MGLDF+G ++Y+++L LS+RLI  D+EHQ
Sbjct: 1181 QMNGKITKEVNTRSTVTFAKDLDLLSNQLPEMGLDFIGEDAYKQVLRLSRRLINGDLEHQ 1240

Query: 1186 WFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKE 1245
            WFEESLRQA+NNKAFKLYT+DKV QSLVKHAHT++ DVKT+EIM LF KDR   +TSAK+
Sbjct: 1241 WFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMADVKTAEIMALFVKDRNAFTTSAKD 1300

Query: 1246 QILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYS 1305
            QI+YRLQ R++M+N ENMFRIE N+   HV +QYIAL+DLT+K+PK+ E  W+YYVTSY 
Sbjct: 1301 QIIYRLQVRSYMSNIENMFRIELNKRSLHVSVQYIALDDLTLKEPKADEDKWKYYVTSYG 1360

Query: 1306 LPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSSPEGVSSSKLKIKIDPKSYALEI 1362
            LPHPTEG+  ++LKIPFLE+ +E   D +G   D + SPEG+S S L+IKI P +Y L I
Sbjct: 1361 LPHPTEGISHEKLKIPFLERLIEFGQDTDGREVDEEFSPEGISLSTLRIKIQPITYKLHI 1420

Query: 1363 EPGSFDLFSRKSMNVYPTYSDETKKRKSIDQMT----KFLDGKNGWKKNLTTADSTNIED 1418
            E GS+D+F+RK++N YPT +++   ++ + Q T    +FL+     + +L  A  + +++
Sbjct: 1421 ENGSYDVFTRKAVNKYPTIANDDVHKEMVVQKTALISRFLENAIRSRNDLNEATKSGMQE 1480

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 319 QQQQHHQSPTIPSLAASTFQESNFQQTPQPEDQSAKNAE------VEFSQAINYVNKIKN 372
           QQQ   Q P   S  AS    SN+  T    +    N E      +    A++Y+ ++K 
Sbjct: 183 QQQIQDQRPAAHSANASE-PSSNYVDTSYSVNNENSNDEDPDYRPLNVKDALSYLEQVKF 241

Query: 373 RFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPES 426
           +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+  P L+  F  FLP+ 
Sbjct: 242 QFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQG 295

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1165 bits (3013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/954 (61%), Positives = 712/954 (74%), Gaps = 55/954 (5%)

Query: 471  QQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGL---PSMIPNDQALXXXXXPGLVH-GY 525
            QQNLPPIGSF+PP NG+ + E     Q + P  L   PSM+           P +VH G 
Sbjct: 562  QQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMV--------QQGPNMVHQGI 613

Query: 526  TNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLD 585
             NE IP+S+LR+ LTDQ  P+    Q Q  P       + +P+      + P+RPEIDLD
Sbjct: 614  VNENIPLSDLRTSLTDQYAPSNFQQQQQQQP-------SISPIIDSQYGDVPVRPEIDLD 666

Query: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645
            PSIVPV+PEPTEP+E N+SL EE  FFEKAK++IG K +YTEFLKILNLYSQD+L  D+L
Sbjct: 667  PSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 726

Query: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705
              KV++YLGSN+ELF+WFKNFVG+QEK   IEN+VHEKH+LDLDLCEA GPSYK+LPK+D
Sbjct: 727  VEKVDFYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSD 786

Query: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765
            TFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE
Sbjct: 787  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 846

Query: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825
            SNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID 
Sbjct: 847  SNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 906

Query: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885
            LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKVY+KSLDHLGLTFKQADKKL
Sbjct: 907  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKL 966

Query: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945
            LTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQL+F F D DIF DIL L   FI H++ Y
Sbjct: 967  LTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAY 1026

Query: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXX 1005
            SNP+KER+KD L  F+SLFFSIPL+K+ EAL      L +                    
Sbjct: 1027 SNPDKERLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDG------------- 1073

Query: 1006 XXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELN--- 1062
                 +KRP   ++ L DIL + KYQK+++                  V   +E L+   
Sbjct: 1074 DSSTPRKRPYQQEMSLLDILHRSKYQKLKRSNDEDGK-----------VPQLSEPLDEES 1122

Query: 1063 -EQDENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERL 1121
               +E E+I EE K PWL GN++E A++ G I NR +FN+FAN+NIY+FFR WT IYERL
Sbjct: 1123 NAIEEEELINEEAKNPWLTGNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERL 1182

