Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D020106.45ON51051021730.0
NDAI0C027706.45ON6304579731e-124
Smik_15.1576.45ON5504358431e-106
TDEL0G042506.45ON5175258381e-106
YOL013C (HRD1)6.45ON5514368311e-104
Suva_15.1596.45ON5504358281e-104
Skud_15.1486.45ON5484288251e-103
ZYRO0C07194g6.45ON5585588131e-101
SAKL0E01958g6.45ON5245197701e-95
CAGL0E02299g6.45ON5454157711e-95
KAFR0A052406.45ON5535537321e-89
TBLA0B005606.45ON4925167087e-87
TPHA0F024806.45ON6054307055e-85
Kpol_1035.506.45ON6014086766e-81
Kwal_56.225226.45ON5134846453e-77
KLTH0C10604g6.45ON5154886281e-74
KNAG0E027406.45ON5564566031e-70
KLLA0C05874g6.45ON5534173903e-40
ACL019C6.45ON5753383781e-38
Ecym_30486.45ON6704083615e-36
Suva_11.1892.545ON758571287e-07
YKL034W (TUL1)2.545ON758571278e-07
Skud_11.1922.545ON758571278e-07
KAFR0B014602.545ON761571261e-06
Smik_11.2132.545ON759571233e-06
TDEL0B063402.545ON762571214e-06
SAKL0A09812g2.545ON751571215e-06
KLTH0D07216g2.545ON747571215e-06
TBLA0I014902.545ON750571206e-06
Ecym_72412.545ON758571197e-06
KLLA0F25674g2.545ON757581198e-06
AFR275W2.545ON753641199e-06
TPHA0C042602.545ON757571199e-06
Kwal_26.80992.545ON750571199e-06
Suva_4.3023.279ON150641111e-05
AGR034W3.279ON159661111e-05
CAGL0L01947g2.545ON757571171e-05
ZYRO0E05632g2.545ON765571171e-05
KNAG0A070902.545ON762671152e-05
TBLA0A096405.628ON325691133e-05
Kwal_27.105463.279ON104801026e-05
NCAS0A047602.545ON761571118e-05
KLLA0E04071g8.317ON704761118e-05
NDAI0A074503.279ON173791032e-04
Kpol_1002.72.545ON754571072e-04
NDAI0H008405.628ON341701034e-04
TDEL0D034603.279ON14442984e-04
KLTH0C05258g3.279ON15266985e-04
NCAS0A113503.405ON428531027e-04
KLTH0G12408g8.317ON603351028e-04
SAKL0G07370g5.628ON32174990.001
NDAI0K018102.545ON76254990.002
Kpol_526.345.628ON32874980.002
CAGL0H10274g3.279ON17558950.002
Skud_2.1863.279ON17868950.002
Smik_2.1963.279ON18568940.002
Suva_2.3048.317ON62435970.003
YBR062C3.279ON18064930.003
TDEL0F02870na 1ON26088940.004
KLLA0F12166g1.389ON152880970.004
ZYRO0C11176g5.628ON36846940.006
Ecym_42508.317ON65734940.007
NDAI0G052001.389ON158652950.007
AER390W5.628ON31660930.007
CAGL0K08052g3.405ON30550930.007
KAFR0H005605.628ON32753920.010
CAGL0K02563g2.542ON58651930.010
TPHA0A033403.405ON38459920.010
ABR104W3.405ON32870920.011
SAKL0H15686g8.317ON59951920.012
CAGL0E01441g8.317ON71727920.012
Ecym_13285.628ON32058910.013
KNAG0I013801.389ON149326930.013
NCAS0C033108.317ON57027920.014
KNAG0A012803.28ON11448850.014
NCAS0A087801.389ON150247920.016
Skud_4.5285.628ON33757900.016
Skud_4.4028.317ON61235910.016
Smik_4.5165.628ON33764900.016
KAFR0B030708.317ON64327910.017
Kpol_1014.163.28ON10748840.017
Kpol_1048.731.389ON154946920.017
Kpol_1052.193.279ON10365840.018
SAKL0D03058g3.279ON15575860.018
TBLA0C013301.389ON145295910.018
Smik_4.3878.317ON63442910.018
SAKL0C01760gsingletonON147449910.021
SAKL0C03586gsingletonON147449910.022
Kwal_56.239008.317ON58978900.022
Ecym_54453.405ON32152890.025
Suva_2.4335.628ON33759890.026
NCAS0A04680singletonON27472880.027
KLLA0E16677g5.628ON30553880.029
CAGL0M08690g5.628ON32846880.033
TBLA0I019603.279ON18468850.036
KAFR0A019902.542ON56051880.038
Ecym_26583.279ON15969840.039
ZYRO0E05192g1.389ON152026890.040
Kwal_26.80902.542ON52063870.044
CAGL0B05049g1.389ON147027880.045
KNAG0A074303.405ON10252810.047
KLTH0E02464g5.628ON32963860.052
YDR265W (PEX10)5.628ON33763860.052
KLLA0F18458g3.279ON14057820.059
Kwal_55.199995.628ON15257820.061
Kwal_55.220543.28ON11148800.062
SAKL0H17116gsingletonON54458860.062
NCAS0C052905.628ON33070850.063
SAKL0D08272g1.389ON149127870.064
KNAG0C056602.542ON50751860.066
ZYRO0D05830g8.317ON78056860.068
KLTH0G18150g1.389ON1554107870.068
TDEL0B061701.389ON147026860.073
YDR143C (SAN1)8.317ON61035860.075
KLTH0F19228g3.28ON11044790.076
KLTH0D07150g2.542ON54047850.081
KAFR0C004603.279ON15760810.081
TDEL0A049405.628ON32664840.082
Suva_8.422.542ON58547850.088
SAKL0C13178g3.28ON13848800.088
CAGL0I04576g3.190ON14988810.088
KAFR0I020901.389ON146667850.092
CAGL0E01567g3.28ON10248780.096
NDAI0B018202.542ON62547850.10
Suva_10.3441.389ON156067850.11
YHL010C (ETP1)2.542ON58547840.12
TPHA0C008508.317ON78146840.12
Skud_8.352.542ON58547840.12
NCAS0C044803.28ON10948780.12
Smik_8.322.542ON58547840.13
TBLA0B087103.28ON12248780.13
TPHA0P014703.28ON11148780.14
ADL181W3.28ON10844770.15
NDAI0G038603.28ON12348780.15
KNAG0G023908.317ON68827830.15
TBLA0G023102.542ON67430830.15
Kpol_1036.668.317ON66826830.17
Kwal_14.12871.389ON151847830.17
TPHA0C042502.542ON55647820.18
Kwal_55.21206singletonON27564810.18
AAL030C1.389ON153946830.19
Skud_15.203.28ON12148770.21
Smik_15.203.28ON12148770.21
YOL133W (HRT1)3.28ON12148770.21
Suva_15.263.28ON12248770.21
KAFR0C017803.28ON11848770.21
Kpol_538.53.405ON33552810.24
NCAS0A125502.542ON57247810.24
KLLA0F25740g2.542ON51747810.24
SAKL0A09746g2.542ON548108810.26
Ecym_20293.28ON11444750.29
NDAI0G026308.317ON66127810.30
Kpol_1002.82.542ON55847810.30
TDEL0A004703.28ON11848750.34
NCAS0A082803.279ON11838750.35
KNAG0J008503.279ON16228760.39
Suva_15.223.22ON133668800.41
Skud_12.3281.389ON155767800.41
ZYRO0C03058g3.28ON11648740.42
ZYRO0B02244g2.542ON56326790.43
ZYRO0E06996g3.279ON17254760.48
TDEL0A031802.542ON56726790.49
KLLA0C15697g3.405ON30449780.55
YLR247C (IRC20)1.389ON155626790.57
KLTH0F18502gsingletonON26763770.59
TDEL0C054203.405ON9350720.62
TPHA0C003505.628ON27825770.64
TPHA0I005908.799ON159148780.65
YPR093C (ASR1)3.405ON28827760.75
TDEL0F044408.317ON55426770.80
TPHA0B036501.389ON157626780.82
Kwal_56.231123.190ON13527730.83
KLTH0F11044g3.405ON29168760.83
KLLA0E07151g3.28ON11048720.85
YOL138C (RTC1)3.22ON134145770.89
ZYRO0F12760g8.799ON155549770.91
Smik_13.4608.799ON156649770.93
TPHA0A039903.279ON175103741.0
YMR247C (RKR1)8.799ON156249771.0
NDAI0G038103.22ON139348761.1
Skud_13.4198.799ON156449761.1
SAKL0A09526gna 2ON66230761.1
Smik_12.3201.389ON155367761.3
Suva_13.4328.799ON155949761.3
TBLA0D006508.799ON156849761.3
Kwal_26.8030na 2ON66030751.3
NDAI0K007108.799ON159149761.3
Skud_15.163.22ON133245761.3
SAKL0B06226g8.799ON155749761.3
KAFR0I028603.22ON136555761.4
NDAI0D02810na 1ON25247731.5
KAFR0B036208.799ON156049751.6
KLLA0E17711g3.190ON16227721.6
NDAI0E004408.808ON41628741.7
SAKL0B08976g3.405ON32250741.7
TDEL0B009808.799ON155949751.7
KLTH0E13992g8.799ON155049751.8
CAGL0L06336g8.247ON60049741.8
KNAG0J015605.628ON30925732.1
TDEL0A03090na 2ON58630742.1
NCAS0C006808.799ON156449742.1
KLTH0D06886gna 2ON66430742.2
Kwal_47.16850na 3ON27388722.3
TBLA0A030505.339ON36149732.4
KNAG0J005408.799ON156148742.4
ABL058C8.799ON154649732.6
CAGL0B02013g8.288ON112033732.6
CAGL0H02651g8.799ON154448732.9
Kwal_27.123278.799ON157449733.0
KLLA0E18503gna 2ON65028723.1
Suva_9.395.702ON168243733.2
Smik_15.163.22ON132648723.2
ZYRO0C17424g3.405ON27350713.3
TDEL0C035107.488ON130285723.8
KAFR0F028406.332ON44524714.0
ZYRO0G17996g7.488ON145587714.2
Kwal_56.235438.247ON96552714.3
TBLA0A039008.317ON69840714.5
KLLA0E06469g7.440ON96564714.9
TBLA0F027507.488ON141485705.6
Smik_16.3333.405ON29050696.3
NDAI0I004006.332ON48126696.3
KLLA0C08756g6.332ON42745696.6
TDEL0D008604.332ON45844696.9
TBLA0F032803.405ON55526697.5
TBLA0I023606.332ON64424698.0
TPHA0A003803.22ON131054698.3
ZYRO0B02046gna 2ON44530688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D02010
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   841   0.0  
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   379   e-124
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   329   e-106
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   327   e-106
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   324   e-104
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   323   e-104
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   322   e-103
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   317   e-101
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   301   1e-95
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   301   1e-95
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   286   1e-89
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   277   7e-87
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   276   5e-85
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   265   6e-81
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   253   3e-77
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   246   1e-74
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   236   1e-70
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   154   3e-40
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   150   1e-38
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   143   5e-36
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    54   7e-07
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    54   8e-07
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    54   8e-07
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    53   1e-06
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    52   3e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    51   4e-06
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    51   5e-06
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    51   5e-06
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    51   6e-06
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    50   7e-06
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    50   8e-06
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    50   9e-06
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    50   9e-06
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    50   9e-06
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    47   1e-05
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    47   1e-05
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    50   1e-05
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    50   1e-05
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    49   2e-05
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    48   3e-05
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    44   6e-05
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    47   8e-05
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    47   8e-05
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    44   2e-04
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    46   2e-04
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    44   4e-04
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    42   4e-04
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    42   5e-04
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    44   7e-04
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    44   8e-04
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    43   0.001
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    43   0.002
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    42   0.002
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    41   0.002
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    41   0.002
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    41   0.002
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    42   0.003
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    40   0.003
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      41   0.004
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    42   0.004
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    41   0.006
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    41   0.007
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    41   0.007
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    40   0.007
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    40   0.007
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    40   0.010
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    40   0.010
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    40   0.010
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    40   0.011
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    40   0.012
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    40   0.012
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    40   0.013
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    40   0.013
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     40   0.014
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    37   0.014
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    40   0.016
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    39   0.016
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    40   0.016
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    39   0.016
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    40   0.017
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    37   0.017
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    40   0.017
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    37   0.018
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    38   0.018
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    40   0.018
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    40   0.018
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    40   0.021
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    40   0.022
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    39   0.022
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    39   0.025
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    39   0.026
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      39   0.027
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    39   0.029
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    39   0.033
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    37   0.036
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    39   0.038
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    37   0.039
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    39   0.040
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    38   0.044
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    39   0.045
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    36   0.047
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    38   0.052
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    38   0.052
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    36   0.059
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    36   0.061
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    35   0.062
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    38   0.062
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    37   0.063
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    38   0.064
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    38   0.066
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    38   0.068
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    38   0.068
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    38   0.073
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    38   0.075
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    35   0.076
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    37   0.081
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    36   0.081
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    37   0.082
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    37   0.088
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    35   0.088
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    36   0.088
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    37   0.092
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    35   0.096
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     37   0.10 
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    37   0.11 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    37   0.12 
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    37   0.12 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    37   0.12 
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       35   0.12 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    37   0.13 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    35   0.13 
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    35   0.14 
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    34   0.15 
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    35   0.15 
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    37   0.15 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    37   0.15 
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    37   0.17 
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    37   0.17 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.18 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    36   0.18 
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    37   0.19 
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    34   0.21 
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    34   0.21 
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    34   0.21 
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    34   0.21 
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    34   0.21 
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    36   0.24 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    36   0.24 
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    36   0.24 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    36   0.26 
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    33   0.29 
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     36   0.30 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    36   0.30 
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    33   0.34 
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    33   0.35 
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    34   0.39 
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    35   0.41 
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    35   0.41 
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    33   0.42 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.43 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.48 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.49 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.55 
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    35   0.57 
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    34   0.59 
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    32   0.62 
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    34   0.64 
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    35   0.65 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    34   0.75 
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    34   0.80 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    35   0.82 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    33   0.83 
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    34   0.83 
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   0.85 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   0.89 
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    34   0.91 
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    34   0.93 
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    33   1.0  
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    34   1.0  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    34   1.1  
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    34   1.1  
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    34   1.1  
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    34   1.3  
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    34   1.3  
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    34   1.3  
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    33   1.3  
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    34   1.3  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   1.3  
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    34   1.3  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    34   1.4  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   1.5  
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    33   1.6  
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    32   1.6  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    33   1.7  
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    33   1.7  
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    33   1.7  
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    33   1.8  
CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some ...    33   1.8  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    33   2.1  
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               33   2.1  
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    33   2.1  
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    33   2.2  
Kwal_47.16850 s47 complement(142657..143478) [822 bp, 273 aa] {O...    32   2.3  
TBLA0A03050 Chr1 complement(731447..732532) [1086 bp, 361 aa] {O...    33   2.4  
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    33   2.4  
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    33   2.6  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   2.6  
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    33   2.9  
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    33   3.0  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    32   3.1  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    33   3.2  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   3.2  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    32   3.3  
TDEL0C03510 Chr3 (612431..616339) [3909 bp, 1302 aa] {ON} Anc_7....    32   3.8  
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    32   4.0  
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    32   4.2  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    32   4.3  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    32   4.5  
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    32   4.9  
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    32   5.6  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    31   6.3  
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    31   6.3  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    31   6.6  
TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.3...    31   6.9  
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    31   7.5  
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    31   8.0  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    31   8.3  
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    31   8.3  

