Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D02110singletonON31731716580.0
NCAS0F03690singletonON37431812551e-174
NCAS0F03700singletonON36731212301e-170
NCAS0J02030singletonON35729711501e-158
NCAS0J01960singletonON35829711461e-157
NCAS0F01690singletonON1651594368e-53
NCAS0F01700singletonON170742574e-26
NCAS0G03840singletonON3582631937e-16
NCAS0I02590singletonON365122950.002
NCAS0E04200singletonON36672750.56
Smik_2.2683.389ON34482711.8
KLLA0C09801g8.699ON588121685.1
Kpol_1053.23.231ON54482685.3
NDAI0F034102.69ON87042686.1
Ecym_46537.442ON101130676.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02110
         (317 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02110 Chr4 (389995..390948) [954 bp, 317 aa] {ON}               643   0.0  
NCAS0F03690 Chr6 complement(741844..742968) [1125 bp, 374 aa] {O...   488   e-174
NCAS0F03700 Chr6 (744295..745398) [1104 bp, 367 aa] {ON}              478   e-170
NCAS0J02030 Chr10 (391030..392103) [1074 bp, 357 aa] {ON}             447   e-158
NCAS0J01960 Chr10 (375848..376924) [1077 bp, 358 aa] {ON}             446   e-157
NCAS0F01690 Chr6 complement(343128..343625) [498 bp, 165 aa] {ON}     172   8e-53
NCAS0F01700 Chr6 complement(343668..344180) [513 bp, 170 aa] {ON}     103   4e-26
NCAS0G03840 Chr7 (710671..711747) [1077 bp, 358 aa] {ON}               79   7e-16
NCAS0I02590 Chr9 (483974..485071) [1098 bp, 365 aa] {ON}               41   0.002
NCAS0E04200 Chr5 (829574..830674) [1101 bp, 366 aa] {ON}               33   0.56 
Smik_2.268 Chr2 complement(477878..478912) [1035 bp, 344 aa] {ON...    32   1.8  
KLLA0C09801g Chr3 complement(846302..848068) [1767 bp, 588 aa] {...    31   5.1  
Kpol_1053.2 s1053 (749..2383) [1635 bp, 544 aa] {ON} (749..2383)...    31   5.3  
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    31   6.1  
Ecym_4653 Chr4 (1276506..1279541) [3036 bp, 1011 aa] {ON} simila...    30   6.7  

>NCAS0D02110 Chr4 (389995..390948) [954 bp, 317 aa] {ON} 
          Length = 317

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/317 (98%), Positives = 311/317 (98%)

Query: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60
           MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV
Sbjct: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60

Query: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120
           VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL
Sbjct: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120

Query: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180
           GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA
Sbjct: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180

Query: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSX 240
           IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLS 
Sbjct: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSE 240

Query: 241 XXXXXVDTDADLVKVANTLMDDEGITETLEPVMDDEHRTRHRRTPTKFGESTYASRTLFK 300
                VDTDADLVKVANTLMDDEGITETLEPVMDDEHRTRHRRTPTKFGESTYASRTLFK
Sbjct: 241 KEEEEVDTDADLVKVANTLMDDEGITETLEPVMDDEHRTRHRRTPTKFGESTYASRTLFK 300

Query: 301 NSSNTRSSLTFRSVSNI 317
           NSSNTRSSLTFRSVSNI
Sbjct: 301 NSSNTRSSLTFRSVSNI 317

>NCAS0F03690 Chr6 complement(741844..742968) [1125 bp, 374 aa] {ON} 
          Length = 374

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 244/318 (76%), Positives = 264/318 (83%), Gaps = 5/318 (1%)

Query: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60
           M+YDGDNEDEKENRDAT+     TLRYKTTEVLIIRGPW  N+ FLF F+NSDKWGLE V
Sbjct: 61  MLYDGDNEDEKENRDATE----TTLRYKTTEVLIIRGPWVRNRYFLFRFSNSDKWGLEKV 116

Query: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120
           VEKKI EAGGYER+N ILAKEAPPLKSY PKMDR+YG+E   + +  NLRI SVRSD LL
Sbjct: 117 VEKKIIEAGGYERLNSILAKEAPPLKSYAPKMDRIYGEEPVRTHQIANLRIASVRSDRLL 176

