Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D021206.30ON1221226445e-88
KAFR0A051106.30ON1221225976e-81
TDEL0G043906.30ON1221225863e-79
NDAI0C026706.30ON1221225847e-79
YOL005C (RPB11)6.30ON1201185811e-78
ZYRO0C07502g6.30ON1221225812e-78
CAGL0E02453g6.30ON1201185812e-78
Kpol_1037.216.30ON1201205786e-78
Smik_15.1656.30ON1201185776e-78
Suva_15.1696.30ON1221185777e-78
Skud_15.1576.30ON1221185777e-78
KNAG0F029106.30ON1221185691e-76
SAKL0E01562g6.30ON1221225561e-74
TBLA0E031506.30ON1181185551e-74
KLTH0C10934g6.30ON1221225394e-72
Kwal_56.224726.30ON1221225371e-71
TPHA0J004106.30ON1201195333e-71
ACL005C6.30ON1221225334e-71
KLLA0C06160g6.30ON1211185101e-67
TPHA0B029202.163ON1301061299e-10
CAGL0L03872g2.163ON137921221e-08
TBLA0B012902.163ON102861163e-08
Kpol_165.22.163ON128921166e-08
KAFR0B045702.163ON131911141e-07
KNAG0I020602.163ON134901114e-07
Ecym_54232.163ON127901097e-07
YNL113W (RPC19)2.163ON1421021099e-07
Smik_14.2142.163ON1421021072e-06
Skud_14.2182.163ON1561041082e-06
TDEL0F011802.163ON129901062e-06
Suva_14.2252.163ON1421041062e-06
AFL220C2.163ON135901044e-06
ZYRO0B09878g2.163ON130901027e-06
NCAS0G025502.163ON1501041029e-06
SAKL0E10692g2.163ON1311021001e-05
NDAI0F027502.163ON14969974e-05
KLTH0D09350g2.163ON14669975e-05
KLLA0F23760g2.163ON12768931e-04
Kwal_26.84732.163ON15043932e-04
YHL030W (ECM29)4.15ON186863651.9
TBLA0J007305.604ON72687652.1
CAGL0L07810g1.423ON59649642.2
KNAG0B026007.353ON27998632.9
ZYRO0C14784g6.144ON41473633.3
Smik_6.288.2ON44443633.7
NCAS0C058604.15ON1868113633.8
ZYRO0E04246g1.423ON60649634.0
KAFR0A043008.758ON145296625.7
Smik_8.114.15ON186937616.1
TPHA0B015207.441ON115070616.1
Kwal_23.58927.257ON67859616.7
NCAS0D007202.311ON107734609.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02120
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   252   5e-88
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   234   6e-81
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   230   3e-79
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   229   7e-79
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   228   1e-78
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   228   2e-78
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   228   2e-78
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   227   6e-78
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   226   6e-78
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   226   7e-78
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   226   7e-78
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   223   1e-76
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   218   1e-74
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   218   1e-74
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   212   4e-72
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   211   1e-71
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   209   3e-71
ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   209   4e-71
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   201   1e-67
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    54   9e-10
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    52   1e-08
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    49   3e-08
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    49   6e-08
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    49   1e-07
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    47   4e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    47   7e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    47   9e-07
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    46   2e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    46   2e-06
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    45   2e-06
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    45   2e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    45   4e-06
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    44   7e-06
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    44   9e-06
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    43   1e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    42   4e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    42   5e-05
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    40   1e-04
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    40   2e-04
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    30   1.9  
TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5....    30   2.1  
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    29   2.2  
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...    29   2.9  
ZYRO0C14784g Chr3 (1149822..1151066) [1245 bp, 414 aa] {ON} simi...    29   3.3  
Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON} Y...    29   3.7  
NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]...    29   3.8  
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    29   4.0  
KAFR0A04300 Chr1 (853102..857460) [4359 bp, 1452 aa] {ON} Anc_8....    28   5.7  
Smik_8.11 Chr8 (23753..29362) [5610 bp, 1869 aa] {ON} YHL030W (R...    28   6.1  
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    28   6.1  
Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL06...    28   6.7  
NCAS0D00720 Chr4 (125029..128262) [3234 bp, 1077 aa] {ON} Anc_2....    28   9.8  