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/510 (84%), Positives = 430/510 (84%)

Query: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXX 60
           MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVM            
Sbjct: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALL 60

Query: 61  XXXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120
                           EQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF
Sbjct: 61  LWKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120

Query: 121 YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN
Sbjct: 121 YWILKDRLEFLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
           STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFA           HSILSLYEIYK
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
           SNQYDQLNA              TPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL
Sbjct: 241 SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL 360
           NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL
Sbjct: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL 360

Query: 361 LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPATXXXX 420
           LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPAT    
Sbjct: 361 LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPATAADA 420

Query: 421 XXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL 480
                    Q              IQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL
Sbjct: 421 DVDVDVAAAQPPSTSSSPSIPHSPIQETLEPEEASIDNNTWYSFPITHINKDKSVISFEL 480

Query: 481 RDDKESSETVQLIRETKTENVIIPDDHIHT 510
           RDDKESSETVQLIRETKTENVIIPDDHIHT
Sbjct: 481 RDDKESSETVQLIRETKTENVIIPDDHIHT 510

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  379 bits (973), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/457 (47%), Positives = 276/457 (60%), Gaps = 52/457 (11%)

Query: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXX 60
           ML +++ Q + F+  +Y++T   IIN+A  STSFLHL LKLN+GFN+M            
Sbjct: 7   MLNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLL 66

Query: 61  XXXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120
                           EQEHIMERLPFT+INFI ++TMFNE+FF T+  YG +L+ ++++
Sbjct: 67  SWKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVY 126

Query: 121 YWILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLN-YEFLKKLY 178
           +WILKDRLEF+IQ+ N + S+++ IFSKF  NLI LS INL+LI+ C+  +   F K   
Sbjct: 127 HWILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWK--- 183

Query: 179 LNSTSILQSLINY--SSPSSTHASN-FNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSL 235
            N+ ++  S++NY  +  SST  SN  N   NP+YLML MEF+           HS+LSL
Sbjct: 184 -NNQNLFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSL 242

Query: 236 YEIYKS---------------------NQYDQLNAXXXXXXXXXXXXXXTPADFNGLENK 274
           +E YKS                      Q D+                     FNGLE K
Sbjct: 243 FEFYKSKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGK 302

Query: 275 FIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNL 334
           FIYEKIIDLFTR LMT+IH+SL LPLN+PMI++KDI+WD  SLY+N   L++I KNN+ L
Sbjct: 303 FIYEKIIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKL 362

Query: 335 DSKLPDMIPEDLQDSDNVCIVCMDDLLSE----EHKKKKAKR------------------ 372
           +S LP+M P+DLQ SDNVCI+CMDDLL      EH    +                    
Sbjct: 363 ESALPNMTPDDLQHSDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKK 422

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVK 409
           LPCGHFLH SCLKNWMERSQTCPICRL VFD++GNVK
Sbjct: 423 LPCGHFLHFSCLKNWMERSQTCPICRLDVFDKNGNVK 459

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  329 bits (843), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/435 (40%), Positives = 252/435 (57%), Gaps = 52/435 (11%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           + RR QL+ F  I Y+LT  C+ ++   S SFL ++LKLN+GFN+M              
Sbjct: 4   ENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLW 63

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN +F+S+MF+E++F T+AF+G +LLY+K+F+W
Sbjct: 64  HLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLE L+QS N + ++   IFS+F LNL++L+ ++ Q+I  CI   Y   +K+ + S
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTN-QKIDIVS 182

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
           TS+                         YLM  MEF             + L+ +E Y+S
Sbjct: 183 TSL-------------------------YLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRS 217

Query: 242 NQ----------------YDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFT 285
            Q                 ++++                   F GLE KF+YEK ID+FT
Sbjct: 218 QQSQSDDGNHIVHDDLSDGNRVDFDGSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFT 277

Query: 286 RSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPED 345
           R L T +H+S+ +P  +PM++LKD+IWD+++LYQ+   L++I +NNK LD  L  +  E 
Sbjct: 278 RFLKTALHLSMLIPFRMPMMLLKDVIWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQ 337

Query: 346 LQDS---DNVCIVCMDDLL------SEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           LQ+S   DN+CI+CMD+L+      + ++K KK KRLPCGH LHLSCLKNWMERSQTCPI
Sbjct: 338 LQNSANEDNICIICMDELIHSTNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPI 397

Query: 397 CRLPVFDESGNVKES 411
           CRLPVFD+ GNV ++
Sbjct: 398 CRLPVFDDKGNVVQT 412

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/525 (36%), Positives = 281/525 (53%), Gaps = 65/525 (12%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           +TR+ Q I F+  +Y LTI  + N+   S SFL   L+L +GFN++              
Sbjct: 5   ETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLW 64

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN + +S+MF+E  F+T+A YG +LL+MK+F+W
Sbjct: 65  KLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHW 124

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           IL+DRLE L+Q+   + ++S  IF++F  NL++L+  + Q+I  C+              
Sbjct: 125 ILRDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVS------------- 171

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
                SL N    S++           ++LM+ MEFA           H+ L  YE Y+S
Sbjct: 172 ----NSLDNSFGASAS-----------VHLMMGMEFALLLIDLLNTTLHAALCFYEFYQS 216

Query: 242 NQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLN 301
             + + NA                  F+GLE KFIYE++ID+ TR L T++H  L +P  
Sbjct: 217 QTHGRRNAVNDDED---------DTQFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFR 267

Query: 302 LPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLL 361
           +P++++KD++WD ++L+QN K L++I +NNK LD KLP M  + L++ DN+CI+CMD+L+
Sbjct: 268 MPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKLPTMSEDQLRNIDNMCIICMDELI 327

Query: 362 SEEHK------KKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPA 415
            E+ +      K K KRLPCGH LHL CLKNWMERSQTCPICRL VFDE GNV +S  P 
Sbjct: 328 PEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPT 387

Query: 416 TXXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNTWYSFPITHINKDKSV 475
           T                                 E + A +D  +WYSFP+   +++  +
Sbjct: 388 TAEVTPTDEINVPETVVERSQEQIQDNQQQMG--EGQVAVLD--SWYSFPVEETSEN--L 441

Query: 476 ISFELRDDKESSETVQ---LIRET-----------KTENVIIPDD 506
           ++F +++   ++ETV    LI  T           + E +IIPD+
Sbjct: 442 VTFSMKNSA-TNETVPASLLIERTNASERYDDDDDQVETIIIPDE 485

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  324 bits (831), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/436 (39%), Positives = 249/436 (57%), Gaps = 53/436 (12%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           + RR QL  F  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M              
Sbjct: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN +F+S++F+E++F T+AF+G +LLY+K+F+W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLE L+QS N + ++   IFS+F  NL++L+ ++ Q+I  CI         +Y N 
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCI-------SSIYTNQ 176

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
            S ++S                     +YL+  MEF             + L+ +E Y+S
Sbjct: 177 KSDIES-------------------TSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRS 217

Query: 242 -----NQYDQLNAXXXXXXXXXXXXXXTPA------------DFNGLENKFIYEKIIDLF 284
                N+ + +                 P              F GLE KF+YEK ID+F
Sbjct: 218 QQSLSNENNHIVHGDPTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVF 277

Query: 285 TRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPE 344
           TR L T +H+S+ +P  +PM++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E
Sbjct: 278 TRFLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVE 337

Query: 345 DLQDS---DNVCIVCMDDLL------SEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
            LQ+S   DN+CI+CMD+L+      + ++K KK KRLPCGH LHLSCLKNWMERSQTCP
Sbjct: 338 QLQNSANDDNICIICMDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCP 397

Query: 396 ICRLPVFDESGNVKES 411
           ICRLPVFDE GNV ++
Sbjct: 398 ICRLPVFDEKGNVVQT 413

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  323 bits (828), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/435 (40%), Positives = 246/435 (56%), Gaps = 53/435 (12%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           + RR QL+AF  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M              
Sbjct: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN +F+S+MF+E++F T+AF+G +LLY+K+F+W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           I+KDRLE L+QS N + ++   IFS+F  NL +L+  + Q+I  CI         +Y N 
Sbjct: 124 IIKDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCI-------SSIYTNK 176

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
                              N ++    +YLM  MEF             + L+ +E Y S
Sbjct: 177 -------------------NIDVVSTSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCS 217

Query: 242 NQYDQLNAXXXXXXXXXXXXXXTPAD----------------FNGLENKFIYEKIIDLFT 285
            Q  Q N                 +                 F GLE KF+YEK ID+FT
Sbjct: 218 QQ-SQSNENNHIVQDEVEDENEVDSGEPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFT 276

Query: 286 RSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPED 345
           R L T +H+S+ +P  +PM++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E 
Sbjct: 277 RFLKTALHLSMLIPFRMPMMLLKDVVWDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQ 336

Query: 346 LQDS---DNVCIVCMDDLL------SEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           +Q+S   DN+CI+CMD+L+      + ++K KK KRLPCGH LHLSCLKNWMERSQTCPI
Sbjct: 337 MQNSANEDNICIICMDELIHSANQQAWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPI 396

Query: 397 CRLPVFDESGNVKES 411
           CRLPVFDE GNV ++
Sbjct: 397 CRLPVFDEKGNVVQT 411

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 172/428 (40%), Positives = 242/428 (56%), Gaps = 48/428 (11%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           + RR QLI F  + Y+LT  C+ ++   S SFL ++LKLN+GFN+M              
Sbjct: 4   ENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EHI ERLPFTIIN +F+S+MF+E++F T+AF+G +LLY+K+F+W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLE L+QS N + ++   I S+F  NL++L+ ++ Q++  CI         +Y N 
Sbjct: 124 ILKDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCI-------SSIYTNQ 176