Query: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180
           GKNPPAVLMTGTN+IVN+PFW +W H+Y ELK R EP TAW+MRRL IQTNMRVRSTL+ 
Sbjct: 177 GKNPPAVLMTGTNDIVNYPFWDIWVHMYEELKRRGEPPTAWQMRRLLIQTNMRVRSTLEE 236

Query: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSX 240
           IP ED PYK YRF SH NFDVNM++  +L FSGIYSCGLGIYSKVWNVI C S FE    
Sbjct: 237 IPYEDQPYKIYRFFSHCNFDVNMNKDVRLNFSGIYSCGLGIYSKVWNVIPCGSKFEDSVK 296

Query: 241 XXXXXVDTDADLVKVANTLMDDEGITETLE-PVMDDEHRTRHRRTPTKFGESTYASRTLF 299
                VDT AD+VKVANTLMDDEGITETLE PVMDDE  TRHRRTPTK GESTYASRTLF
Sbjct: 297 EVEEEVDTGADIVKVANTLMDDEGITETLEPPVMDDERLTRHRRTPTKSGESTYASRTLF 356

Query: 300 KNSSNTRSSLTFRSVSNI 317
           KNSSNTRSSLTFR+VSNI
Sbjct: 357 KNSSNTRSSLTFRNVSNI 374

>NCAS0F03700 Chr6 (744295..745398) [1104 bp, 367 aa] {ON}
          Length = 367

 Score =  478 bits (1230), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 239/312 (76%), Positives = 258/312 (82%), Gaps = 5/312 (1%)

Query: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60
           M+YDGDNEDEKENRDAT+     TLRYKTTEVLIIRGPW  N+ FLF F+NSDKWGLE V
Sbjct: 60  MLYDGDNEDEKENRDATE----TTLRYKTTEVLIIRGPWVRNRYFLFRFSNSDKWGLEKV 115

Query: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120
           VEKKI EAGGYER+N ILAKEAPPLKSY PKMDR+YG+E   + +  NLRI SVRSD LL
Sbjct: 116 VEKKIIEAGGYERLNSILAKEAPPLKSYAPKMDRIYGEEPVRTHQIANLRIASVRSDRLL 175

Query: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180
           GKNPPAVLMTGTN+IVN+PFW +W H+Y ELK R EP TAW+MRRL IQTNMRVRSTL+ 
Sbjct: 176 GKNPPAVLMTGTNDIVNYPFWDIWVHMYEELKRRGEPPTAWQMRRLLIQTNMRVRSTLEE 235

Query: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSX 240
           IP ED PYK YRF SH NFDVNM++  +L FSGIYSCGLGIYSKVWNVI C S FE    
Sbjct: 236 IPYEDQPYKIYRFFSHCNFDVNMNKDVRLNFSGIYSCGLGIYSKVWNVIPCGSKFEDSVK 295

Query: 241 XXXXXVDTDADLVKVANTLMDDEGITETLE-PVMDDEHRTRHRRTPTKFGESTYASRTLF 299
                VDT AD+VKVANTLMDDEGITETLE PVMDDE  TRHRRTPTK GESTYASRTLF
Sbjct: 296 EVEEEVDTGADIVKVANTLMDDEGITETLEPPVMDDERLTRHRRTPTKSGESTYASRTLF 355

Query: 300 KNSSNTRSSLTF 311
           KNSSNTRSSLTF
Sbjct: 356 KNSSNTRSSLTF 367

>NCAS0J02030 Chr10 (391030..392103) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score =  447 bits (1150), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 246/297 (82%), Gaps = 1/297 (0%)

Query: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60
           M+YDG+NEDEKENRDAT+ GNG TLRYKTTEVLIIRGPW  N+ FLF  ++  KWGLESV
Sbjct: 60  MLYDGNNEDEKENRDATETGNGGTLRYKTTEVLIIRGPWNRNRHFLFILSDVSKWGLESV 119

Query: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120
           VEKKI EAGGYER+N ILAKEAPPLKSYDPKMDR+YG E   S++N NLRITSV+SD  L
Sbjct: 120 VEKKIIEAGGYERLNSILAKEAPPLKSYDPKMDRIYGGEPVPSNQNANLRITSVQSDCSL 179