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  252 bits (644), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  234 bits (597), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 120/122 (98%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+IDPDTK+PNAVVITFEKEDHTLGNLIR+ELLND++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHPFFARFKLR+QT+EGYDPK+ALKNACNSII+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  230 bits (586), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 109/122 (89%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+I+PDTKAPNAVVITFEKEDHTLGNLIRSELLND++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN II+KL VLK NFETEWNLQTLA+D+N 
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  229 bits (584), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 110/122 (90%), Positives = 116/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL IDPDTKAPNAVVITF+KEDHTLGNLIRSELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHPFFA FKLRIQTVEGYDPK ALKNACN+II+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  228 bits (581), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+IDPDTKAPNAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQT EGYDPKDALKNACNSII+KLG LK NFETEWNLQTLAAD+
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 117/122 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL++DPDTKAPNA+V+TFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FARFK+RIQT+EGYDPKDALKNACN II+KLGVLK NFETEWNLQTLA+D+N 
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 GI 122
           GI
Sbjct: 121 GI 122

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  228 bits (581), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 108/118 (91%), Positives = 116/118 (98%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+IDPDTKAPNAVVITFEKEDHTLGNLIR+ELLND++VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQTVEGYDPKDAL+NAC+SII+KLG LK NFETEWNLQTLAAD+
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADD 118

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  227 bits (578), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 115/120 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPD+FELFLLGEGESKL I+PDTKAPNAVVITFEKEDHTLGNLIRSELLNDS+VLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FARFKLRIQTVE YDPKDALKNACN+II+KLG+LK NFETEWNLQTLA+DEN 
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  226 bits (577), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 108/118 (91%), Positives = 113/118 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+IDPDTKAPNAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQT EGYDPKDALKNACNSII+KLG LK NFETEWNLQTLA D+
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDD 118

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  226 bits (577), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 108/118 (91%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQT EGYDPKDALKNACNSII+KLG LK NFETEWNLQTLAAD+
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  226 bits (577), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 108/118 (91%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLGEGESKL+I+PDTKAPNAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQT EGYDPKDALKNACNSII+KLG LK NFETEWNLQTLAAD+
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADD 118

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  223 bits (569), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 105/118 (88%), Positives = 113/118 (95%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLLG+GESKL IDPDTK+PNA+VITF KEDHTLGNLIR+ELLNDS+VLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHPFFARFKLRIQTVEGYDPKDALKNACN II+KLG+LK NFETEWNLQTLA D+
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDD 118

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  218 bits (556), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKAPNAV+ITFEKEDHTLGNLIR+ELL D RVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FARFK+RIQTVEGYDPKDALKNACN+II+KL  L+ NFETEW+LQTLA++EN 
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 GI 122
           G+
Sbjct: 121 GL 122

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  218 bits (555), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFE FLLGEGESKLQI+PDTKAPN VVITFEKEDHTLGNLI+SELL+D +VLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHP FARFK+RIQTVEGYDPKDAL+ ACNSII KLG+LK NFETEWNLQTLA+D+
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  212 bits (539), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 110/122 (90%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EGE+KL+IDPDTKAPNAV++TFEKEDHTL NLIR ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FA+FKLRIQTVEGYDPKDALKNACN IISKLG L+ NFETEWNLQTLA+++N 
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  211 bits (537), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 110/122 (90%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EGE+KL+IDPDTKAPNAV++TFEKEDHTL NLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FA+FK+RIQT EGYDPKDALKNACN IISKLG L+ NFETEWNLQTLA+++N 
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 GI 122
            +
Sbjct: 121 AM 122

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  209 bits (533), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EG+SKLQI+ DTKA NAVVITFEKEDHTLGNLIR+ELLND +VLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADEN 119
           YKVEHP FARFKLRIQT E YDPKDALK ACN+II+KLG+LK NF+TEWNLQTLA+D+N
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDN 119

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  209 bits (533), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 110/122 (90%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EGESKL+I+PDTKA NAV+ITFEKEDHTLGN+IR+ELL D RVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSII+KL  LK NFETEWNLQTLA+++  
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 GI 122
            +
Sbjct: 121 RL 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  201 bits (510), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 93/118 (78%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60
           MNAPDRFELFLL EGESKL+++ DTKA +A+++TFEKEDHTLGNLIR+ELL D  VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADE 118
           YKVEHP FA+FK+RIQTVEGYDPKDALKNACNSII+KL  L+ NFETEWNLQTLA ++
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 54.3 bits (129), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 2   NAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFA 59
           + P+  E+ +    E K++I P+  +P+    +F+  +EDHTLGN +R  ++ +  V F 
Sbjct: 18  SVPEVDEVDVNAVDEDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFC 77