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKS 241
                              N ++    +YLM  MEF             + L+ +E Y+S
Sbjct: 177 -------------------NIDIISTSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRS 217

Query: 242 NQYDQLNAXXXXXXXXXXXXXXTPA------------DFNGLENKFIYEKIIDLFTRSLM 289
            Q     +                A             F GLE KF+YEK ID+FTR L 
Sbjct: 218 QQSQSNESNHIVHDDTPNGVGFEEAHAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLK 277

Query: 290 TMIHISLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS 349
           T +H+S+ +P  +P+++LKD++WD+++LYQ+   L++I +NNK LD  L  +  E LQ+S
Sbjct: 278 TALHLSMLIPFRMPLMLLKDVVWDVLALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNS 337

Query: 350 ---DNVCIVCMDDLLSEE------HKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
              DN+CI+CMD+L+  +      +K KK KRLPCGH LHLSCLKNWMERSQTCPICRL 
Sbjct: 338 ANEDNICIICMDELMHSQADQTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLS 397

Query: 401 VFDESGNV 408
           VFDE GNV
Sbjct: 398 VFDEKGNV 405

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/558 (34%), Positives = 278/558 (49%), Gaps = 82/558 (14%)

Query: 4   TRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXX 63
           TRR Q+  F   +Y LTI  + NSA  S SFL  ++KL  GFNV+               
Sbjct: 6   TRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWK 65

Query: 64  XXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWI 123
                        E EHI ERLPFTIIN +F+S+MF+E+ F T+  +G +LLYMK+F+WI
Sbjct: 66  LSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHWI 125

Query: 124 LKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNST 182
           LKDRLE L+QS + + ++   I ++F  NL++L+ ++ +++  CI               
Sbjct: 126 LKDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCIT-------------- 171

Query: 183 SILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSN 242
               SL N    S++           ++LM+ MEFA           H++L+ YE Y++ 
Sbjct: 172 ---NSLSNSFGASTS-----------VHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQ 217

Query: 243 ---QYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALP 299
                  ++                 + F GLE KF+YE++ID+FTR L T+IH  + +P
Sbjct: 218 VDAHLSSVDTDTDGGDEENEDEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIP 277

Query: 300 LNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDD 359
             + ++++KD+ WD+++L Q    L++I +NNK LD KL  M P +L  +DN+CIVCMD+
Sbjct: 278 FRMSILLIKDVFWDVLTLCQIVSSLWRIWQNNKQLDDKLKTMSPVELSATDNICIVCMDE 337

Query: 360 LLSE--------------EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405
           L ++              +  K K KRLPCGH LHL CLKNWMERSQTCPICRLPVFDE+
Sbjct: 338 LCADLEEVVQGPDREKVAKTGKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDEN 397

Query: 406 GNVKESERPATXXXXXXXXXXX-----------------------XXQXXXXXXXXXXXX 442
           GNV +S+   T                                                 
Sbjct: 398 GNVVQSQSSTTNRTTQATNQSTNVTTTAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSR 457

Query: 443 XXIQETLE---PEEASIDNNT-----WYSFPITHINKDKSVISFELRDDKESS---ETVQ 491
              Q+TL    P   + D+N+     WYS+PI    KD  V++F LRD    +     + 
Sbjct: 458 QSTQQTLGDLTPTPTTADSNSNIANLWYSYPIQEA-KD-GVVTFSLRDSVSGNPVRAKLT 515

Query: 492 LIRETKTENVIIPDDHIH 509
           L  + +T+ + IP++ IH
Sbjct: 516 LNNDNETQRITIPNECIH 533

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  301 bits (770), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 170/519 (32%), Positives = 260/519 (50%), Gaps = 71/519 (13%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           Q RR Q I ++   Y   I  + +S   S +FL  ++KL +G N++              
Sbjct: 5   QNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLW 64

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EH+ ERL FTI+N IF+S+MF E+ F+T+  +  +L+++K+F+W
Sbjct: 65  KLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHW 124

Query: 123 ILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNS 181
           ILKDRLEF+ Q +N N ++ + +FS+F  NL+ L++++ Q+++ C+              
Sbjct: 125 ILKDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCL-------------- 170

Query: 182 TSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK- 240
                         S   SN     + +YLM  ++FA           H +++  E+Y+ 
Sbjct: 171 --------------SNSISNDQWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRL 216

Query: 241 ---SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLA 297
              ++ YD+                    +F GLE KF+YEK+ID+  R L  ++HI+L 
Sbjct: 217 QSHNSHYDE--------------------EFLGLEGKFMYEKLIDMGARLLKMLLHIALL 256

Query: 298 LPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCM 357
           +P  +P++++KDIIWD ISLYQ    L++  KN K LD KLPD+  E+L   +N+CIVCM
Sbjct: 257 IPFRMPIMIIKDIIWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEELNQGNNMCIVCM 316

Query: 358 DDLLSEEHKKK---KAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV------ 408
           DD+L     +    K K+LPCGH LHLSCLK+WMERSQTCPICRLPVFDE GNV      
Sbjct: 317 DDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPVFDERGNVTRMDSS 376

Query: 409 -KESERP-------ATXXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNT 460
            +E + P       A                              +  + P+   +  + 
Sbjct: 377 SQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRSVIMPQVPRVPQD- 435

Query: 461 WYSFPITHINKDKSVISFELRDDKESSETVQLIRETKTE 499
           WY+FPI      K  + F+L D   +  T  L+ +T+ +
Sbjct: 436 WYAFPIEATQTTKDKVVFKLVDSDNNEITANLLTKTRPQ 474

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  301 bits (771), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 171/415 (41%), Positives = 240/415 (57%), Gaps = 21/415 (5%)

Query: 5   RRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXX 64
            + + + FTAI YVLTI C+I++   S SFL ++LKL++GFN++                
Sbjct: 6   HKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQF 65

Query: 65  XXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWIL 124
                       E EHI ERLPF +IN IF+ + FNEK+F T+A    +LLYMK+F+WIL
Sbjct: 66  LTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWIL 125

Query: 125 KDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTS 183
           +DRL+ L+Q  N +      + +++  NL++L  I+  +I  C+   Y     ++   T+
Sbjct: 126 RDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTN 185

Query: 184 ILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQ 243
            +  ++   SP +  A         IY+M AMEF            ++ L  YE + S +
Sbjct: 186 SI--VLGGGSPLTQRAL--------IYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRK 235

Query: 244 YDQLNAXXXXXXXXXXXXXXTPAD--FNGLENKFIYEKIIDLFTRSLMTMIHISLALPLN 301
           + Q N                  D  FNGLE KF+YEK+ID+ TR L T++H+ +A+ LN
Sbjct: 236 FSQNNPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLN 295

Query: 302 LPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS---DNVCIVCMD 358
           LP++++KDI  D+  LY N K L  I KN+K LD+KLP M  +DL +    DNVCIVCMD
Sbjct: 296 LPLMLVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMD 355

Query: 359 DLLSE-----EHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV 408
           +L+SE     +   KK K+LPCGH LHLSCLKNWMERSQTCPICRLPVFDE+G +
Sbjct: 356 ELVSENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEI 410

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  286 bits (732), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 185/553 (33%), Positives = 274/553 (49%), Gaps = 55/553 (9%)

Query: 1   MLQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXX 60
           ++Q+R+ QL+ F+ IIY+LTI  I  S   S +FL  ++KL QG NV+            
Sbjct: 2   IVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFL 61

Query: 61  XXXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIF 120
                           E EHI ERLPFTIIN +F+ ++FNE  F     +  IL  +K+F
Sbjct: 62  LWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVF 121

Query: 121 YWILKDRLEFLIQS-NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPL--NYEFLKKL 177
           +WILKDRLE L+QS N    +   IFS++ LNL I S ++  +          Y+     
Sbjct: 122 HWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNST 181

Query: 178 YLNSTSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYE 237
             N  +   +L+N ++ + T+          ++L+  MEF            H++L+ YE
Sbjct: 182 NNNQNADSSNLMNKNNLTPTNKK-------ALFLLFGMEFFVLFLDLINLAMHTVLNFYE 234

Query: 238 IY---KSNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHI 294
            Y   ++  +  +NA                A+FNGLE KF+YEK+ID+ T+   T++HI
Sbjct: 235 FYCSQRATAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHI 294

Query: 295 SLALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQ-DSDNVC 353
            + +   L ++VLKD++WD ++LYQ+   L++I KNNK LD KLP +   D++ D+DN+C
Sbjct: 295 FVLIQTKLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNIC 354

Query: 354 IVCMDDLLSEEHKK----------------KKAKRLPCGHFLHLSCLKNWMERSQTCPIC 397
           IVCMDDL+   H K                K+ K+LPCGH LHLSCLKNWMERSQTCPIC
Sbjct: 355 IVCMDDLVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPIC 414

Query: 398 RLPVFDESGNVK-------------------ESERPATXXXXXXXXXXXXXQXXXXXXXX 438
           RLPVFDE+GNVK                    S                           
Sbjct: 415 RLPVFDENGNVKPFLHTTTNNNMQPNNDADVTSTTATNSRTDTSTPMTDVPTPTRTSASA 474

Query: 439 XXXXXXIQETLEPEEASIDNNTWYSFPITHINKDKSVISFELRDDKESSETVQL------ 492
                 I +  +     ID+  WY+F I  I+  ++ + F +R+   ++ ++ +      
Sbjct: 475 LTTSSIITQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIER 534

Query: 493 IRETKTENVIIPD 505
           + ET    ++IPD
Sbjct: 535 MEETAEGQIVIPD 547

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  277 bits (708), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 185/516 (35%), Positives = 261/516 (50%), Gaps = 77/516 (14%)

Query: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXX 62
           Q+R +Q + FT  IYVLT + +  +   S SFL +++KL QGFN++              
Sbjct: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILW 64

Query: 63  XXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122
                         E EH++ERLPFT+IN +F+S+MFNE    T      +LLYMK+  W
Sbjct: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNW 124

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFS-KFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           IL+DRLE L+Q+ N + ++   IFS +F+ NLI+ S I+  ++  CI             
Sbjct: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCI------------- 171

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNP-IYLMLAMEFAXXXXXXXXXXXHSILSLYEIY 239
                         S++  SN N+G +  +YL++ MEF            HSIL++YE Y
Sbjct: 172 --------------SNSLLSNSNIGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFY 217

Query: 240 KSNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALP 299
           KS+                       + FNGLE KFIYEKIID FTR L T+IHI L +P
Sbjct: 218 KSS------LVSLDTHLTSEDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIP 271

Query: 300 LNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQD-SDNVCIVCMD 358
             +P+++ KD++ DL++L QN   +++I  NN+ LD +LP +    L    D +CI+CMD
Sbjct: 272 FAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMD 331

Query: 359 DL----LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERP 414
           DL    + +  +K+K K LPCGH LH++CLKNWMERSQTCP+CRLPVF+E G V  + R 
Sbjct: 332 DLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRRE 391

Query: 415 ATXXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEP----EEASIDNNTWYSFPITHIN 470
                                            T EP       S +N  W SFPI  I 
Sbjct: 392 RAT------------------------------TPEPSTSTSSDSEENEEWVSFPIETI- 420

Query: 471 KDKSVISFELRDDKESSETVQLIRETKTENVIIPDD 506
            D S I+F L +D       +L+  + T+     DD
Sbjct: 421 -DDSTITFNLANDDGRILKSRLLINSTTDTTQNSDD 455

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  276 bits (705), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 164/430 (38%), Positives = 237/430 (55%), Gaps = 57/430 (13%)

Query: 4   TRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXX 63
           TR+ QL   T +IY  TI     +   S+S+L +++KL +G NV+               
Sbjct: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66

Query: 64  XXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFI-TMAFYGFILLYMKIFYW 122
                        E EHI+ERLPFTIINF  +S+MFNE+  I +++ YG IL++MK+ +W
Sbjct: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126

Query: 123 ILKDRLEFLIQS-NTNYSVSRFIFS-KFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           +LKDRLE L+QS N N S+   IFS +F+LNL + + I+ Q++  C+             
Sbjct: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVT------------ 174

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
                 S+ N    S++           I+L+L +EF            H+ L+LYE +K
Sbjct: 175 -----NSIKNSMGASTS-----------IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHK 218

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
           S +   LN                  +FN LE KF+YEK ID+FTR L T++H+ + +P 
Sbjct: 219 SIEDRNLN----IVGEDEDGLVDDEEEFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPF 274

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDN-VCIVCMDD 359
            + +++LKD+IWD+I+LYQ+   L++  +N+K LD KLP +  E+L+ SDN +CIVCMD 
Sbjct: 275 RMKIVLLKDVIWDVITLYQSTVSLWKTWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDS 334

