Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0D016605.122ON56456428100.0
NDAI0C031105.122ON56456426010.0
TDEL0E050805.122ON56356225950.0
CAGL0M07920g5.122ON56456425590.0
Smik_12.1065.122ON56356325270.0
Suva_10.1285.122ON56356325180.0
KAFR0E020205.122ON56456425150.0
Skud_12.1105.122ON56356325140.0
YLR044C (PDC1)5.122ON56356325060.0
NCAS0A14630na 1ON56356225050.0
ZYRO0F01606g5.122ON56356324920.0
KLLA0E16303g5.122ON56356224880.0
ACL134C5.122ON58656424820.0
KLTH0B01188g5.122ON59356224810.0
Kpol_1010.485.122ON56356324590.0
NDAI0A01400na 1ON56356224580.0
SAKL0G10164gna 2ON56456424490.0
SAKL0G14894g5.122ON56456424470.0
Ecym_24795.122ON56456424230.0
TBLA0B075205.122ON56356324170.0
Suva_10.227na 3ON56356324080.0
TBLA0B10060singletonON56456424020.0
TPHA0H009505.122ON56356324010.0
TPHA0Q00120singletonON56356323980.0
KAFR0E01520singletonON56356323920.0
Smik_12.197na 3ON56356323910.0
Skud_12.203na 3ON56356323880.0
Kwal_33.155405.122ON56456223850.0
Suva_7.369na 4ON56356323840.0
YLR134W (PDC5)na 3ON56356323790.0
YGR087C (PDC6)na 4ON56356323470.0
NDAI0A02510singletonON56356323460.0
TBLA0D02840singletonON56356323340.0
SAKL0F04334gsingletonON56456323310.0
NCAS0A14240singletonON56556423300.0
AAL073Wna 2ON56356223220.0
KNAG0M012505.122ON56356323190.0
KNAG0J01330singletonON56456422680.0
TBLA0E03070singletonON56356322640.0
NDAI0D03270singletonON52152022020.0
KNAG0J01340singletonON56556221960.0
KLTH0D08272gsingletonON56356221950.0
CAGL0G02937gna 4ON56456321210.0
Ecym_3185na 2ON56356320090.0
SAKL0E04972g2.390ON61154818590.0
KLTH0E09702g2.390ON60754916200.0
ZYRO0A08426g2.390ON58454616140.0
YDL080C (THI3)2.390ON60955416120.0
Suva_4.1672.390ON62055416080.0
Kwal_47.178782.390ON61054916060.0
KNAG0A059002.390ON62055715840.0
TDEL0G032102.390ON60656715780.0
Skud_4.1752.390ON62055415690.0
CAGL0L06842g2.390ON63858115690.0
Smik_4.1562.390ON62155415630.0
TPHA0G026202.390ON68859315510.0
KAFR0F029902.390ON60855615160.0
NCAS0A040002.390ON62556815170.0
TBLA0B088202.390ON63558615080.0
NDAI0E017002.390ON62156814960.0
Ecym_60552.390ON59256013660.0
ADR254W2.390ON58155313211e-177
Kpol_1046.92.390ON59855911461e-150
KLLA0F16962g2.390ON5785538701e-109
CAGL0A03102g5.456ON6496028681e-108
SAKL0G03036g5.456ON6376008601e-107
Suva_2.5545.456ON6356068411e-104
KLTH0F15510g5.456ON6256018391e-104
Kpol_1062.125.456ON6305908311e-102
Smik_4.6495.456ON6356098231e-101
YDR380W (ARO10)5.456ON6356068231e-101
NCAS0A118305.456ON6376128171e-100
Skud_4.6515.456ON6356048161e-100
ACR211W5.456ON6296017943e-97
TPHA0J026805.456ON6486267936e-97
ZYRO0G04378g5.456ON6136057891e-96
KAFR0E037305.456ON6356017813e-95
TBLA0A026705.456ON6406177771e-94
Kpol_440.45.456ON6366037594e-92
KNAG0C047905.456ON6376007561e-91
TBLA0A064205.456ON6386137552e-91
TDEL0D024505.456ON6756067433e-89
SAKL0D00220gsingletonON5775747354e-89
TPHA0E016005.456ON6515967188e-86
KLLA0E02707g5.456ON6316057037e-84
KLTH0D00418gsingletonON5615626281e-73
NDAI0A044505.456ON5615466141e-71
TDEL0C07020singletonON5605646081e-70
TDEL0F00150singletonON5605626072e-70
Skud_7.383na 4ON86922143e-20
Kwal_26.75822.441ON6792971867e-14
YMR108W (ILV2)2.441ON6873111868e-14
NDAI0H023802.441ON6853001822e-13
CAGL0K03465g2.441ON6773101761e-12
KAFR0A005702.441ON6825071742e-12
TBLA0I014002.441ON7103091742e-12
Smik_13.2972.441ON6873101743e-12
KNAG0A062502.441ON6803101715e-12
KNAG0E023602.441ON6933111707e-12
SAKL0E03740g2.441ON6793061672e-11
KLTH0D04532g2.441ON6783021653e-11
NCAS0F015002.441ON6843091644e-11
Kpol_297.122.441ON6713101626e-11
TPHA0G024402.441ON6913031626e-11
TDEL0B055201.450ON5552901626e-11
Suva_13.2872.441ON6873041627e-11
KLLA0B12584g2.441ON6915291618e-11
ZYRO0E03454g1.450ON5492841609e-11
ZYRO0G19954g2.441ON7003121591e-10
TDEL0A021602.441ON6823051591e-10
NCAS0A043202.441ON6893091592e-10
Skud_13.2672.441ON6873041563e-10
NCAS0G039601.450ON5772971554e-10
Ecym_61072.441ON6893101554e-10
AEL305C2.441ON6683071521e-09
NDAI0E020502.441ON6903141511e-09
Ecym_13601.450ON5444871492e-09
TPHA0G028852.441ON6883031484e-09
Smik_5.871.450ON5605141474e-09
YEL020C1.450ON5605131431e-08
Skud_5.761.450ON5605131422e-08
AEL055C1.450ON5454781304e-07
Kwal_34.161161.450ON5532941118e-05
KNAG0H015801.450ON5602621082e-04
TPHA0B039401.450ON5753061082e-04
Suva_5.681.450ON561298980.002
KLTH0H14102g1.450ON551288950.007
SAKL0D10934g1.450ON550133930.011
Kpol_1061.501.450ON571125920.014
CAGL0M03245g1.450ON56254790.52
NDAI0G005201.450ON575344770.92
TBLA0C015601.450ON582274761.4
KAFR0H028901.450ON56054732.5
Smik_10.1291.253ON176997715.5
TDEL0C027907.418ON2786149715.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0D01660
         (564 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...  1087   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122   1006   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...  1004   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   990   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   978   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   974   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   973   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   972   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   969   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   969   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   964   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   962   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   960   0.0  
KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...   960   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   951   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              951   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   947   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   947   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   937   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   935   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   932   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   929   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   929   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      928   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   926   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   925   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   924   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...   