Query: 1122 YEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQND 1181
             E+KQ+NEKVTKE++ R +  FAKDL+L+S+QL +MGLDF G ++Y+++L LS+RLI  +
Sbjct: 1183 LEIKQMNEKVTKEISKRSMVTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGE 1242

Query: 1182 IEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSST 1241
            +EHQWFEE LRQA+NNKAFKLYT+DKVIQ LVKHAHT++ D KT+EIM LF KDR  S+T
Sbjct: 1243 LEHQWFEEGLRQAYNNKAFKLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTT 1302

Query: 1242 SAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYV 1301
            SAK+QI+YRLQ R++M+NTENMFR+EF+    HV +QYIAL+DLT+K+P++ E  W+YYV
Sbjct: 1303 SAKDQIIYRLQARSYMSNTENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYV 1362

Query: 1302 TSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSSPEGVSSSKLKIKIDPKSY 1358
            TSY+LPHPTEG+  ++LKIPFLE+ +E   D +G   D K SPEG+S S LKIKI P +Y
Sbjct: 1363 TSYALPHPTEGISHEKLKIPFLERLIEYGQDTDGREVDEKFSPEGLSVSTLKIKIQPVTY 1422

Query: 1359 ALEIEPGSFDLFSRKSMNVYPTYSDETKKR----KSIDQMTKFLDGKNGWKKNL 1408
             L IE GS+D+F+RK+ N YPT +++   +    K    ++KFLD     + +L
Sbjct: 1423 KLHIESGSYDVFTRKAANKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDL 1476

 Score =  308 bits (788), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 192/265 (72%), Gaps = 36/265 (13%)

Query: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262
           +D  YRPLNVKDALSYLEQVK+QF+ RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFR
Sbjct: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSE----SNL 318
           GYP+L+QGFNTFLPQGYRIEC+T+PD PIRVTTPMGT+T++   +  A S+ E    S+L
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNVSPPARSALEPQEPSSL 182

Query: 319 QQQ------QHHQSPTIPS------------------LAASTFQESNFQ-QTPQPEDQS- 352
            +       Q H  P +PS                  LA  +   S  Q + P P+ Q  
Sbjct: 183 PEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQPL 242

Query: 353 ------AKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVT 406
                  KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY+QVT
Sbjct: 243 TAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 302

Query: 407 VLFQHAPDLLDDFKKFLPESSGTTS 431
            LFQ+APDLL+DFKKFLP+SS + +
Sbjct: 303 HLFQNAPDLLEDFKKFLPDSSASAN 327

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/960 (60%), Positives = 720/960 (75%), Gaps = 46/960 (4%)

Query: 471  QQNLPPIGSFAPP-NGTASREYAPGNQFVGPGGL---PSMIPNDQALXXXXXPGLVH-GY 525
            QQNLPPIGSF+PP NG+   E     Q + P  L   PSM+ +           +VH G 
Sbjct: 569  QQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSMVQHGA--------NIVHQGI 620

Query: 526  TNEAIPVSNLRSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLD 585
             NE +P+S+LR+ LT+Q  P+ +  Q Q  P       + +P+A     + P+RPEIDLD
Sbjct: 621  ANENLPLSDLRTSLTEQYAPSNIQQQQQQHP------QSISPIANSQYGDVPVRPEIDLD 674

Query: 586  PSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDEL 645
            PSIVPV+PEPTEP+E N+SL EE  FFEKAK++IG K +YTEFLKILNLYSQD+L  D+L
Sbjct: 675  PSIVPVVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDL 734

Query: 646  CVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTD 705
              KV++YLGSN+ELF+WFKNFVG+QE+   IENIVHEKH+LDLDLCEA GPSYK+LPK+D
Sbjct: 735  VEKVDFYLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSD 794

Query: 706  TFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIE 765
            TFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYDF IE
Sbjct: 795  TFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIE 854

Query: 766  SNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDL 825
            SNLRTIQ LETI NKI NMT  EK NFKLPPGLGHTS TIYKKVIRKVYDK+RGFEIID 
Sbjct: 855  SNLRTIQCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDA 914

Query: 826  LHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKL 885
            LHE PA+T PVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKL
Sbjct: 915  LHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKL 974

Query: 886  LTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTY 945
            LTTKQL+SEISSIKVDQTNK+IHWLTPKPKSQL+F F D +IF DIL L   FI+H++ Y
Sbjct: 975  LTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAY 1034