Query: 360 LLSEE---------------------HKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           L++ +                     H K+K K+LPC H LHL CLKNWMERSQTCPICR
Sbjct: 335 LINIDFNSTEETENKEKEEQIYNAAIHSKQKPKKLPCCHILHLGCLKNWMERSQTCPICR 394

Query: 399 LPVFDESGNV 408
           L VFD +GN+
Sbjct: 395 LSVFDSNGNI 404

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  265 bits (676), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 157/408 (38%), Positives = 225/408 (55%), Gaps = 54/408 (13%)

Query: 27  SAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQEHIMERLP 86
           + + STS+L +++KL+QGFN +                            E EH+MERLP
Sbjct: 31  AVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYEHVMERLP 90

Query: 87  FTIINFIFISTMFNEK-FFITMAFYGFILLYMKIFYWILKDRLEFLIQS-NTNYSVSRFI 144
           FTI+N +   +MFN+K    T + +GF L++MK+ +WIL+DRL+ ++QS N + +++  I
Sbjct: 91  FTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDSSTLTSII 150

Query: 145 FSK-FYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTSILQSLINYSSPSSTHASNFN 203
            S  F+LNLII + ++ +++  C+                   SL N    S+T      
Sbjct: 151 LSNNFFLNLIIFTIVDYKMVSYCVS-----------------NSLSNSMGASTT------ 187

Query: 204 LGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQYDQLNAXXXXXXXXXXXXXX 263
                ++L+L MEF            H+ L+LYE + +      N               
Sbjct: 188 -----VHLLLGMEFTMLLIDLLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDEL 242

Query: 264 TPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLNLPM-IVLKDIIWDLISLYQNCK 322
               FN LE KF+YEK ID+FTR L T IHI + +PL +   ++LKD+IW++ISLY++  
Sbjct: 243 ---QFNSLEGKFMYEKTIDVFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTG 299

Query: 323 ILFQILKNNKNLDSKLPDMIPEDLQDSDN-VCIVCMDDLL----SEEH------------ 365
            L++  KNNK LD KLP    E+L+++DN +CIVCMDDLL    SE++            
Sbjct: 300 SLWKTWKNNKQLDDKLPTASIEELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHI 359

Query: 366 --KKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411
              K+K K+LPCGH LHL+CLKNWMERSQTCPICRLPVFD+ GNV  S
Sbjct: 360 MKSKQKPKKLPCGHILHLNCLKNWMERSQTCPICRLPVFDDKGNVMPS 407

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  253 bits (645), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 150/484 (30%), Positives = 235/484 (48%), Gaps = 57/484 (11%)

Query: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXX 61
           ++ +R Q  A+    Y      II +  +S SFL LS +L +G N++             
Sbjct: 3   VRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGVLL 62

Query: 62  XXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121
                          E EHI ERL FTI+N  F+S+ F+E  F+++  +   L+++K+F+
Sbjct: 63  WKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKVFH 122

Query: 122 WILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           W+L+DRLE + Q ++ + + +R + S+F+ N+ +L  ++ Q+ K CI     F +  +  
Sbjct: 123 WVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF-- 180

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
                     YSS  S H            LM A+EFA            SI++L E+Y+
Sbjct: 181 ----------YSSSLSVH------------LMFAVEFAMLLVDVTEVAMKSIINLVEVYQ 218

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
             +    +                  D+ GLE KF+YEK++ L  +     +HI L +P 
Sbjct: 219 CKRSFARDGE----------------DYTGLEGKFMYEKVVQLICQLTRMGLHIMLMMPF 262

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDN-VCIVCMDD 359
           ++P+++ KDI+WD  +++   K L    K+N+ +D KLPD+    L  SD+ +CIVCMDD
Sbjct: 263 SMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKLPDVSEAQLAASDDKMCIVCMDD 322

Query: 360 LLSEE---HKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV-----KES 411
           +L+     + K+K KRLPC H LHL CLK+WMERSQTCPICR+PVFD+ GNV     + +
Sbjct: 323 MLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTCPICRVPVFDKKGNVVVTSDQTN 382

Query: 412 ERPATXXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNNTWYSFPITHINK 471
            +P T                            I  T  P         WY+FP   ++ 
Sbjct: 383 NQPGTSSAVESTADET---STAATTSVSSQSSSIAVTDVPSH----QRGWYAFPTVQVHD 435

Query: 472 DKSV 475
           + S+
Sbjct: 436 EGSI 439

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  246 bits (628), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 145/488 (29%), Positives = 237/488 (48%), Gaps = 50/488 (10%)

Query: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXX 61
           L+ +R Q + +T   Y      +++    S SFL   LKL +G N++             
Sbjct: 3   LRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILL 62

Query: 62  XXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121
                          E EHI ERL FTI+N  F+S+ F E  F+T+     +L ++++F+
Sbjct: 63  WKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFH 122

Query: 122 WILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           W+LKDRLE++ Q ++   +++R + S+F+LN+II + ++ Q+++ C+             
Sbjct: 123 WVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCL------------- 169

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
                 SL N   PS +          P+Y++  ++F+            S+++L E+ +
Sbjct: 170 ----RNSLTNKHDPSPSA---------PVYILFCVDFSMLLVDVAEVAMKSVINLIELIQ 216

Query: 241 SNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300
             +  + +                  DF GL+ KF+YEK++ L  + L   + ++   P 
Sbjct: 217 CKRAFERDGD----------------DFVGLDGKFMYEKLVQLVCQVLKLGLRVASLAPF 260

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS-DNVCIVCMDD 359
           ++P+++ KDIIWD I+L+   K +++  K+N+ +D KLPD+    L  S D +CIVCM+D
Sbjct: 261 SMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMED 320

Query: 360 LLSEEHK---KKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPAT 416
           +L        K K K+LPC H LHL CLK+WMERSQTCPICR+ VFD  GNV    + A 
Sbjct: 321 MLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAA 380

Query: 417 XXXXXXXXXXXXXQXXXXXXXXXXXXXXIQETLEPEEASIDNN--TWYSFPITHINKDKS 474
                                                +S + N  TWY+FP+T  + D +
Sbjct: 381 QQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSNPNFPTWYTFPVTLSDNDGA 440

Query: 475 VISFELRD 482
           V  F++RD
Sbjct: 441 V-DFKVRD 447

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  236 bits (603), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 147/456 (32%), Positives = 215/456 (47%), Gaps = 71/456 (15%)

Query: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXX 61
           L++R+ Q      +IY+LT   +IN+   S +FL  +  L QG N +             
Sbjct: 6   LRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLL 65

Query: 62  XXXXXXXXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121
                          E+EHI ER+P T+IN I IS++ ++K+   +   G +LL +K+ +
Sbjct: 66  WKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSH 125

Query: 122 WILKDRLE-FLIQSNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180
           WIL+DRLE FL + N   +++  +FSKF  NL+I   ++  + K C    +      Y  
Sbjct: 126 WILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICF---FNHFGNFY-- 180

Query: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYK 240
                            H  +F+   N   +M  +E+A           H++L+ Y  ++
Sbjct: 181 -----------------HHGDFS---NITQIMFGLEYAVVFIDLINILCHTVLNFYAFHR 220

Query: 241 SN-QYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALP 299
           +  Q  + N                     GLE KFIYEK+ID     L T +H ++ +P
Sbjct: 221 TQLQSARFNLEMMNDDFSEDENDSGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIP 280

Query: 300 LNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDD 359
           L    +++KD +WDL +L  N   L++I KNN+ L+ KLP++  EDL D DN+CIVCMDD
Sbjct: 281 LRFQSMLVKDFVWDLFNLVNNGNSLWKIYKNNRQLNKKLPNIAIEDLLDHDNMCIVCMDD 340

Query: 360 LLSEEH--------------------------------------------KKKKAKRLPC 375
           L+   H                                              KK K+LPC
Sbjct: 341 LVLVHHPTKRRQSVQEECDDEKNTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPC 400

Query: 376 GHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411
           GH LH SCLKNWMERSQTCPICR+PVFD+ GNV+ S
Sbjct: 401 GHMLHFSCLKNWMERSQTCPICRVPVFDKDGNVRPS 436

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 114/417 (27%), Positives = 188/417 (45%), Gaps = 46/417 (11%)

Query: 8   QLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXXXXX 67
           + IA++ + Y      +      S S+LH   K+ +G + M                   
Sbjct: 25  KFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVIH 84

Query: 68  XXXXXXXXXEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYWILKDR 127
                    E EHI+ER+ +T+I  +   +  N      M  +  + +  +  +WILKDR
Sbjct: 85  MLFGQLRLIEYEHILERISYTVITLLLSCSSMN-GLISVMQIHCVLFVCCRTLHWILKDR 143

Query: 128 LEFLIQSN------TNYSVSRFIFSKFYL----NLIILSTINLQLIKTCIPLNYEF--LK 175
           +E   Q+N       +  +SRF+F+   L     +I+   +N  L K+ I + Y    + 
Sbjct: 144 MEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYKSNIDVTYTLFIIS 203

Query: 176 KLYLNSTSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSL 235
           +  +  T +LQ ++               G+N   L      A             ++  
Sbjct: 204 QYAILGTDLLQVILRT-------------GLNLFELSTIQNRARIRRNADHHVDEPVI-- 248

Query: 236 YEIYKSNQYDQLNAXXXXXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHIS 295
                 N  ++ NA                    GLE KFIYEK+ID+F  ++  +I  +
Sbjct: 249 ------NHEERPNAVAIEEDEDEDEENA------GLEGKFIYEKLIDVFISTVKVIIKFA 296

Query: 296 LALPLNLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSD-NVCI 354
            +      M+V   ++W+ I+ +++ + L++  K++K+LD+ L D     ++  + ++CI
Sbjct: 297 SSFSTGRVMMV--TVLWEAITTFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICI 354

Query: 355 VCMDDLLSEEHKK---KKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNV 408
           VCM+D L    +K   KK K LPC H LHLSCLKNW+ RS TCPICRLP+FDE+GNV
Sbjct: 355 VCMEDFLPSHQRKSDGKKVKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNV 411

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 159/338 (47%), Gaps = 45/338 (13%)

Query: 77  EQEHIMERLPFTIINFIFISTMFNEKFF---ITMAFYGFILLYMKIFYWILKDRLEFLIQ 133
           E +HI ERL   ++    I     + +    +T+ FY   L    + +W+L+DR++F+ Q
Sbjct: 78  EYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILFYTLCL----VAHWVLRDRMDFVFQ 133

Query: 134 -SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTSILQSLINYS 192
              T+ S+   + S+F  +L++L  ++ +++K C+                         
Sbjct: 134 VHGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCV------------------------- 168

Query: 193 SPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQYDQLNAXXX 252
                  +N +   + +YLMLA+ FA            + L+L+E+ +S +    N    
Sbjct: 169 -----QNTNVDGKRHELYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRRTRSAN---- 219

Query: 253 XXXXXXXXXXXTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDIIW 312
                         +   LE K+IYE + DL    L  ++ I   + +   + V+  I  
Sbjct: 220 LVYEGGTTDDDADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYSIFV 279

Query: 313 DLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKK---K 369
             I   ++  +++   KNNK L  KL D+  E L D+D++CI+CMDD+L      K   +
Sbjct: 280 RSIKAGESFLLVYNYWKNNKKLYEKLSDVSEEQLDDTDSMCIICMDDMLPTTETTKMNRR 339

Query: 370 AKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGN 407
           AK LPCGH LH  CLK+WMERSQTCPICRL VF    N
Sbjct: 340 AKMLPCGHMLHFGCLKSWMERSQTCPICRLSVFANDSN 377

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  143 bits (361), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 107/408 (26%), Positives = 175/408 (42%), Gaps = 37/408 (9%)

Query: 10  IAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMXXXXXXXXXXXXXXXXXXXXX 69
           + F A+ Y L    + N    S SFL    K   G +++                     
Sbjct: 11  LQFIAVTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVRML 70

Query: 70  XXXXXXXEQEHIMERLPFTIINFIFISTMFNEK----FFITMAFYGFILLYMKIFYWILK 125
                  E EHI ERL  T+++ + +    + K      I + F+    +  ++ +W+++
Sbjct: 71  FGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFH----VLCQVLHWVVR 126

Query: 126 DRLEFLIQS--NTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLNSTS 183
           DR+EF+      T  ++   +FS+F L++++L  ++ +L+         +  + +     
Sbjct: 127 DRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMM--------YFYRQHQAEQG 178