Query: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180
           G+NPPAV+MTGTN+I+NFPFW LW+H Y ELK+R EPATAW+++RL IQTNMRVRS+L+ 
Sbjct: 180 GENPPAVIMTGTNDILNFPFWDLWQHFYKELKQRGEPATAWQLQRLLIQTNMRVRSSLEE 239

Query: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSX 240
           IP +DLPYK Y+F SH N DVN+DEYA+LK S IY+ GLG YSKVWN I C S FETLS 
Sbjct: 240 IPYKDLPYKIYQFFSHCNLDVNIDEYARLKLSAIYTYGLGSYSKVWNAIPCGSKFETLSE 299

Query: 241 XXXXXVDTDADLVKVANTLMDDEGITETL-EPVMDDEHRTRHRRTPTKFGESTYASR 296
                VDTDAD+VKVANTLMDDEGITETL  PVMDDE  TRHR TPTK  ES YASR
Sbjct: 300 KVDEEVDTDADIVKVANTLMDDEGITETLGPPVMDDEPPTRHRHTPTKSDESIYASR 356

>NCAS0J01960 Chr10 (375848..376924) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score =  446 bits (1146), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 245/297 (82%), Gaps = 1/297 (0%)

Query: 1   MIYDGDNEDEKENRDATDIGNGATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESV 60
           M+YDG+NEDEKENRDAT+ GNG TLRYKTTEVLIIRGPW  N+ FLF  ++  KWGLESV
Sbjct: 61  MLYDGNNEDEKENRDATETGNGGTLRYKTTEVLIIRGPWNRNRHFLFILSDVSKWGLESV 120

Query: 61  VEKKINEAGGYERINCILAKEAPPLKSYDPKMDRVYGKESSFSDENVNLRITSVRSDHLL 120
           VEKKI EAGGYER+N ILAKE PPLKSYDPKMDR+YG E   S++N NLRITSV+SD  L
Sbjct: 121 VEKKIIEAGGYERLNSILAKEVPPLKSYDPKMDRIYGGEPVPSNQNANLRITSVQSDCSL 180

Query: 121 GKNPPAVLMTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKA 180
           G+NPPAV+MTGTN+I+NFPFW LW+H Y ELK+R EPATAW+++RL IQTNMRVRS+L+ 
Sbjct: 181 GENPPAVIMTGTNDILNFPFWDLWQHFYKELKQRGEPATAWQLQRLLIQTNMRVRSSLEE 240

Query: 181 IPDEDLPYKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLSX 240
           IP +DLPYK Y+F SH N DVN+DEYA+LK S IY+ GLG YSKVWN I C S FETLS 
Sbjct: 241 IPYKDLPYKIYQFFSHCNLDVNIDEYARLKLSAIYTYGLGSYSKVWNAIPCGSKFETLSE 300

Query: 241 XXXXXVDTDADLVKVANTLMDDEGITETL-EPVMDDEHRTRHRRTPTKFGESTYASR 296
                VDTDAD+VKVANTLMDDEGITETL  PVMDDE  TRHR TPTK  ES YASR
Sbjct: 301 KVDEEVDTDADIVKVANTLMDDEGITETLGPPVMDDEPPTRHRHTPTKSDESIYASR 357

>NCAS0F01690 Chr6 complement(343128..343625) [498 bp, 165 aa] {ON} 
          Length = 165

 Score =  172 bits (436), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 87/159 (54%), Positives = 109/159 (68%), Gaps = 3/159 (1%)

Query: 129 MTGTNNIVNFPFWRLWEHLYGELKEREEPATAWKMRRLFIQTNMRVRSTLKAIPDED-LP 187
           MTGT + VNF  W LW  LY +LK+R EPAT W+MRRL +QTNMR RS LK    +D LP
Sbjct: 1   MTGTKDEVNFSLWTLWNRLYAQLKQRGEPATPWQMRRLLVQTNMRARSILKGRSIDDFLP 60

Query: 188 YKEYRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETL--SXXXXXX 245
            KEYR+ SH+++D++M++  ++ F  IYS G+GIYS  WN+I C S FE    +      
Sbjct: 61  IKEYRYFSHVSYDLDMNQQTRVPFLLIYSYGMGIYSNAWNIIPCGSRFEWFLKTTDVEED 120