Query: 60  AYKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            Y + HP      LRIQT       +AL+     ++    V++  F
Sbjct: 78  GYSIPHPSETLLNLRIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 51.6 bits (122), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 2/92 (2%)

Query: 16  ESKLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKL 73
           ++K+++ P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      L
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           RIQT       DAL+   + +I     +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%)

Query: 20  QIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVE 79
           Q+ P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      LR+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKDALKNACNSIISKLGVLKGNF 105
                DAL      ++    V++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 16  ESKLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKL 73
           E K++I P   + +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      L
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           RIQT       +AL+     ++    V++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 17  SKLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLR 74
           +K++I P   + +    +F+  +EDHTLGN +R  ++ + +V F  Y + HP      +R
Sbjct: 34  NKIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIR 93

Query: 75  IQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           IQT       DALK     ++    V++  F
Sbjct: 94  IQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 47.4 bits (111), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRI 75
           K++I P+    +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           QT       DA K     ++    V++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRI 75
           K+++ P+  + +    +F+   EDHTLGN +R  ++ +  V F  Y + HP      LRI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           QT       +AL      ++    V++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 46.6 bits (109), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKV 63
           PDR ++ LL +  S    +  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            HP      +RIQT       DAL+     ++    V++  F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKV 63
           PDR ++ LL +  S    +  T A   +V    +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 42  PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            HP      +RIQT       DAL+     ++    V++  F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAY 61
           + PDR ++ LL +  S    +  T A   +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            + HP      +RIQT       DAL+     ++    V++  F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 2/90 (2%)

Query: 18  KLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRI 75
           K+++ P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      LRI
Sbjct: 33  KIKLLPQASSEDGTCASFQIAEEDHTLGNALRYVIMKNKDVEFCGYSIPHPSENLLNLRI 92

Query: 76  QTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           QT       D L+     ++     ++  F
Sbjct: 93  QTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAY 61
           + PDR ++ LL +  S    +  T A   +V    +EDHTLGN +R  ++ +  V F  Y
Sbjct: 40  DEPDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            + HP      +RIQT       +AL+     ++    V++  F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 18  KLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRI 75
           K+++ P   + +     F+   EDHTLGN +R  ++ +  V F  Y + HP      +RI
Sbjct: 39  KIRLLPQATSEDGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRI 98

Query: 76  QTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           QT       DAL      ++    V++  F
Sbjct: 99  QTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {ON}
           highly similar to uniprot|Q755Q7 Ashbya gossypii AFL220C
           AFL220Cp and similar to YNL113W uniprot|P28000
           Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
           subunit common to RNA polymerases I and III
          Length = 130

 Score = 43.9 bits (102), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 2/90 (2%)

Query: 18  KLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRI 75
           K++I P   + +    +F+  +EDHTLGN +R  ++ +  V F  Y + HP      +R+
Sbjct: 34  KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76  QTVEGYDPKDALKNACNSIISKLGVLKGNF 105
           QT       D L      ++     ++  F
Sbjct: 94  QTYGNVTAVDVLHKGLQDLMDLCDAVEDKF 123

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 43.9 bits (102), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 4   PDRFELFLLGEGESKLQIDPDTKAPNAVVITFE--KEDHTLGNLIRSELLNDSRVLFAAY 61
           PDR ++ +L EG S+          +    +F+   EDHTLGN +R  ++ +  V F  Y
Sbjct: 50  PDREKVKILPEGASE----------DGTCASFQIVDEDHTLGNALRYIIMKNPNVEFCGY 99

Query: 62  KVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            + HP      +RIQT       +A +     ++    V++  F
Sbjct: 100 SIPHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKV 63
           PDR ++ LL +  S    D  T A         +EDHTLGN +R  ++ +  V F  Y +
Sbjct: 31  PDREKIKLLPQATS----DDGTSAS----FQISEEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNF 105
            HP      +RIQT       +AL+     ++     ++  F
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 42.0 bits (97), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%)

Query: 37  KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIIS 96
           +EDHTLGN +R  ++ + +V F  Y + HP      +RIQT       +AL      ++ 
Sbjct: 74  QEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRIQTYGEITAVEALHKGLQDLMD 133