Query: 184 ILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAXXXXXXXXXXXHSILSLYEIYKSNQ 243
            L  L+   +  +T     +L        L ++F             + L   E++K+ +
Sbjct: 179 YLYYLLFSDNGQNTSEDRLSLS-------LGVDFGLLFLDWLQVVLLNCLKFVELFKAGR 231

Query: 244 YDQLNAXXXXXXXXXXXXXXTPADFNG---LENKFIYEKIIDLFTRSLMTMIHISLALPL 300
             Q                    + +G   LE KFIYEKI++     L  +++I L    
Sbjct: 232 RVQ------EHQLLDNNELENDIEDDGAFILEEKFIYEKIVETVLEILKILLNIFLITSG 285

Query: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDL 360
               +V  +I    I   + C +LF   KNN+ L  KL D+    L   D  C +CMDD+
Sbjct: 286 IHSFVVFYNIFIKSIETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGVDITCTICMDDM 345

Query: 361 LSEEHKK---KKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDES 405
           L  +  K   KKAK LPCGH LH  CLK+WM+R+QTCPICR PVF  S
Sbjct: 346 LPSKDVKVNNKKAKMLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSS 393

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK  +   +  PC H  H SCL+NWM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCRSPL 755

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK  +   +  PC H  H SCL+NWM     CP+CR P+
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPL 755

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK  +   +  PC H  H SCL+NWM     CP+CR P+
Sbjct: 699 CTICMSDVPIYIEEIPETHKVDQHSYMVTPCDHVFHTSCLENWMSYKLQCPVCRSPL 755

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      L E HK  +   +  PC H  H SCL+NWM     CP+CR P+
Sbjct: 702 CSICMSEIPVYVEELPETHKVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCRAPL 758

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK  +   +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 700 CAICMSDVPIYIEEVPETHKVDQHSYMVTPCNHVFHTPCLENWMSYKLQCPVCRSPL 756

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      + E HK      +  PCGH  H  CL+NWM     CP+CR P+
Sbjct: 703 CAICMSEVPVYVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSYKLQCPVCRSPL 759

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM D+      + E HK      +  PCGH  H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM+D+      + + HK  K   +  PC H  H  CL++WM     CP+CR P+
Sbjct: 688 CAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 744

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      + E H   K   +  PC H  H +CL+NWM     CP+CR P+
Sbjct: 691 CTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCRAPL 747

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      + E HK    + +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKLQCPVCRAPL 755

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 8/58 (13%)

Query: 352 VCIVCMDDLL-----SEEHKKKKAKRL---PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           VC +CM D+      +EE  K  A+     PC H  H  CL+NWM     CP+CR P+
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 349 SDNVCI---VCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPIC 397
           +DN C+   +CM +L      + E HK      +  PC H  H  CL+NWM     CP+C
Sbjct: 687 NDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVC 746

Query: 398 RLPV 401
           R P+
Sbjct: 747 RAPL 750

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      + E H   +   +  PC H  H +CL+NWM     CP+CR P+
Sbjct: 698 CAICMSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLENWMGYKLQCPVCRAPL 754

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 8/57 (14%)

Query: 353 CIVCMD------DLLSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM       D + E HK  K   +  PC H  H  CL++WM     CP+CR P+
Sbjct: 691 CAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 747

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394
           + LP +  + L+ SDN C +C  + L  E K      LP C H   L CL  W+ RS TC
Sbjct: 63  ASLPRINKKMLKPSDN-CSICYTNYL--EDKYPLVVELPHCHHKFDLECLSVWLSRSTTC 119

Query: 395 PICR 398
           P+CR
Sbjct: 120 PLCR 123

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 338 LPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPI 396
           LP +  + L + DN C +C    L +E+       LP CGH   L C+  W+ RS TCP+
Sbjct: 76  LPRVPKKRLAEGDN-CAICCCGYLEDEYPL--VVELPNCGHTFDLQCVSVWLSRSTTCPM 132

Query: 397 CRLPVF 402
           CR  V 
Sbjct: 133 CRSDVL 138

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM +       L E H+  K   +  PC H  H SCL++WM     CP+CR P+
Sbjct: 698 CAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++      + E HK  +   +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 706 CAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIFHTQCLENWMSYKLQCPVCRSPL 762

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 344 EDLQDSDNV-CIVCMD------DLLSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTC 394
           E L ++++V C +CM       D   E HK  +   +  PC H  H  CL+NWM     C
Sbjct: 693 ESLVETNSVDCSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLENWMSYKLQC 752

Query: 395 PICRLPV 401
           P+CR P+
Sbjct: 753 PVCRTPL 759

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 8/69 (11%)

Query: 330 NNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME 389
           NN+ +D K P ++P   ++S   CI+CM  +++           PCGH    +CL NW +
Sbjct: 253 NNEKIDLKNPKILPYIPEESRK-CILCMSFMINPSCA-------PCGHIYCWNCLINWCK 304

Query: 390 RSQTCPICR 398
             + CP+CR
Sbjct: 305 EKEECPLCR 313

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 5/80 (6%)

Query: 334 LDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQ 392
           +DS LP +    L+D++   I C +     + K      LP C H   L C+  W+ +S+
Sbjct: 18  IDS-LPRVEKGKLKDAEACSICCCN---YRDDKYPLVVELPHCNHRFDLECVAVWLSKSR 73

Query: 393 TCPICRLPVFDESGNVKESE 412
           TCP+CR  V     NV  S+
Sbjct: 74  TCPLCRDDVLSHKPNVDVSQ 93

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 8/57 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM ++        E H   +   +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRTPL 758

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 329 KNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           ++++ +D++LPD  PE             +D  +  H    A  LPCGH     CL  W 
Sbjct: 178 ESDQRVDNELPD--PESSAHHTGEQEGGQEDTPTYGHS---ATVLPCGHVFGRECLYKWT 232

Query: 389 ERSQTCPICRLPVFDE 404
               +CPICR P+  E
Sbjct: 233 TEHNSCPICRAPILSE 248

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 329 KNNKNLDSKLPDMIPE----DLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSC 383
           KN K+   +  D +P      ++D +  C +C    L  E K      LP CGH   L C
Sbjct: 76  KNRKSCSKEFIDSLPRIKANSIKDKNAECAICFCKFL--EDKYPLVAELPHCGHRFDLEC 133

Query: 384 LKNWMERSQTCPICRLPVF 402
           +  W+ +S TCP+CR  V 
Sbjct: 134 ISVWLSKSDTCPLCRDSVL 152

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 8/57 (14%)

Query: 353 CIVCMD------DLLSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           C +CM       D +   HK      +  PC H  H  CL+NWM     CP+CR P+
Sbjct: 695 CAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGYKLQCPVCRAPL 751

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 11/70 (15%)

Query: 335 DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC 394
           D K+   IP     S   CI+C++D++            PCGH     CL +W +    C
Sbjct: 276 DEKILPFIPP----SSRNCILCLNDMVDPSCS-------PCGHIFCWRCLMDWCQERAEC 324

Query: 395 PICRLPVFDE 404
           P+CR P   +
Sbjct: 325 PLCRQPCLPQ 334

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 372 RLP-CGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESE 412
           RLP CGH   L CL  W  +S +CP+CR  V      V  S+
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEVDTSQ 133

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 334 LDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQ 392
           +DS LP +   DL+ +D  C +C    L + H      +LP C H   L C+  W+ +S+
Sbjct: 66  IDS-LPRVNKCDLKGAD-ACSICCCGYLDDTHPL--VVKLPHCSHRFDLECVAVWLSKSR 121

Query: 393 TCPICR 398
           TCP+CR
Sbjct: 122 TCPLCR 127

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 348 DSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQT--CPICR 398
           + DN+C +C DDL   +  + K K  PC H  H  C++ W   S    CP+CR
Sbjct: 7   EGDNICPICFDDLNDTDILQGKLK--PCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           +LPCGH     C++ W     TCPICR  +    G
Sbjct: 228 KLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 332 KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS 391
           +++D   P  +P  + +S   CI+C+ ++       K     PCGH    +C+ NW +  
Sbjct: 251 RHVDLSDPAQMPF-INESSRKCILCLTEM-------KDPSCAPCGHIFCWNCIINWCKER 302

Query: 392 QTCPICRLPVFDES 405
             CP+CR     +S
Sbjct: 303 SECPLCRQKCLKQS 316

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 353 CIVCMDDL------LSEEHKKKKAKRL--PCGHFLHLSCLKNWMERSQTCPICR 398
           C +CM  +      +   HK      +  PC H  H  CL+NWM     CP+CR
Sbjct: 703 CAICMSPVPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYKLQCPVCR 756

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 14/74 (18%)

Query: 328 LKNNKNL---DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCL 384
           LK++K++   D  +   IPE+ ++    CI+C++ ++            PCGH     C+
Sbjct: 254 LKDSKHIELSDESVFKFIPEESRN----CILCLNSMVD-------PSAAPCGHIFCWDCI 302

Query: 385 KNWMERSQTCPICR 398
            NW +    CP+CR
Sbjct: 303 INWCKERPECPLCR 316

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPICR 398
           IP+    SD+ C +C  + +++E+       LP CGH     C+  W+ ++ TCP+CR
Sbjct: 93  IPQKKLKSDDTCPICCSNFIADEYPL--VVELPHCGHKFDFECVSMWLTKNTTCPMCR 148

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394
           + LP +  + L  +DN C +C  + L +E+       LP C H   L CL  W+ RS TC
Sbjct: 91  ASLPRINRKKLNSTDN-CSICYTNYLEDEYPL--VVELPHCNHRFDLECLSVWLSRSTTC 147

Query: 395 PICRLPVF 402
           P+CR  V 
Sbjct: 148 PLCRDDVM 155

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394
           S LP +    L+ +DN C +C  + L +E+       LP C H   L CL  W+ RS TC
Sbjct: 98  SSLPRINKRKLKVTDN-CSICYTNYLEDEYPL--VVELPHCHHKFDLECLSVWLSRSTTC 154

Query: 395 PICRLPVF 402
           P+CR  V 
Sbjct: 155 PLCRDDVM 162

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           RLPCGH     CL  W     +CP+CR  + + +G
Sbjct: 272 RLPCGHVFGRECLYKWSRLENSCPLCRHKISESAG 306

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTC 394
           + LP +  + L+ +DN C +C  + L +E+       LP C H   L CL  W+ RS TC
Sbjct: 93  ASLPRINKKKLKATDN-CSICYTNYLEDEYPL--VVELPHCHHKFDLECLSVWLSRSTTC 149

Query: 395 PICR 398
           P+CR
Sbjct: 150 PLCR 153

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 29/88 (32%)

Query: 343 PEDLQDSDNVCIVCMDDLLSEEHK--------KKKAKR--------------LPCGHFLH 380
           P +L + D  C +C++ L ++E+         + K K               +PC H+ H
Sbjct: 131 PNELANDDETCCICLELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIPCQHYFH 190

Query: 381 LSCLKNWM-------ERSQTCPICRLPV 401
             CLK W         R   CP+CR+ +
Sbjct: 191 AGCLKEWFSPQRRGKRRPLVCPLCRMDI 218

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 40/80 (50%), Gaps = 10/80 (12%)

Query: 320  NCKILFQILKNNKNLDSKLPDMIPEDLQDSDNV-CIVCMDDLLSEEHKKKKAKRLPCGHF 378
            NCK++  +    + LD+     +   + + +N+ C VC  D+ +          L CGHF
Sbjct: 1176 NCKVINNLESRVRYLDT--LGQLKTAIANGENISCAVCYSDIYT-------GSILKCGHF 1226

Query: 379  LHLSCLKNWMERSQTCPICR 398
                C+ +W +++ +CP+C+
Sbjct: 1227 FCKDCVTHWFKKNTSCPMCK 1246

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           CI+C++++             PCGH    +C+ NW +  + CP+CR
Sbjct: 318 CILCLNEMTDPSCP-------PCGHLFCWACIMNWCKEREECPLCR 356

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           LPCGH     C+  W +   +CPICR  + ++ G
Sbjct: 279 LPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 347  QDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            Q+ +  C +C+D +        K   L CGHF    C+ +W++    CPIC+
Sbjct: 1261 QNKEFQCTICLDAIT-------KGCMLKCGHFFCEDCIYDWLQTRTICPICK 1305

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 8/60 (13%)

Query: 339 PDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           P++ P  + +    CI+C+ D+            LPCGH    +C+  W      CP+CR
Sbjct: 253 PEIFP-FISEQSRKCILCLADMTDPSC-------LPCGHMFCWACVMQWCNERNECPLCR 304

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 5/50 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICRL 399
           VC +C++D+     K   +   PCGH  H  C++ W   ++   CP+CR+
Sbjct: 5   VCAICLEDICG---KSSTSYLKPCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 7/53 (13%)