Query: 246 VDTDADLVKVANTLMDDEGITETLEPVMDDEHRTRHRRT 284
           VDT AD+VKVANT MDDEGITE L PV D++   RHR T
Sbjct: 121 VDTGADIVKVANTPMDDEGITEILRPVTDEKLPIRHRFT 159

>NCAS0F01700 Chr6 complement(343668..344180) [513 bp, 170 aa] {ON} 
          Length = 170

 Score =  103 bits (257), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 48/74 (64%), Positives = 60/74 (81%)

Query: 22  GATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESVVEKKINEAGGYERINCILAKE 81
           G +  YKTTEVLIIRGPWA NK FL++FTN +   LE +++K I + GGYER++ ILAKE
Sbjct: 77  GTSALYKTTEVLIIRGPWARNKNFLYTFTNRNSSELEDIIDKMIIKDGGYERLSSILAKE 136

Query: 82  APPLKSYDPKMDRV 95
           APPLKS+DPK+DRV
Sbjct: 137 APPLKSFDPKIDRV 150

>NCAS0G03840 Chr7 (710671..711747) [1077 bp, 358 aa] {ON}
          Length = 358

 Score = 79.0 bits (193), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 106/263 (40%), Gaps = 50/263 (19%)

Query: 31  EVLIIRGPWAENKLFL-FSFTNSDKWGLESVVEKKINEAGGYERINCILAKEAPPLKSYD 89
           EVLII GPW EN L+   SF   DK  +E++V    N+ GGY+ I  I++ EA P +SY 
Sbjct: 83  EVLIIVGPWNENTLYFDTSFDVPDK-EMETIV----NKNGGYDTIKSIISNEASPKRSYP 137

Query: 90  PKMDRV----------YGKESSFSDENVNLRITSVRSDHLLGKNPPAVLMTGTNNIVNFP 139
            K              Y  E  F D +  L              PP  + TG     N  
Sbjct: 138 TKTKTTLRSDTHKYTNYKAEPFFQDFDYEL--------------PPLAITTGVLQTANSV 183

Query: 140 FWRLWEHLYGELKEREEPATAWK------MRRLFIQT-------------NMRVRSTLKA 180
              LW + Y  LK  E P    +      +RRL + T             +   R TL+ 
Sbjct: 184 ITELWYNFYKRLKSVEGPILILEITDSSHLRRLILNTKAVFTNVLEPFPIDTSYRDTLER 243

Query: 181 IPDEDLPYKE-YRFSSHLNFDVNMDEYAKLKFSGIYSCGLGIYSKVWNVILCRSLFETLS 239
            P+   P    YRF S+ +++V++D      F  +Y   +  ++ VWN + C S      
Sbjct: 244 FPEYKFPRANIYRFRSYQSYEVDVDYGIMAAFQRLYELEVDSHTSVWNCLPCDSSLCFYF 303

Query: 240 XXXXXXVDTDADLVKVANTLMDD 262
                 VD    ++  A+T  DD
Sbjct: 304 ETESERVDPGLFILDSAHTPEDD 326

>NCAS0I02590 Chr9 (483974..485071) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 57/122 (46%), Gaps = 15/122 (12%)

Query: 18  DIGNGATL----RYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESVVEKKINEAGGYER 73
           + G GA       Y+  EVLII GP++ + L+   FT      ++S++E    E GG + 
Sbjct: 86  ETGQGANWAKEENYEVKEVLIISGPYSADTLYFSRFTKIPDSDMDSILE----EHGGVDA 141

Query: 74  INCILAKEAPPLK-SYDPKMDRVYGKESSFSDENVNLRITSVRSDHLLGKNPPAVLMTGT 132
           I  I+A+E    K ++ PK      +  S  D        ++ S  ++   PPA ++T  
Sbjct: 142 IKAIIAREIRDHKPNHHPK------QVHSILDRGEVYEYDTISSHLIVECIPPAFVLTSC 195

Query: 133 NN 134
           ++
Sbjct: 196 SS 197

>NCAS0E04200 Chr5 (829574..830674) [1101 bp, 366 aa] {ON} 
          Length = 366