Query: 946  SNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDRSHWLQEKEKKTKEXXXXXXXXXXXXX 1005
            SNP+KER+KD L+ F+SLFFSI L+++ E+L      + E                    
Sbjct: 1035 SNPDKERLKDLLKYFISLFFSISLEEIEESLQAYKQSVSESSGSDDG------------- 1081

Query: 1006 XXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXXXXXNIVGDSNEELNEQD 1065
                 +KR    ++ L DIL + +YQK+++                      +EE N  +
Sbjct: 1082 GSSVSRKRSYQQEMTLLDILHRSRYQKLKRSKDEDGKVPQLSEA-------PDEESNIIE 1134

Query: 1066 ENEIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMK 1125
            E E+I EE K PWL GN++E A++ G I NR +FN+FANTNIY+FFR WT IYERL E+K
Sbjct: 1135 EEELINEEAKNPWLTGNLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIK 1194

Query: 1126 QINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQ 1185
            Q+NEKVTKE+N+R    FAKDL+L+S QL +MGLDF+G ++Y+++L LS+RLI  D+EHQ
Sbjct: 1195 QMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQ 1254

Query: 1186 WFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKE 1245
            WFEESLRQA+NN+AFKLYT+DKV QSLVKHAHT++ D KT+EIM LF KDR  ++TSAK 
Sbjct: 1255 WFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKG 1314

Query: 1246 QILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYS 1305
            QI+YRLQ R+HM+NTENMFRIEF++   HV IQYIAL+DLT+K+PK  E  W+YYVTSY+
Sbjct: 1315 QIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYA 1374

Query: 1306 LPHPTEGVPQDELKIPFLEKTLELEVDEEG---DNKSSPEGVSSSKLKIKIDPKSYALEI 1362
            LPHPTEGV  ++LKIPFLE+ +E   D +G   D K SPEG+S S LKIKI P +Y L+I
Sbjct: 1375 LPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDI 1434

Query: 1363 EPGSFDLFSRKSMNVYPTYSDETKKRKSIDQ----MTKFLDGKNGWKKNLTTADSTNIED 1418
            E GS+D+F+RKS N YPT +++   ++ + Q    +++FLD     + +L  +   ++++
Sbjct: 1435 ENGSYDVFTRKSANKYPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQE 1494

 Score =  310 bits (793), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 163/265 (61%), Positives = 193/265 (72%), Gaps = 41/265 (15%)

Query: 207 YRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYPM 266
           YRPLNVKDALSYLEQVK+QFS RPDIYN FLDIMKDFKSQ+IDTPGVIERVS LFRGYP+
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 267 LVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLS--------GGPAMEAPSS---SE 315
           L+QGFNTFLPQGYRIEC+T+PD PIRVTTPMGT+T++        G    + PSS   ++
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 316 SNLQQQQHHQSPTIPS----------------LAASTFQESNFQQTPQP----------- 348
            N  Q+ H+  P +PS                L+A++    + QQ+  P           
Sbjct: 349 GNGTQRSHN-VPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPL 407

Query: 349 --EDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVT 406
             ++   KN +VEFSQAI+YVNKIK RFADQPDIYK FLEILQTYQREQKPINEVY+QVT
Sbjct: 408 AVQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 467

Query: 407 VLFQHAPDLLDDFKKFLPESSGTTS 431
            LFQ+APDLL+DFKKFLP+SS + +
Sbjct: 468 HLFQNAPDLLEDFKKFLPDSSASAN 492

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/874 (61%), Positives = 667/874 (76%), Gaps = 65/874 (7%)

Query: 575  EAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNL 634
            E  +RPEIDLDPS+VP++PEPT+P+E  + LVEETNFF+K KK+IG K +Y EFLK+LNL
Sbjct: 827  ENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEFLKVLNL 886

Query: 635  YSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEAC 694
            YS DLL  DEL  K++YYL  NEELF+WFKNFVG+ EKP  IENIVHEKHKLDLDLCEAC
Sbjct: 887  YSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDLDLCEAC 946

Query: 695  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTE 754
            GPSYKKLPKTDT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++   + +
Sbjct: 947  GPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKKPYLRLK 1006

Query: 755  EERHEYDFCIESNLRTIQTLETIANKIGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVY 814
            ++ HEYDF IESNLRTIQTLETIA+KI NMT  EK NFKLP GLGHT+STIYKKVIRKVY
Sbjct: 1007 KKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKKVIRKVY 1066

Query: 815  DKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 874
            DK+RGFEIID LHE PA+ VPVVLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHL
Sbjct: 1067 DKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHL 1126