Query: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +Q +   CI+C+  ++            PCGH     C+ NW      CP+CR
Sbjct: 270 IQGASRTCILCLSKIVDPSCA-------PCGHLYCWDCILNWCNEKPECPLCR 315

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVF 402
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 246 TCPVCLERMDSE---TTGLITIPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 7/59 (11%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICRLPVFDESGNV 408
           +C +C+D +      K  AK  PC H  H+ C++ W   S    CP CR+     S N+
Sbjct: 18  ICAICLDAI-----DKSIAKLEPCNHKYHIDCIRTWHNYSNDLNCPTCRIETNQLSVNI 71

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 332 KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME-- 389
           K++ S +    P+D       C +C + + S        + +PCGH  HL+C++ W    
Sbjct: 3   KHISSHIAMGCPQD------ECSICWESMPS-----GVGRLMPCGHEYHLACIRKWFHLH 51

Query: 390 -RSQTCPICR 398
             +++CP+CR
Sbjct: 52  SGNRSCPVCR 61

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 7/51 (13%)

Query: 363 EEHKKKKAK-------RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           EEHK+K +        +L CGH     C+  W +   +CPICR  +    G
Sbjct: 228 EEHKEKPSPEYKHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           ++PCGH    SCL  W     +CP+CR
Sbjct: 292 KIPCGHIFGRSCLYEWTRLENSCPLCR 318

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 11/58 (18%)

Query: 341 MIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +IPE  +     CI+C+ D++           LPCGH    +C+ +W      CP+CR
Sbjct: 262 LIPEHSRS----CILCLVDMVDPSC-------LPCGHLFCWNCIMHWCTERSECPLCR 308

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGHF    C+ +W++  +TCPIC+
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICK 1215

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           +LPCGH     CL  W +   TCP+CR
Sbjct: 232 KLPCGHIFGRECLYRWCKLENTCPLCR 258

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 37.4 bits (85), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 22/48 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    CGH  HL C+  W++    CP+   P
Sbjct: 59  CIECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKTRDACPLDNQP 106

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRL 399
            C +C+ D+            L CGHF    C+ +W++  + CP+C++
Sbjct: 1191 CSICLQDI-------SLGSMLKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 11/57 (19%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           IPE    S   CI+C+ D+             PCGH    +CL +W +    CP+CR
Sbjct: 279 IPE----SSRKCILCLMDMTDPSCT-------PCGHLFCWNCLMSWCKERPECPLCR 324

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           +LPCGH     C+  W +   +CP+CR  + + +G
Sbjct: 253 KLPCGHIFGRECIYKWSKLENSCPLCRHKISESAG 287

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 11/64 (17%)

Query: 335 DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC 394
           D K    IPE    S   CI+C+ ++             PCGH     CL +W +    C
Sbjct: 272 DKKQLPYIPE----SSRKCILCLTNMTDPSCA-------PCGHLFCWDCLMSWCKERPEC 320

Query: 395 PICR 398
           P+CR
Sbjct: 321 PLCR 324

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           +LPCGH     CL  W +   TCP+CR
Sbjct: 301 KLPCGHIFGRECLFKWSKVENTCPLCR 327

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 37.0 bits (84), Expect = 0.017,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 22/48 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C  + ++E   +  A    C H  HL C+  W++    CP+   P
Sbjct: 52  CIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 99

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 11/46 (23%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C +C++ + +          + CGHF    C+++W++   +CP+C+
Sbjct: 1226 CTICLNQIYT-------GSIIKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 336 SKLPDMIPEDLQDS-DNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQT 393
           S LP +   DL+D  ++ C +C       + K     +LP CGH     CL  W+ +++T
Sbjct: 16  SSLPRLKLSDLKDPINDSCSICC--CTYADDKYPLISKLPHCGHNFDYECLSIWLSKNKT 73

Query: 394 CPICR 398
           CP+CR
Sbjct: 74  CPMCR 78

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 37.7 bits (86), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 32/75 (42%), Gaps = 4/75 (5%)

Query: 338 LPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPI 396
           LP +   +L   D   I C       E        LP C H   L CL  W+ ++ TCP+
Sbjct: 72  LPRITARNLVKGDECSICCSK---YNEDDYPLVVELPHCSHRFDLECLTPWLLKNSTCPL 128

Query: 397 CRLPVFDESGNVKES 411
           CR  V ++  ++  S
Sbjct: 129 CRDDVMEKVDSIDVS 143

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 48/95 (50%), Gaps = 24/95 (25%)

Query: 322  KILFQILKNNK---------NLDSKLP----DMIPEDLQDSDNV--CIVCMDDLLSEEHK 366
            KI+  ++K  K         NL+S+L     + I +D+  ++++  C +C+  +      
Sbjct: 1091 KIILDVIKRQKFEKNLITISNLNSRLKFLNQNKILQDISSTESILNCSICLTSI------ 1144

Query: 367  KKKAKRLPCGHFLHLSCLKNWMERS--QTCPICRL 399
             +    L CGH+    C+ NW+E+S  + CPIC++
Sbjct: 1145 -EIGSILKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESER 413
           +LPCGH     C+  W     +CP+CR  + + +G  + +E+
Sbjct: 264 KLPCGHIFGRECIYKWSRLENSCPLCRHKISENAGVQRAAEQ 305

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPV 401
            C VC +++            + CGHF   SC+  W++   TCP+C+  V
Sbjct: 1164 CAVCFNEIFV-------GSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPV 401
            C VC +++            + CGHF   SC+  W++   TCP+C+  V
Sbjct: 1164 CAVCFNEIFV-------GSVVKCGHFFCYSCIHTWLKEHNTCPLCKTNV 1205

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 30/78 (38%), Gaps = 3/78 (3%)

Query: 329 KNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           +N    D +     PE  Q  DN      DD     +K    + LPC H     C++ W 
Sbjct: 184 QNGPANDGETASSPPEQEQPKDNEN--SGDDQGKVTYKHSPVQ-LPCSHVFGRECIRQWT 240

Query: 389 ERSQTCPICRLPVFDESG 406
               TCPICR  +    G
Sbjct: 241 NLHNTCPICRANIVGADG 258

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 8/52 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME---RSQTCPICRLPV 401
           C +C D +         AK +PC H  HLSC++ W       +TCP CR+ +
Sbjct: 9   CPICWDSMAD-----NVAKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 8/59 (13%)

Query: 340 DMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           D +P  + ++   CI+C+ D+             PCGH     CL +W +    CP+CR
Sbjct: 274 DQLPY-IPEASRKCILCLMDMTDPSCT-------PCGHLFCWDCLMSWCKERPECPLCR 324

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 337 KLPDMIPEDLQDSDNVCIVCM----DDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS 391
           +LP     +L +S + C +C     DD  +E         LP C H  H  C+K W++++
Sbjct: 194 QLPRTNCAELSNSSDECPICRIAYSDDFETE------ITCLPNCSHHFHFECIKLWLQKN 247

Query: 392 QTCPICRLPVFD 403
             CP+CR  V +
Sbjct: 248 SLCPLCRDNVME 259

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +++    C++C++ +L            PCGH     C+  W    Q CP+CR
Sbjct: 248 IKEDSRKCVLCLNYMLDPSAT-------PCGHLFCWDCIMEWTLERQECPLCR 293

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           CI+C+ ++            LPCGH     C+ +W + +  CP+CR
Sbjct: 277 CILCLMEMTDPSC-------LPCGHVFCWDCITDWTKENPECPLCR 315

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 346 LQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPICRLPVFDE 404
           +++ D +C +C      +++       LP C H+  L C+  W++++ +CPICR  V ++
Sbjct: 108 IKNKDEICSICRCKFFDDDYPL--IIELPNCKHYFDLECITLWLQKNSSCPICRNDVLEK 165

Query: 405 SGNVKESE 412
              + +S+
Sbjct: 166 KFKIDDSQ 173

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVF 402
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 240 TCPVCLERMDSE---TTGLITIPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 37.0 bits (84), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 14/69 (20%)

Query: 342 IPEDLQDS-----------DNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWME 389
           +PE   DS           D+ C +C    L + +      +LP C H   L C+  W+ 
Sbjct: 68  VPEGFSDSLPRVATTHLSPDDTCAICCCVYLEDSYPL--VVKLPNCNHKFDLQCITLWLS 125

Query: 390 RSQTCPICR 398
           +S TCP+CR
Sbjct: 126 KSSTCPMCR 134

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGHF    C+ +W++ +Q+CP+C+
Sbjct: 1214 IKCGHFFCRKCIHSWLKNNQSCPLCK 1239

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 337 KLPDMIPEDLQDSD-NVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
           K P    +++QD++   C VC++ L SE         +PC H  H  CL  W +    CP
Sbjct: 210 KDPFTAKKEVQDTELPTCPVCLERLDSE---VTGLATIPCQHTFHCVCLNKWGD--NRCP 264

Query: 396 ICR 398
           +CR
Sbjct: 265 VCR 267

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 375  CGHFLHLSCLKNWMERSQTCPICRLPV 401
            CGH    SC+ +W++  +TCP+C+ P 
Sbjct: 1179 CGHLFCTSCIFSWLKNRKTCPLCKHPT 1205

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 35.8 bits (81), Expect = 0.047,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 9/52 (17%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWME------RSQTCPICR 398
           C +CM+++   E      + LPC H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGPHE---PLGELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 16/63 (25%)

Query: 345 DLQDSDNV---------CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
           DLQD   +         CI+C+  ++            PCGH     CL NW +    CP
Sbjct: 262 DLQDPAELSFIPSESRKCILCLSLMVDPSCA-------PCGHLFCWDCLLNWSKERPECP 314

Query: 396 ICR 398
           +CR
Sbjct: 315 LCR 317

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 12/63 (19%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCP 395
           ++LP  IPE    +   CI+C+ ++             PCGH    SCL +W +    CP
Sbjct: 274 NQLP-FIPE----ASRKCILCLMNMSDPSCA-------PCGHLFCWSCLMSWCKERPECP 321

Query: 396 ICR 398
           +CR
Sbjct: 322 LCR 324

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +P     +++ C +C  + L + +    AK   C H   L CL  W++ + TCP+CR
Sbjct: 60  VPNSKLKAEDTCAICQCNFLDDPYPLV-AKVPRCNHKFDLECLSIWLQNNHTCPMCR 115

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 36.2 bits (82), Expect = 0.061,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 24/57 (42%), Gaps = 11/57 (19%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           IP D +     CI+C+  +L            PCGH     CL +W      CP+CR
Sbjct: 95  IPSDSRK----CILCLGFMLDPSCA-------PCGHVFCWKCLLSWCNERPECPLCR 140

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 35.4 bits (80), Expect = 0.062,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 56  CIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 103

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 7/58 (12%)

Query: 361 LSEEHKKK-------KAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKES 411
           LS+E KK+           L CGH     C+  W + + +CPICR  +    G ++ S
Sbjct: 210 LSKEPKKEHTPTYKHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREGLIQRS 267

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 330 NNKNL-DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM 388
           N+ NL D ++   IPED +     CI+C+  +             PCGH     C+ +W 
Sbjct: 260 NHLNLSDKEIFPFIPEDARK----CILCLAYMTDPSCS-------PCGHIFCWECILDWC 308

Query: 389 ERSQTCPICR 398
           +    CP+CR
Sbjct: 309 KERPECPLCR 318

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICRL 399
            + CGHF   SC+ +W+     CP+C++
Sbjct: 1177 IKCGHFFCKSCIHSWLRNKNACPLCKM 1203

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 5/51 (9%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVF 402
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 170 ACPVCLERMDSE---TTGLITIPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 362 SEEHKKK---KAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERP 414
            EE +KK      +LPC H     CL  W +   +CP+CR  + +    V+  +RP
Sbjct: 287 GEESQKKYLHSPVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVE----VQPEQRP 338

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 18/107 (16%)

Query: 302  LPMIVLKDIIWDLISLYQNCKILFQILKNNK---NLDSKLPDM-----IPEDLQDSDNV- 352
            +P+I LK       S+ +N K    + KN++   NL S+L  +     + E L++ +   
Sbjct: 1165 VPLIQLKPST--RASILKNVKDNTLLSKNSQKINNLQSRLKYLETLTKLKEGLKNENTFN 1222

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRL 399
            C +C+ ++            + CGHF   SC+ +W++   +CP+C++
Sbjct: 1223 CTICLGEIY-------MGSVIKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 18/26 (69%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGHF   SC+ +W++   +CP+C+
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESG 406
           +LPCGH     C+  W     +CP+CR  + +  G
Sbjct: 254 KLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG 288