Query: 97  KLGVLKGNF 105
              V++  F
Sbjct: 134 LCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%)

Query: 37  KEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIIS 96
           +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT   +   + L+     ++ 
Sbjct: 71  EEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDLMD 130

Query: 97  KLGVLKGNF 105
               ++  F
Sbjct: 131 LCDAVEDKF 139

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%)

Query: 38  EDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISK 97
           EDHTLGN +R  ++ +  V F  Y + HP      +RIQT       +AL      ++  
Sbjct: 53  EDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQTYGKITAVEALHKGLGDLMDM 112

Query: 98  LGVLKGNF 105
              ++  F
Sbjct: 113 CDAVEDRF 120

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%)

Query: 35  FEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQT 77
             +EDHTLGN +R  ++ +  V F  Y + HP      LRIQT
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQT 115

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 29.6 bits (65), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 11  LLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRS--ELLND---SRVLFAAYKVEH 65
           L  EG  KLQ+ P T A N  ++  + +  TLG++++   EL++D      LF + K + 
Sbjct: 397 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDL 456

Query: 66  PFF 68
           P F
Sbjct: 457 PQF 459

>TBLA0J00730 Chr10 (169980..172160) [2181 bp, 726 aa] {ON} Anc_5.604
           YOR022C
          Length = 726

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 40  HTLGNLIRSELLNDSRVLFAAYKVEHPFF-----ARFKLRIQTVEGYDPKDALKNACNSI 94
           H+LGNLI  +LLN+++     +KV + F        FKL  +T       D + N     
Sbjct: 499 HSLGNLILFDLLNNTKKYSLNFKVGNYFCLGSPAGVFKLIQRT-----NIDGINNKAGKE 553

Query: 95  ISKLGVLKGNFETE---WNLQTLAADE 118
           + K   LK  ++ E   W  QTL   E
Sbjct: 554 LGKRKKLKQKYQLEIDNWQTQTLPCKE 580

>CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa]
           {ON} similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008w SAT4 serine/threonine-specific protein kinase
          Length = 596

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 51  LNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNA-CNSIISKL 98
           +   R L+ A K + PF+ ++    +   GY+P ++LK A C ++I  +
Sbjct: 497 MRTGRQLWTAAKKDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVIYSM 545

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score = 28.9 bits (63), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 7/98 (7%)

Query: 22  DPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGY 81
           DPD K  N +  T      T G L+ S  LN+S V  AA ++       +  R      +
Sbjct: 51  DPDHKIMNPLFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQ----HWDYRENFPNEF 106

Query: 82  DPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADEN 119
           DP    +    SI+ +L +++ N     N   ++ DEN
Sbjct: 107 DPASDTREDTKSIVLRLPIVELN---GMNTLLISVDEN 141

>ZYRO0C14784g Chr3 (1149822..1151066) [1245 bp, 414 aa] {ON} similar
           to uniprot|P53136 Saccharomyces cerevisiae YGL111W NSA1
           Constituent of 66S pre-ribosomal particles involved in
           60S ribosomal subunit biogenesis
          Length = 414

 Score = 28.9 bits (63), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 10/73 (13%)

Query: 29  NAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALK 88
           N  ++ FE E++ L + I S+LL+DSR+         PF+A+ K R++  + +     L+
Sbjct: 65  NVELVHFE-EEYELKDKI-SDLLDDSRL--------EPFYAKSKSRVKLRDAFIMLQPLR 114

Query: 89  NACNSIISKLGVL 101
           N    +++K G++
Sbjct: 115 NGHFLVVTKSGLV 127

>Smik_6.28 Chr6 complement(54289..55623) [1335 bp, 444 aa] {ON}
           YFL048C (REAL)
          Length = 444

 Score = 28.9 bits (63), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%), Gaps = 5/43 (11%)

Query: 24  DTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHP 66
           D+  P+ + +T++ ED+   NL++ ++  D+RV F   KV  P
Sbjct: 184 DSSVPSTIRVTYDMEDN---NLLKVQV--DNRVCFQTRKVRFP 221

>NCAS0C05860 Chr3 complement(1204693..1210299) [5607 bp, 1868 aa]
           {ON} Anc_4.15 YHL030W
          Length = 1868

 Score = 28.9 bits (63), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 6/113 (5%)