Query: 875  GLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGL 934
            GLTFKQADKKLLTTKQL+SEISSIKVDQT+KR+HWLTPKPKSQL+F   D DI  DIL  
Sbjct: 1127 GLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDIIFDILSF 1186

Query: 935  TSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIPLDKVNEALSDR------SHWLQEKEK 988
              +F+ H+STYSNPEKER+ DF++ F SLFFSIPL+++ EA+S R         L++K+K
Sbjct: 1187 VEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEKLEDKQK 1246

Query: 989  KTKEXXXXXXXXXXXXXXXXXXKKRPLNIDIPLADILRKHKYQKIRKXXXXXXXXXXXXX 1048
              +E                  K+   +I + L DIL++ KYQ+++              
Sbjct: 1247 NGEE---------------NSKKRTSRDITLSLEDILQRTKYQRLK-------------- 1277

Query: 1049 XXXNIVGDSNEEL----NEQDENEIIL------EEIKRPWLLGNIIETASNHGTISNRKV 1098
                  GD ++E+    N  D+ +++       +E K+PWLLG ++E A+  G I +R +
Sbjct: 1278 -----YGDDSDEVDGHGNRHDDQKLLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNI 1332

Query: 1099 FNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMG 1158
            FNMF+NTN+Y+F R  T +YERL+E+KQ+N+KV++E++ R+IS+FAKDLNLISTQL +MG
Sbjct: 1333 FNMFSNTNMYIFIRHLTTMYERLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMG 1392

Query: 1159 LDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHT 1218
            LDF   + YQ+LLVL KRLI  D+EHQWFEESLRQAFNNKAFKLYT+DKV Q+LVKHAHT
Sbjct: 1393 LDFSEGDVYQQLLVLCKRLILGDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHT 1452

Query: 1219 ILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQ 1278
            I+ D+KT+EIM LFEKDR  +STS+K+QILYRLQTRA MT+ ENMFRIE+N    H+CIQ
Sbjct: 1453 IISDLKTTEIMALFEKDRTKNSTSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQ 1512

Query: 1279 YIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTL-------ELEV 1331
            YIAL+DLT+K  K++E+ W+YY+TSY+L HPTEG+ Q+ ++IPFLE+ +       + E 
Sbjct: 1513 YIALDDLTVKDAKTLEEKWKYYITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEET 1572

Query: 1332 DEEGDNKS----SPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSDETKK 1387
            D++   KS    SPEG+S S LKIKIDP++Y L IE GSFD+FSRKS+N +P    +  K
Sbjct: 1573 DDQKQTKSLMKYSPEGISGSTLKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSK 1632

Query: 1388 RKSIDQMT----KFLDGKNGWKKNLTTADSTNIE 1417
              ++ ++     KFL+ K GWK+ ++     +IE
Sbjct: 1633 YGTMPKLKNTVEKFLNSKMGWKRAISKDQMESIE 1666

 Score =  180 bits (456), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 103/133 (77%), Gaps = 5/133 (3%)

Query: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262
           +D  YRPLNVKDALSYLEQVK+QF+ RPD+YN FLDIMKDFKSQ+IDTPGVI RVS+LF 
Sbjct: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354

Query: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSGGPAMEAPSSSESNLQQQQ 322
            YP L+QGFNTFLPQGYRIEC+++P+ PI V TPMGT+T+SG   +E  +S   N   Q 
Sbjct: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGTTTVSG--VLE--TSVTENQNHQL 410

Query: 323 HHQSPTIPSLAAS 335
            H  P  PS  AS
Sbjct: 411 QHSLPQ-PSTTAS 422

 Score =  143 bits (360), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 95/199 (47%), Positives = 116/199 (58%), Gaps = 30/199 (15%)

Query: 354 KNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAP 413
           +  +VEFSQAI+YVNKIKNRFA+QP IYK FLEILQTYQREQKPINEVYSQVTVLFQ AP
Sbjct: 539 RTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAP 598

Query: 414 DLLDDFKKFLPESS----GTTSTSE---LPQNAGIQQRAAIPTPNPKHQQXXXXXXXXXX 466
           DLL+DFKKFLP+SS    G+  TS+        G  Q+    TP+ + Q           
Sbjct: 599 DLLEDFKKFLPDSSANNNGSIVTSQEENFMYANGFNQQQPHLTPHSEIQ----------- 647