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 35.0 bits (79), Expect = 0.076,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           CI C    +++   +  A    C H  HL C+  W++    CP+
Sbjct: 55  CIQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQTRNACPL 98

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ L SE         +PC H  H  CL  W  +   CP+CR
Sbjct: 246 TCPVCLERLDSE---VTGLATIPCQHTFHCQCLNKW--KDSRCPVCR 287

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 35.8 bits (81), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 340 DMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPICR 398
           D IP DL      C +C ++   +E+       LP C H   L C+  W+  + TCP+CR
Sbjct: 80  DKIPNDL------CSICFENFREDEYPL--VIELPHCSHKFDLQCISVWLSSNSTCPVCR 131

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 335 DSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC 394
           +S+LP  IP+    +   CI+C++ +             PCGH     C+ +W +    C
Sbjct: 263 ESQLP-YIPQ----ASRSCILCLNAMTDPSCA-------PCGHIFCWDCILSWCKERPEC 310

Query: 395 PICR 398
           P+CR
Sbjct: 311 PLCR 314

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.4 bits (85), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSE---TSGLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 35.4 bits (80), Expect = 0.088,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 83  CIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQTRNACPLDNQP 130

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 35.8 bits (81), Expect = 0.088,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 36/88 (40%), Gaps = 24/88 (27%)

Query: 324 LFQILKNNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLP--------- 374
           ++ I KN   LD  + D       + ++VC +C     +  H      R P         
Sbjct: 15  VWDIPKNEDRLDESMAD-------EDEDVCGICR----ASYHAPCPNCRYPGESCAIVLG 63

Query: 375 -CGHFLHLSCLKNWMERSQT---CPICR 398
            CGH  H+ C+  W++   +   CP+CR
Sbjct: 64  RCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 332  KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS 391
            KNL SK+ D+I    Q+    C +C++ +            + CGHF    C+ +W++  
Sbjct: 1134 KNL-SKIQDLIE---QNKSFNCPICLNTIYM-------GSIIKCGHFFCKHCIFSWLKNK 1182

Query: 392  QTCPICR 398
              CPIC+
Sbjct: 1183 SVCPICK 1189

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 34.7 bits (78), Expect = 0.096,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 47  CIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 94

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H SCL  W +    CP+CR
Sbjct: 267 TCPVCLERMDSE---TTGLITIPCQHTFHCSCLDKWND--SRCPVCR 308

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 332  KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS 391
            KNL S+L D I E+   S   C +C+ ++       +    + CGH+   SC+  W+   
Sbjct: 1226 KNL-SRLKDTINENQVLS---CSICLGEV-------EVGAIIKCGHYFCKSCILTWLRSH 1274

Query: 392  QTCPICR 398
              CPIC+
Sbjct: 1275 SKCPICK 1281

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSE---TTGLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 3/46 (6%)

Query: 356 CMDDLLSEEHKKK---KAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            +D + SEE           LPC H     CL  W     TCP+CR
Sbjct: 259 GVDTIQSEEDSPTYLHSPTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSE---TTGLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 34.7 bits (78), Expect = 0.12,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 54  CIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 101

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ + SE         +PC H  H  CL  W  ++  CP+CR
Sbjct: 239 TCPVCLERMDSE---TTGLVTIPCQHTFHCQCLNKW--KNSRCPVCR 280

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 34.7 bits (78), Expect = 0.13,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++      A    C H  HL C+  W++  + CP+   P
Sbjct: 67  CIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKTREACPLDNQP 114

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 34.7 bits (78), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    ++E   +       C H  HL C+  W++    CP+   P
Sbjct: 56  CIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKTRDACPLDNQP 103

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 34.3 bits (77), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           CI C  + +++   +  A    C H  HL C+  W+     CP+
Sbjct: 53  CIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLTRNACPL 96

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 34.7 bits (78), Expect = 0.15,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 68  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQTRDACPLDNQP 115

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           +LPCGH     C+  W     +CP+CR
Sbjct: 337 KLPCGHIFGRDCIFKWSHLENSCPLCR 363

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICRLPVF 402
           +PC H  H  CL  W  ++  CPICR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 13/26 (50%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICR 398
           LPC H     CL  W     TCP+CR
Sbjct: 262 LPCHHIFGRECLYKWTRHENTCPLCR 287

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRL 399
            C +C+ ++            + CGHF    C+ +W++   +CP+C++
Sbjct: 1189 CTICLGEIY-------MGSVIKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 8/47 (17%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           VC+  MD L++          +PC H  H  CL  W  ++  CP+CR
Sbjct: 243 VCLEKMDSLVT------GLITIPCSHTFHCQCLDKW--KNSKCPVCR 281

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (10%)

Query: 336 SKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMER-SQTC 394
           SK+  + P    DS   C +C +D     +K      L C H  H  C+  W+ R S  C
Sbjct: 105 SKVESLGPG--ADSRTTCAICQEDF----NKLNNVCLLGCNHVFHTYCIDQWICRNSACC 158

Query: 395 PICR 398
           P+C+
Sbjct: 159 PLCK 162

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C +C+ D+            +  GHF    C+ +W+E  Q+CP+C+
Sbjct: 1219 CTICLCDICD-------GAIIGRGHFYCQECISSWLETKQSCPLCK 1257

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 113

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 113

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 66  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 113

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 67  CIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 114

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 34.3 bits (77), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 63  CIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 110

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 349 SDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICR 398
           SD  C +C      EE K+ +    PC H  HL C++ W   +    CP CR
Sbjct: 2   SDLECAICF-----EEFKEDRCALNPCHHTFHLECIRIWHSYADDLKCPTCR 48

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ L  E         +PC H  H  CL  W  ++  CP+CR
Sbjct: 237 TCPVCLEQLDCE---TTGLITIPCQHTFHCQCLDKW--KNSRCPVCR 278

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +C VC++ L SE          PC H  H  CL  W  ++  CP+CR
Sbjct: 214 MCPVCLEKLDSE---VTGLVTTPCQHTFHCKCLDQW--KNGNCPVCR 255

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 45/108 (41%), Gaps = 25/108 (23%)

Query: 299 PLNLPMIVLKDIIWDLISLYQNCKILFQILKNN--------KNLDSKLPDMIPEDLQDSD 350
           P    ++ +K++++    L ++CK  F  L ++        K +D + P           
Sbjct: 187 PETCHVVYIKEVVFKKRLLPEDCKSDFPYLLHDPFTNELTTKGIDREFPS---------- 236

Query: 351 NVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
             C VC++ + S+         +PC H  H  CL  W  +   CP+CR
Sbjct: 237 --CPVCLERMDSD---ITGLITIPCQHTFHCQCLDKW--KDSRCPVCR 277

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 33.5 bits (75), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 20/44 (45%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPI 396
           CI C  + +++   +  A    C H  HL C+  W+     CP+
Sbjct: 59  CIQCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLTRNACPL 102

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 372 RLPCGHFLHLSCLKNWMERSQTCPICR 398
           +LPC H     CL  W +   +CP+CR
Sbjct: 243 KLPCDHIFGRECLYKWSKLENSCPLCR 269

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
            C VC++ L   +        +PC H  H  CL  W  ++  CP+CR
Sbjct: 234 TCPVCLERL---DDGTTGLITIPCQHTFHCQCLDKW--KNSKCPVCR 275

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 33.5 bits (75), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 63  CIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKTRDACPLDNQP 110

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 375 CGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESE 412
           C H   L C+  W+ +S TCP+CR  V +   N+  S+
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNIDTSK 107

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 372 RLP-CGHFLHLSCLKNWMERSQTCPICR 398
           +LP CGH   L C+  W+    TCP+CR
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCR 136

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 330  NNKNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM- 388
            NNK +  K      +  +  +++C++C   L     KK     LPCGH  H  C++ W  
Sbjct: 1265 NNKKIMDKFGYWYCDSCKKRNSLCVLCERPL-----KKLTMVLLPCGHEGHFQCIQEWFL 1319

Query: 389  -ERSQTCP 395
             E+ + CP
Sbjct: 1320 NEKERECP 1327

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 332  KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS 391
            KNL S+L D + E+   S   C +C+ D+       +    + CGH+   +C+  W+   
Sbjct: 1223 KNL-SRLKDTLNENQILS---CSICLGDV-------EIGAIIKCGHYFCKNCILTWLRAH 1271

Query: 392  QTCPICR 398
              CPIC+
Sbjct: 1272 NKCPICK 1278

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 33.1 bits (74), Expect = 0.42,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 21/48 (43%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           CI C    +++   +  A    C H  HL C+  W++    CP+   P
Sbjct: 61  CIECQPMAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 108

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 350 DNVCIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERSQTCPICRLPVF 402
           D+ C +C      ++H       LP C H   L C+  W+ +S +CP+CR  V 
Sbjct: 100 DDSCPICCCTYKEDDHPL--VAELPHCNHKFDLECISVWLSKSTSCPLCRDDVM 151

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICR 398
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCR 274

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICR 398
           +C +C++ +    ++  + + LPC H  H+SC++ W   S    CP CR
Sbjct: 4   ICGICLESM----NETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGH+   SC+  W+     CPIC+
Sbjct: 1252 IKCGHYFCKSCILTWLRAHSKCPICK 1277

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 344 EDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMER-SQTCPICR---- 398
           +++ D +  C++C +      ++    + L C H  H  C+  W+ R S  CP+C+    
Sbjct: 101 KNVSDEEESCVICQEQF----NELNNIRVLGCSHIFHSHCIDRWICRNSACCPLCKRSYS 156

Query: 399 LPV 401
           LPV
Sbjct: 157 LPV 159

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
           Anc_3.405 YPR093C
          Length = 93

 Score = 32.3 bits (72), Expect = 0.62,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS--QTCPICRL 399
           +C +C+     EE  ++  +  PC H  H  C++ W   +    CP CR+
Sbjct: 8   MCAICL-----EEGHEEFGELHPCRHKFHKECIRRWHTGAIDLKCPTCRI 52

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 12/25 (48%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICR 398
           PCGH     C+ +W      CP CR
Sbjct: 242 PCGHIFCWDCIVDWCRERPECPFCR 266

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   L + + K        C +  H SCL  W   S   TCP+CR
Sbjct: 1537 CAICYSTLHAVDRKLPTKVCPTCNNKFHGSCLYKWFRSSNNNTCPLCR 1584

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 375 CGHFLHLSCLKNWMERS--QTCPICRL 399
           CGH  HL+C++ W + S    CPICR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 373 LPCGHFLHLSCLKNWMERSQTCPICR 398
           LPC H     CL  W +   +CP+CR
Sbjct: 216 LPCNHVFGRECLFKWSQLENSCPLCR 241

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 18/26 (69%)

Query: 373  LPCGHFLHLSCLKNWMERSQTCPICR 398
            + CGHF   +C+ +W++ +  CP+C+
Sbjct: 1284 ISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 32.7 bits (73), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 375 CGHFLHLSCLKNWMERSQT---CPICR 398
           C H  H+ C++ W+E +     CP+CR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 11/68 (16%)

Query: 351 NVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQT--CPICRLPVFDESGNV 408
           + C +C + L      K   + + CGH  H +C++ W   S+   CP CR+    +S ++
Sbjct: 2   DSCPICFESL-----SKGACRLVECGHKYHFNCIRRWHYHSKNLQCPTCRI----KSRHL 52

Query: 409 KESERPAT 416
           ++ ER  T
Sbjct: 53  EDIERKVT 60

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 32.3 bits (72), Expect = 0.85,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 19/48 (39%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLP 400
           C+ C  +       +  A    C H  HL C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLDNKP 102

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCP 395
            C++C   L     KK     LPCGH  H  C++ W   E  Q CP
Sbjct: 1293 CVLCERPL-----KKLTMVILPCGHEGHFQCIQEWFLDENEQECP 1332

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 34.3 bits (77), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H SCL  W   S   TCP+CR
Sbjct: 1501 CAICYS-ILHAVDRKLPTKTCPTCNNKFHGSCLYKWFRSSGNNTCPLCR 1548

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1512 CAICYS-ILHAVDRKLPSKTCPTCKNRFHGACLYKWFRSSGNNTCPLCR 1559

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 44/103 (42%), Gaps = 42/103 (40%)

Query: 338 LPDMIPEDLQD---------SDNVCI---------VCMDDLLSEE---HKKKKA------ 370
           L ++IPEDLQ+         +D  C          V ++D+L +E   + + KA      
Sbjct: 48  LSELIPEDLQNEWFDSLADKNDKGCKETFVSSLPRVSINDILKQEIIRNPEIKAAHLNCS 107