Query: 11  LLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSE--LLNDSRVLFAAYKVEHPFF 68
           L  EG  KLQ+   T A N  ++    +  TLG+++  E  L+ D   +   +       
Sbjct: 391 LHAEGWPKLQLGESTPAFNTTILQRRLQYETLGDILMKEFSLVEDLSFIEFLFDSLQGDL 450

Query: 69  ARFKLRIQ-TVEGYDPKDALKNACNSIISKL-GVLKGNFETEWNLQTLAADEN 119
           + F+  IQ  +    P   L+   +S   KL G+LK     ++NLQ  ++D+N
Sbjct: 451 SEFRASIQEALISLTPH--LRKLPSSSKDKLKGILKNLLSDDFNLQEASSDQN 501

>ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {ON}
           similar to uniprot|P25333 Saccharomyces cerevisiae
           YCR008W
          Length = 606

 Score = 28.9 bits (63), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 51  LNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNA-CNSIISKL 98
           +   R L+   + E PFFA++  + +   G++P + LK A C ++I  +
Sbjct: 525 MRTGRQLWKVAQKEDPFFAKYLRKRKEKGGFEPIENLKRARCRNVIYSM 573

>KAFR0A04300 Chr1 (853102..857460) [4359 bp, 1452 aa] {ON} Anc_8.758
           YOR291W
          Length = 1452

 Score = 28.5 bits (62), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 14/96 (14%)

Query: 21  IDPDTKAPNAV---VITFEKEDHTLG---NLIRSELLNDSRVLFAAYKVEHPF--FARFK 72
           IDPD    +AV   + +  +ED  L    N I  ++ + S++LF   ++ HPF  F  F 
Sbjct: 438 IDPDWLDLSAVYRGLPSAIQEDRILAFDKNQINLKVKSTSQILFD--EILHPFYIFQIFS 495

Query: 73  LRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETE 108
           + + +++ Y        AC  +IS L +L+  FET+
Sbjct: 496 IILWSLDEY----YYYAACIFVISMLSILQSLFETK 527

>Smik_8.11 Chr8 (23753..29362) [5610 bp, 1869 aa] {ON} YHL030W
           (REAL)
          Length = 1869

 Score = 28.1 bits (61), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 11  LLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIR 47
           L  EG  KLQ+ P T A N  ++  + +  TLG++++
Sbjct: 398 LHAEGWPKLQLGPQTPAFNTAILQRQLQYETLGDILK 434

>TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {ON}
           Anc_7.441 YBL105C
          Length = 1150

 Score = 28.1 bits (61), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 28/70 (40%), Gaps = 1/70 (1%)

Query: 9   LFLLGEGE-SKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAAYKVEHPF 67
           L +LG+G   K+ +           I   K+DH + N   +    + +V   A K +HPF
Sbjct: 826 LKVLGKGNFGKVLLSKSKNTGRVCAIKVLKKDHIIQNHDIASARAEKKVFLLATKTKHPF 885

Query: 68  FARFKLRIQT 77
                   QT
Sbjct: 886 LTNLYCSFQT 895

>Kwal_23.5892 s23 (1358818..1360854) [2037 bp, 678 aa] {ON} YIL067C
           - Hypothetical ORF [contig 11] FULL
          Length = 678

 Score = 28.1 bits (61), Expect = 6.7,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 41  TLGNLIRSELLNDSRVLFAAYKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLG 99
           T G+L+R E  N  +    AY  EHP    +++   T + ++  DA     N I   +G
Sbjct: 547 TRGSLLRGEAGNSWKPPVLAYNQEHPHLLNWQVTNSTEKSFEKLDAYSLLINDIERYVG 605

>NCAS0D00720 Chr4 (125029..128262) [3234 bp, 1077 aa] {ON} Anc_2.311
           YGL156W
          Length = 1077

 Score = 27.7 bits (60), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 89  NACNSIISKL-GVLKGNFETEWNLQTLAADENMG 121
           N C++++  +  VLKGN E+   + TL+  EN+G
Sbjct: 652 NECDNLLEHIQTVLKGNTESSLTVSTLSWQENLG 685

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,020,232
Number of extensions: 490657
Number of successful extensions: 1380
Number of sequences better than 10.0: 56
Number of HSP's gapped: 1379
Number of HSP's successfully gapped: 56
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)