Query: 467 XXXXQQNLPPIGSFAP-PNGT----ASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGL 521
                QNLPP+GSF+  PNG      S++  P ++F       +   +         P  
Sbjct: 648 ----AQNLPPLGSFSTQPNGVFPKQESQQIVPTSRFDANNDQLAQQQHRHQQQQQQIPQQ 703

Query: 522 VHGYTN---EAIPVSNLRS 537
              Y N   E +PVS+LRS
Sbjct: 704 STMYQNVHPEVVPVSDLRS 722

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 49/86 (56%), Gaps = 3/86 (3%)

Query: 340 SNFQQTPQPEDQSAKNAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPIN 399
           +N Q +P+ ++Q      +    A++Y+ ++K +F  +PD+Y  FL+I++ ++ +     
Sbjct: 287 NNTQDSPKEDNQYRP---LNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTP 343

Query: 400 EVYSQVTVLFQHAPDLLDDFKKFLPE 425
            V ++V+ LF   P L+  F  FLP+
Sbjct: 344 GVIARVSSLFHDYPSLIQGFNTFLPQ 369

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 5/79 (6%)

Query: 198 EQDQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERV 257
           EQ + QD+ +       A+SY+ ++K +F+ +P IY  FL+I++ ++ +      V  +V
Sbjct: 536 EQRRTQDVEF-----SQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQV 590

Query: 258 SALFRGYPMLVQGFNTFLP 276
           + LF+  P L++ F  FLP
Sbjct: 591 TVLFQEAPDLLEDFKKFLP 609

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/853 (58%), Positives = 588/853 (68%), Gaps = 115/853 (13%)

Query: 200  DQFQDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSA 259
            +  QD +YRPLN KDALSYLEQVK+QF+ RPD+YN FLDIMKD+KSQ+IDT GVIER+S 
Sbjct: 242  EHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIST 301

Query: 260  LFRGYPMLVQGFNTFLPQGYRIECTTDPDGP--IRVTTPM------------GTSTLSG- 304
            LF+GYP+L+QG NTFLPQGY+IECT++P  P  I+VTTP             G S + G 
Sbjct: 302  LFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTPFDTTRELSLDHNTGGSAVGGH 361

Query: 305  --GPAMEAPSSS-----ESNLQQQQHHQSPT-IPSLAAST-----FQESNFQQTPQPEDQ 351
              GPA  + S S     E+ + + +  ++P  +P+ AA         ES+ Q+  Q   Q
Sbjct: 362  LAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAAFAQDQVHHAESDTQREIQKSAQ 421

Query: 352  SAK------------NAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPIN 399
              +            N +VEFS AI+YVNKIK RFADQPDIYK FLEILQTYQREQKPI+
Sbjct: 422  LQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIH 481

Query: 400  EVYSQVTVLFQHAPDLLDDFKKFLPESSGT------------------------------ 429
            EVY+QVT LFQ+APDLLDDFKKFLP+++                                
Sbjct: 482  EVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLLQQQQQQQQLQHQIQLQQQQSQQ 541

Query: 430  -----TSTSELPQNAGIQQRAAIPTPNP----KHQQXXXXXXXXXXXXXXQQNLPPIGSF 480
                 +S  EL Q    QQ++  P  +P    +HQQ               QNLPP+G+F
Sbjct: 542  YQSFQSSPQELDQR---QQQSNSPFNHPASFYQHQQARA------------QNLPPLGNF 586

Query: 481  APPNGTASREYAPGNQFVGPGGLPSMIPNDQALXXXXXPGLVHGYTNEAIPVSNLRSPLT 540
            +PP      E       V P  L    P  Q+        +  G TN ++PVS++R P+ 
Sbjct: 587  SPPINGRDNEAQVNLPAVQPPAL-DFPPQQQSQSHRHV--VAQGMTNNSLPVSDMRGPVD 643

Query: 541  DQQYPNLLNMQNQMTPGQMDINNATAPMAQQYTNEAPIRPEIDLDPSIVPVIPEPTEPLE 600
                P  L  Q+                  QY  E   RPEIDLDPS+VPVIPEP  PLE
Sbjct: 644  GGFAPQPLYSQD-----------------VQYM-EPTSRPEIDLDPSLVPVIPEPIRPLE 685

Query: 601  YNVSLVEETNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELF 660
             + +L+EET+FF+KAKK++G KQVYTEFLKILNL+SQDL+ TDEL  KVE+YLG N ELF
Sbjct: 686  NDSTLIEETSFFDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELF 745