Query: 371 --------------KRLP-CGHFLHLSCLKNWMERSQTCPICR 398
                          +LP CGH     C+  W+ +++TCPICR
Sbjct: 108 ICYCKYTDDDYPLIAQLPHCGHHFDFECISIWLSKNETCPICR 150

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1508 CAICYS-ILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1555

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 350  DNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCP 395
            +++C++C   +     KK     L CGH  H  C KNW   E   TCP
Sbjct: 1343 NSLCVICECPM-----KKLTLTALRCGHEAHFQCFKNWFLDEGMNTCP 1385

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1510 CAICYS-ILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1557

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 332  KNLDSKLPDMIPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS 391
            KNL S+L D + E+   S   C +C+ ++       +    + CGH+   +C+  W+   
Sbjct: 1219 KNL-SRLKDTLNENQILS---CSICLGEV-------EIGAIIKCGHYFCKNCILTWLRAH 1267

Query: 392  QTCPICR 398
              CPIC+
Sbjct: 1268 SKCPICK 1274

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1505 CAICYS-ILHAVDRKLPSKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1552

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1514 CAICYS-ILHAVDRKLPSKTCPTCNNKYHGACLYKWFRSSGNNTCPMCR 1561

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ V +
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H +CL  W + S   TCP+CR
Sbjct: 1537 CAICYS-VLHAVDRKLPTKTCPTCKNKFHGACLYKWFKSSGNNTCPLCR 1584

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 7/45 (15%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCP 395
            CI+C   L     KK     LPCGH  H  C++ W   E+   CP
Sbjct: 1284 CILCERPL-----KKLTMVILPCGHEGHFQCIQEWFLDEKEHECP 1323

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1503 CAICYS-ILHAVDRKLPTKTCPTCNNKFHGACLYKWFRSSGNNTCPMCR 1550

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
            YOL138C
          Length = 1365

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 350  DNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNW--MERSQTCP-ICRLPV 401
            +++C++C + +     KK     L CGH  H  C K W   E   +CP  C  P+
Sbjct: 1314 NSLCVLCEEPM-----KKMTISLLACGHEGHFDCFKKWFIQEAMDSCPGGCTHPI 1363

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 16/47 (34%)

Query: 369 KAKRLPCGHFLHLSCLKNWME------RSQT----------CPICRL 399
           K  +LPC H+ H  C+K+W        +S T          CP+CRL
Sbjct: 182 KVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1506 CAICYS-ILHAIDRKLPSKTCPTCKNRFHGACLYKWFRSSGNNTCPLCR 1553

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 375 CGHFLHLSCLKNWMERSQT---CPICR 398
           C H  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 374 PCGHFLHLSCLKNWM---ERSQTCPICR 398
           PCGH     CL NW+    +   CP CR
Sbjct: 44  PCGHNFCYGCLNNWITGGSKDLNCPQCR 71

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 7/50 (14%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQ--TCPICRL 399
            C +C++ L      +   + + C H  HL C++ W   SQ   CP CR+
Sbjct: 5   TCSICLEAL-----GQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1505 CAICYS-ILHAVDRKLPTKTCPTCNNKFHGACLYKWFRSSGNNTCPLCR 1552

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1496 CAICYS-ILHAVDRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCR 1543

>CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|P32917 Saccharomyces
           cerevisiae YDR103w STE5 pheromone signal transduction
           pathway protein
          Length = 600

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 350 DNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICR 398
           +++C +C D+ ++ +   +K   L CGH  H+ CL  ++  S   PIC+
Sbjct: 37  NHICTLC-DEPIAYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICK 83

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 12/25 (48%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICR 398
           PCGH     CL  W      CP+CR
Sbjct: 272 PCGHTYCWDCLFKWCNERPECPLCR 296

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   +   S  CP C++ V +
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K   K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1510 CAICYS-ILHAVDRKLPTKTCPTCKNKFHGACLYKWFRSSGNNTCPLCR 1557

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C   + + S  CP C++ + +
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>Kwal_47.16850 s47 complement(142657..143478) [822 bp, 273 aa] {ON}
           YDL218W - Hypothetical ORF [contig 219] FULL
          Length = 273

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 18/88 (20%)

Query: 118 KIFYWILKDRLEFLI--------------QSNTNYSVSRFIFSKFYLNLIILSTINLQLI 163
           +IF W+L+  L+F+               Q  T+YS++  + S  YL LIIL  +   + 
Sbjct: 17  RIFLWVLRC-LQFMTSVATVGLLAYVMDTQGTTSYSLAISVISVVYLILIILIPVEANVY 75

Query: 164 KTCIPLNYEF-LKKLYLNSTSILQSLIN 190
             C+ L +EF +  L+L +  I+Q +I+
Sbjct: 76  AVCV-LVFEFVVASLWLGA-CIVQGIIS 101

>TBLA0A03050 Chr1 complement(731447..732532) [1086 bp, 361 aa] {ON}
           Anc_5.339 YDR313C
          Length = 361

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 342 IPEDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMER 390
           IP D       C +C +DLL +E    K  RL C    H  C+K W ++
Sbjct: 290 IPADSTAKIQECPICFEDLLPDE----KIGRLECLCVFHYRCIKRWYKK 334

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   L + + K        C +  H +CL  W   S   TCP+CR
Sbjct: 1507 CAICYSILHAVDRKLPNKTCPTCKNRFHGACLYKWFRSSGNNTCPLCR 1554

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W + S   TCP+CR
Sbjct: 1492 CAICYS-ILHVVDRKLPSKVCPTCSNRFHGACLYKWFKSSGNNTCPLCR 1539

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 4/33 (12%)

Query: 375  CGHFLHLSCLKNWMERSQTCPI---CRLP-VFD 403
            C H LHL C K W   S+ CP    C  P +FD
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCPNMFD 1118

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   L + + K        C +  H +CL  W   S   TCP+CR
Sbjct: 1490 CAICYSILHAVDRKLPTKTCSTCKNKFHGACLYKWFRSSGNNTCPLCR 1537

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 4/49 (8%)

Query: 353  CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICR 398
            C +C   +L    +K  +K  P C +  H +CL  W   S   TCP+CR
Sbjct: 1520 CAICYS-ILHAVDRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCR 1567

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPV 401
           PCGH +H  C   +++ S  CP C + V
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSV 417

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 168  PLNYEFLKKLYLNSTSILQSLINYSSPSSTHASNFNLGVNPIY 210
            PL + F K L+ ++TS  QS  N  +P++T   +FN GV+P++
Sbjct: 1576 PLAFNFGKPLFPSNTSSFQSFQNPFTPAAT---SFNTGVSPVF 1615

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 7/48 (14%)

Query: 350  DNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCP 395
            + +C++C   L     KK     LPCGH  H  C++ W   E    CP
Sbjct: 1275 NTLCVLCERPL-----KKLTMVILPCGHEGHFQCIQEWFLNENEHECP 1317

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 4/50 (8%)

Query: 352 VCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWM--ERSQTCPICRL 399
            C +C+DD     + +      PC H  H  CL+ W        CPICR+
Sbjct: 4   TCPICLDD--DRTNIESIGTLQPCNHKFHRDCLRRWHLYAHDLVCPICRV 51

>TDEL0C03510 Chr3 (612431..616339) [3909 bp, 1302 aa] {ON} Anc_7.488
           YBL047C
          Length = 1302

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 9/85 (10%)

Query: 271 LENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDI---IWDLISLYQNC---KIL 324
           +E K  ++ I D   ++    +   + +P  L   + +D    IWDL  ++ N    K+ 
Sbjct: 265 MEKKQQFDAIFDSLDKARTGSLSSQVLVPFFLSSKLNQDTLASIWDLADIHNNAEFTKLE 324

Query: 325 FQI---LKNNKNLDSKLPDMIPEDL 346
           F I   L   KN   +LPD++P+ L
Sbjct: 325 FAIAMFLIQKKNAGVELPDVVPDQL 349

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 9/24 (37%), Positives = 14/24 (58%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPIC 397
           PCGH     C++ ++ R   CP+C
Sbjct: 42  PCGHTFCSICIREYINRQSKCPLC 65

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
           similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 270 GLENKFIYEKIIDLF----TRSLMTMIHISLALPLNLPMIVLKDIIWDLISLYQNC---K 322
           G + K  ++ I D      T SL   + ++  L   L    L  + WDL  ++ N    K
Sbjct: 345 GFDKKRQFDAIFDSLDKNHTGSLGAAVLVNFFLSSRLSQETLASV-WDLADIHNNAEFTK 403

Query: 323 ILFQI---LKNNKNLDSKLPDMIPEDL 346
           + F I   L   KN   +LPD+IP+ L
Sbjct: 404 VEFAIAMFLIQKKNAGVELPDVIPDQL 430

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTC------PICR 398
           C +C++  +S     +K   L CGH +H  CL  + E   +C      P CR
Sbjct: 162 CCLCLE-YISCRTVGEKVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 4/40 (10%)

Query: 363 EEHKKKKAKRLP----CGHFLHLSCLKNWMERSQTCPICR 398
           +E+KK +    P    C H    SCL  W +   +CP+CR
Sbjct: 321 DENKKHEYHNSPVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 965

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 342 IPEDLQDSDNVCIVCMDD--LLSEEHKKKKAKR-------LPCGHFLHLSCLKNWMERSQ 392
           +P  +  + N C V +DD   ++E  ++K+ K        L C H +H    + W ER  
Sbjct: 893 LPIVINGTTNSCEVRIDDDAKINEVKERKRLKMNEWFSFCLKCNHGMHAGHAEEWFERHS 952

Query: 393 TCPI 396
            CP+
Sbjct: 953 ICPV 956

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
           YBL047C
          Length = 1414

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 271 LENKFIYEKIIDLFTRSLMTMIHISLALPLNLPMIVLKDI---IWDLISLYQNC---KIL 324
           L+ K  ++ I D   +S    +  S+ +P  L   + ++    IWDL  ++ N    K+ 
Sbjct: 270 LDKKKQFDTIFDTLDKSHQGQLGSSVLVPFFLSSKLNQETLASIWDLADIHNNAEFTKVE 329

Query: 325 FQI---LKNNKNLDSKLPDMIPEDL 346
           F I   L   KN   +LPD+IP+ L
Sbjct: 330 FAIAMFLIQKKNAGIQLPDVIPDQL 354

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 7/50 (14%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLP-CGHFLHLSCLKNWMERS--QTCPICRL 399
           C +C++  + +E+K+    RL  C H  HL+C++ W + S    CPICR+
Sbjct: 4   CPICLE--IDQEYKQ--FGRLEVCRHQFHLNCIREWHKYSIDLKCPICRI 49

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 9/26 (34%), Positives = 16/26 (61%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRL 399
           PCGH     C++ +++ +  CP+C L
Sbjct: 42  PCGHTFCSVCIREYLQSNSKCPLCLL 67

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 7/45 (15%)

Query: 353 CIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPIC 397
           C +C D L       K +   PCGH     C++ ++++   CP+C
Sbjct: 32  CHICKDFL-------KASVLTPCGHSFCSICIRKYLQKESKCPLC 69

>TDEL0D00860 Chr4 (158917..160293) [1377 bp, 458 aa] {ON} Anc_4.332
           YML068W
          Length = 458

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 344 EDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNW 387
           E ++ S+  C +CM     E  K  K   LPCGH L L C K++
Sbjct: 171 EKMERSNFDCCICM-----ETKKGSKMIALPCGHLLCLLCTKSY 209

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 375 CGHFLHLSCLKNW--MERSQTCPICR 398
           C H  H +C++ W    +S  CP+CR
Sbjct: 22  CQHNFHFNCIRQWHLTSKSLECPVCR 47

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPIC 397
           PCGH     C++ ++ +   CP+C
Sbjct: 42  PCGHTFCSLCIRGYLNKEPKCPLC 65

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1310

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 7/54 (12%)

Query: 344  EDLQDSDNVCIVCMDDLLSEEHKKKKAKRLPCGHFLHLSCLKNW-MERSQT-CP 395
            E     + +C+VC   +     K      L CGH  H  C+++W +E   T CP
Sbjct: 1255 ESCNKRNKLCVVCEKPM-----KGLTMSVLQCGHGGHFECMRDWFLEEGMTDCP 1303

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 16/30 (53%)

Query: 374 PCGHFLHLSCLKNWMERSQTCPICRLPVFD 403
           PCGH +H  C +     S  CP C++ V +
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,575,432
Number of extensions: 1965213
Number of successful extensions: 9043
Number of sequences better than 10.0: 274
Number of HSP's gapped: 9228
Number of HSP's successfully gapped: 283
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)