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 22  GATLRYKTTEVLIIRGPWAENKLFLFSFTNSDKWGLESVVEKKINEAGGYERINCILAKE 81
            +T+ Y   EVL++RGP++ +  +  +FT        S++EK    +   + I   LAK+
Sbjct: 94  ASTMNYNVEEVLVVRGPYSNDTPYFQAFTKITSIEQRSLLEKYGGLSAIKQLITTELAKD 153

Query: 82  ---AP-PLKSYD 89
              +P PL  YD
Sbjct: 154 IQHSPTPLMHYD 165

>Smik_2.268 Chr2 complement(477878..478912) [1035 bp, 344 aa] {ON}
           YBR128C (REAL)
          Length = 344

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 43  KLFLFSFTNSDKWGLESVVEKKINEAGGYERINC-ILAKEAPPLKSYDPKMDRVYGKESS 101
           KL L S  + +K  L   VE+ +NEA  Y+RI+   L K+  PL S   K+D +  K+++
Sbjct: 30  KLDLISLNDENK-VLNEKVERILNEAMNYDRIDVKSLEKKKDPLTSSLMKLDILRMKKNN 88

Query: 102 ----FSDENVNLRITSVRSDHL 119
               +  E +N RI S R DH+
Sbjct: 89  NRIKYRIEQLNERIHS-RRDHI 109

>KLLA0C09801g Chr3 complement(846302..848068) [1767 bp, 588 aa] {ON}
           similar to uniprot|Q99257 Saccharomyces cerevisiae
           YPL169C MEX67 Poly(A)RNA binding protein involved in
           nuclear mRNA export component of the nuclear pore
           ortholog of human TAP
          Length = 588

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 17/121 (14%)

Query: 90  PKMDRVYGKESSFSDENVNLRITSVRSDH---LLGKNPPAV--LMTGTNNIVNFPFWRLW 144
           P M +V  KE S   E++NL   ++R  +    L +  P +  L    N+I  F    +W
Sbjct: 152 PAMMKVASKEPSMVVESINLSDNNLRDVNGVTTLAQTFPHLKNLCIANNSISRFHSLEVW 211

Query: 145 EHLYGELKE---REEPATAWKMRR---------LFIQTNMRVRSTLKAIPDEDLPYKEYR 192
           ++ + EL+E      P T+ ++ R         L I  N+ VR   K +    LP ++ +
Sbjct: 212 KNKFKELRELLMMNNPITSDRLYRTEMLRIFPKLVILDNVVVRDEQKLLSIYSLPVQQTQ 271

Query: 193 F 193
           F
Sbjct: 272 F 272

>Kpol_1053.2 s1053 (749..2383) [1635 bp, 544 aa] {ON} (749..2383)
           [1635 nt, 545 aa]
          Length = 544

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 147 LYGELKEREEPATAWKMRRLFIQTNMRVRSTLKAIPDEDLPYKEYRFSSHLNFDVNMDEY 206
           LYG L+ +EE    +++          +    K   D DLP  E  F    N DVN D  
Sbjct: 137 LYGALEPQEELQEGFEIA---------IDLATKWNSDFDLPIPEDFF----NLDVNNDND 183

Query: 207 AKLKFSGIYSCGLGIYSKVWNV 228
            KLKF+   +    I S+V+ +
Sbjct: 184 VKLKFNRFVAQAFAISSRVFEI 205

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 5/42 (11%)

Query: 267 ETLEPVMDDEHRTRHRRTPTKFGESTYASRTLFKNSSNTRSS 308
           ETL+P++D     R    P +F E+++AS + FKN++NT  +
Sbjct: 5   ETLKPLVD-----RILNNPLQFKEASFASTSNFKNNNNTEKA 41

>Ecym_4653 Chr4 (1276506..1279541) [3036 bp, 1011 aa] {ON} similar
           to Ashbya gossypii ACR190C
          Length = 1011

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 282 RRTPTKFGESTYASRTLFKNSSNTRSSLTF 311
           RR P+K+ ES  A+RTL  +S N RS   F
Sbjct: 901 RRPPSKYQESAIAARTLSPSSFNKRSESQF 930

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,813,804
Number of extensions: 1582210
Number of successful extensions: 4514
Number of sequences better than 10.0: 22
Number of HSP's gapped: 4602
Number of HSP's successfully gapped: 22
Length of query: 317
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 208
Effective length of database: 40,982,805
Effective search space: 8524423440
Effective search space used: 8524423440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)