Query: 661  TWFKNFVGFQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEV 720
             WFK+FV + E+P  IEN+VHEKH+LDLDLCEAC PSYKKLPK DTFMPC GRDEMCWEV
Sbjct: 746  DWFKSFVNYVERPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEV 805

Query: 721  LNDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANK 780
            LNDEWVGHPVWASEDSGFIAHRKNQYEE+LFK EEERHEYD+ IE+NLRTIQ LETIANK
Sbjct: 806  LNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANK 865

Query: 781  IGNMTNEEKKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKR 840
            I NMT EEKK FKLPPGLGHTS+TIYKKVIRKVYDKDRGFEIID LHE PA++VP+VL+R
Sbjct: 866  ISNMTVEEKKTFKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRR 925

Query: 841  LKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKV 900
            LKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIK+
Sbjct: 926  LKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKI 985

Query: 901  DQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVF 960
            DQ NKRI+  T KPKSQL+F   D  +  DIL L   FI+HS+TYSNP+KE++  F R F
Sbjct: 986  DQANKRIYPFTSKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGF 1045

Query: 961  VSLFFSIPLDKVN 973
            +S+FFSIPL  ++
Sbjct: 1046 LSIFFSIPLTDLD 1058

 Score =  437 bits (1123), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 218/370 (58%), Positives = 283/370 (76%), Gaps = 7/370 (1%)

Query: 1068 EIILEEIKRPWLLGNIIETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQI 1127
            E +  + K+PWLLGNI++ A+NHG +SNRK +NMFANTNIYVFFR  T +Y+RL E K I
Sbjct: 1124 EAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRLSEAKNI 1183

Query: 1128 NEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWF 1187
            NE+VTKE+NSR++ QFAKDLNL STQL DMGLDF G ++Y++LL L KRLIQ+DIEHQWF
Sbjct: 1184 NEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSDIEHQWF 1243

Query: 1188 EESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQI 1247
            EESLRQA+ NKAFK+YTVDKVIQSLVKHAH+I+ D KT+EIM+LFEKDR   +TS +EQI
Sbjct: 1244 EESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTTSTREQI 1303

Query: 1248 LYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLP 1307
            LYRLQ R+ M  TENMFRIE N    HV IQ++A++DLT+ QP S++  W+YY+TSYSL 
Sbjct: 1304 LYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYLTSYSLS 1363

Query: 1308 HPTEGVPQDELKIPFLEKTLELEVDEEGDNK-SSPEGVSSSKLKIKIDPKSYALEIEPGS 1366
            HPTEGVP +E+K PFLEKTL  + D + D++  SP G S S+L+I+I+P+SYAL+IEP S
Sbjct: 1364 HPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYALQIEPNS 1423

Query: 1367 FDLFSRKSMNVYPTYSDETKKR--KSIDQ-MTKFLDGKNGWKKNL---TTADSTNIEDLV 1420
             DLF+R ++N +PT   E   R  K++ + +   ++ ++GWKK L   +   + +I + V
Sbjct: 1424 KDLFTRSTVNKHPTKIGEASGRDAKTMQKSLADMVNSEHGWKKGLQNESIGKAESIINFV 1483

Query: 1421 KKSRELSKAT 1430
            K    L KAT
Sbjct: 1484 KARGFLEKAT 1493

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  236 bits (601), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 198/366 (54%), Gaps = 23/366 (6%)

Query: 611 FFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVGFQ 670
           F    +  +  + +Y EFLK++NL++Q L+  +    +   + GS+  L T F N +   
Sbjct: 206 FLIYFRNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEY 265

Query: 671 EKPLIIENIVHEKHKLDL---------DLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVL 721
           +        +H++ K  L         D     GPSYK+L   +T   C GRD +C EVL
Sbjct: 266 KD-------IHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVL 318

Query: 722 NDEWVGHPVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKI 781
           NDEWVGHPVWASE+ GFIAH+KNQYEE+LFK EEERHEYDF + S    I         +
Sbjct: 319 NDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSL 378

Query: 782 GNMTNEEKKNFKL--PPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLK 839
               ++ ++  ++  P     + ++I +KVIR++Y  + G  +ID +   P   VP +LK
Sbjct: 379 QLSKDDGRRRNRVSSPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILK 438

Query: 840 RLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIK 899
             K+K ++W  A+ EWNK WRE+EQK YYKSLDHLGL FK A+K+ L  KQLL E  S K
Sbjct: 439 TAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEK 498

Query: 900 VDQTNKRIHWLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRV 959
            D+  K  H+       + +++F D  +  D+  +    +  +S+ S  +K         
Sbjct: 499 QDKLLKE-HY----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEA 553

Query: 960 FVSLFF 965
           F  L F
Sbjct: 554 FFDLLF 559

 Score =  126 bits (317), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 156/318 (49%), Gaps = 5/318 (1%)

Query: 1057 SNEELNEQDENEIILEEIKRPWLLGNIIETASN-HGTISNRKVFNMFANTNIYVFFRLWT 1115
            SN +++E D   + ++ I     LG      +      SNR+  N+F + NI   F    
Sbjct: 580  SNSQISEDDVEAMFMKGILEEKGLGRWFSNDTELKKEFSNRQNINIFCDINIMSLFHYIQ 639

Query: 1116 VIYERLYEMKQINEKVTKEVNS--RRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVL 1173
             +YER  ++K     + K++ +  RR S  AK L L+  QL D GL+    + Y+ +   
Sbjct: 640  TLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSDNGLELGQDDGYEWIKTT 699

Query: 1174 SKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLVKHAHTILGDVKTSEIMVLFE 1233
            SK+ +  +++HQWFEESLR  F NKA+KLYT+D+VI++++    TI       +I+ L  
Sbjct: 700  SKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPSLLQILDLLV 759

Query: 1234 KDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEFNEEKNHVCIQYIALEDLTIKQPKSM 1293
             +    +T+  +Q+ YR + R  M    +MFR+E   + N +  QYI ++DL   Q    
Sbjct: 760  DNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHAQLDKN 819

Query: 1294 EKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTLELEVDEEGDNKSSPEGVSSSKLKIKI 1353
            +     Y   Y     T+ +  D L  P+   +L L   EE +       +    L + I
Sbjct: 820  KLEHSLYCQEYLSADATKYLDTDGLNTPYY--SLNLLKREEQNIPFMNGNIYKPHLSVNI 877

Query: 1354 DPKSYALEIEPGSFDLFS 1371
            +P  Y ++I PGS D+ S
Sbjct: 878  NPLDYVVDIAPGSIDICS 895

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
           YOL004W
          Length = 1490

 Score =  187 bits (474), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 93/102 (91%)

Query: 203 QDLAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFR 262
            D  YRPLNVKDALSYLEQVKYQF+ RPD+YN FLDIMKDFKSQ+IDTPGVI+RVS LF+
Sbjct: 187 HDAYYRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

Query: 263 GYPMLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGTSTLSG 304
           GYP L+QGFNTFLPQGYRIEC+ +PD PIRVTTPMG+S+++G
Sbjct: 247 GYPGLIQGFNTFLPQGYRIECSANPDEPIRVTTPMGSSSVAG 288

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 39/64 (60%)

Query: 363 AINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKF 422
           A++Y+ ++K +F  +PD+Y  FL+I++ ++ +      V  +V+ LF+  P L+  F  F
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTF 258

Query: 423 LPES 426
           LP+ 
Sbjct: 259 LPQG 262

>TDEL0B07130 Chr2 complement(1259210..1260148) [939 bp, 312 aa] {ON}
            Anc_2.620 YMR055C
          Length = 312

 Score = 38.9 bits (89), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 47/109 (43%), Gaps = 7/109 (6%)

Query: 1322 FLEKTLELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTY 1381
            F  + L+++ DE+G+  +         + + + P  Y+   EP +F LFS    ++ PTY
Sbjct: 109  FAWQCLQIQRDEDGNGSAHQVSTYVQGMNVLMAPLLYSCPSEPMAFQLFSTLCYSLIPTY 168

Query: 1382 SDET-----KKRKSIDQMTKFLDGKNG--WKKNLTTADSTNIEDLVKKS 1423
             D          + +D   K +D K       NL TA+   I  ++  S
Sbjct: 169  LDSNLTGVHNGARLLDICLKIIDPKLSKFLSDNLLTAEIYGIPSILTLS 217

>Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)
          Length = 849

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 12/63 (19%)

Query: 616 KKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNF---VGFQEK 672
           K+F+GT++ Y   L+IL+ Y Q LL +D         L ++EEL+  F N    + FQ +
Sbjct: 282 KEFVGTERKYVHDLEILDKYRQQLLDSD---------LITSEELYMLFPNLSDAIDFQRR 332

Query: 673 PLI 675
            L+
Sbjct: 333 FLV 335

>ZYRO0D04950g Chr4 complement(416099..418429) [2331 bp, 776 aa] {ON}
           similar to gnl|GLV|KLLA0C12969g Kluyveromyces lactis
           KLLA0C12969g and some similarites with YAL041W
           uniprot|P11433 Saccharomyces cerevisiae YAL041W CDC24
           Guanine nucleotide exchange factor (GEF or GDP-release
           factor) for Cdc42p required for polarity establishment
           and maintenance and mutants have morphological defects
           in bud formation and shmooing
          Length = 776

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 16/97 (16%)

Query: 586 PSIVPVIPEPTEPLEYNVSLVEE----TNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLT 641
           P I P      E L+  +  + +    T  ++  K+F+ T++ Y   L+IL+LY Q LL 
Sbjct: 253 PEIFPSFQSVQEGLKRELHYLSQQRNTTEHYKVIKEFVTTERKYVHDLEILDLYRQQLLN 312

Query: 642 TDELCVKVEYYLGSNEELFTWFKNF---VGFQEKPLI 675
           ++         L ++EEL+  F N    + FQ + L+
Sbjct: 313 SN---------LITSEELYMLFPNLSDAIDFQRRFLV 340

>TBLA0A05620 Chr1 complement(1394838..1397228) [2391 bp, 796 aa] {ON}
            Anc_1.99 YNL258C
          Length = 796

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 18/115 (15%)

Query: 1104 NTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMG-LDFV 1162
            NT  Y F   +  +YE     K +N  V  E NS  +S      NLIS   K+   ++  
Sbjct: 670  NTRNYFFINFFQFLYEETITKKILNWNVISEKNSENLS------NLISIIWKNTEVIELQ 723

Query: 1163 GVNSYQEL----LVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKVIQSLV 1213
             +  YQEL    L++SK LI +        + + + F N  F L+T +++IQ ++
Sbjct: 724  NLKEYQELREKFLIVSKLLILH-------LKDIMEMFYNGDFYLFTTEELIQWVI 771

>KAFR0K00480 Chr11 (99311..101776) [2466 bp, 821 aa] {ON} Anc_7.32
           YAL041W
          Length = 821

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 611 FFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNF---V 667
           + +  K+F+ T++ Y   L+IL+ Y Q LL         +Y L ++EEL+  F N    +
Sbjct: 304 YIKIIKEFVATERKYVHDLEILDKYKQQLL---------DYNLITSEELYMLFPNLSEAI 354

Query: 668 GFQEKPLI 675
            FQ + LI
Sbjct: 355 DFQRRFLI 362

>Suva_8.261 Chr8 (472765..475035) [2271 bp, 756 aa] {ON} YOR208W
           (REAL)
          Length = 756

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 70/158 (44%), Gaps = 27/158 (17%)

Query: 519 PGLVHGYTNEAIPVSNL----RSPLTDQQYPNLLNMQNQMTPGQMDINNATAPMAQQY-- 572
           P  +  Y  E I +SNL      P TD   P++    +      + ++ +T P+A     
Sbjct: 39  PAQMPAYRGETINLSNLPQNSVKPCTDLDDPSIRRNNSDKRSKVLLLDLSTGPIASSSAS 98

Query: 573 -TNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEETNF-FEKA-KKFIGTKQVYTEFL 629
            TN   I          V  +P P+       +LV+ +N+ FEK  K ++G+++ Y EF+
Sbjct: 99  NTNTGDI---------TVLQLPLPS-------TLVKRSNYPFEKLLKNYLGSEEKYVEFI 142

Query: 630 KILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFV 667
           K++  Y  D+   ++   K+   L +   L   F+ F+
Sbjct: 143 KVIKAY--DVFIFNDSFSKISTCLKTTFCLIEKFQKFI 178

>Skud_2.66 Chr2 (130986..134063) [3078 bp, 1025 aa] {ON} YBL037W
            (REAL)
          Length = 1025

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 1119 ERLYEMKQINEKVTKEVNSRRISQFAKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLI 1178
            E LYE K++ EK+  EVN     Q  KDL+        + L+FVGV        L+ RL 
Sbjct: 120  ELLYEHKEVVEKINDEVN----YQLVKDLSSSDDNFVMLALNFVGVVGK-----LTNRLA 170

Query: 1179 QND 1181
             ND
Sbjct: 171  YND 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,111,079
Number of extensions: 7138145
Number of successful extensions: 23443
Number of sequences better than 10.0: 98
Number of HSP's gapped: 24247
Number of HSP's successfully gapped: 148
Length of query: 1434
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1312
Effective length of database: 39,492,147
Effective search space: 51813696864
Effective search space used: 51813696864
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)