923   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   922   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   920   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   908   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   908   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   903   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   902   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            902   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   899   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   897   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   878   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              876   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              852   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   850   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   850   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   821   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   778   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   720   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   628   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   626   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   625   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   624   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   623   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   614   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   612   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   608   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   608   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   606   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   602   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   588   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   588   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   585   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    580   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   530   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   513   e-177
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   446   e-150
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   339   e-109
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   338   e-108
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   335   e-107
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   328   e-104
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   327   e-104
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   324   e-102
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   321   e-101
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   321   e-101
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   319   e-100
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   318   e-100
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   310   3e-97
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   310   6e-97
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   308   1e-96
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   305   3e-95
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   303   1e-94
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   296   4e-92
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   295   1e-91
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   295   2e-91
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   290   3e-89
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   287   4e-89
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   281   8e-86
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   275   7e-84
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   246   1e-73
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   241   1e-71
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   238   1e-70
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                238   2e-70
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    87   3e-20
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    76   7e-14
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    76   8e-14
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     75   2e-13
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    72   1e-12
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    72   2e-12
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    72   2e-12
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    72   3e-12
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    70   5e-12
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    70   7e-12
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    69   2e-11
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    68   3e-11
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    68   4e-11
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    67   6e-11
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    67   6e-11
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    67   6e-11
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    67   7e-11
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    67   8e-11
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    66   9e-11
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    66   1e-10
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    66   1e-10
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    66   2e-10
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    65   3e-10
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    64   4e-10
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    64   4e-10
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    63   1e-09
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    63   1e-09
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    62   2e-09
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     62   4e-09
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    61   4e-09
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    60   1e-08
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    59   2e-08
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    55   4e-07
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    47   8e-05
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    46   2e-04
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    46   2e-04
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    42   0.002
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    41   0.007
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    40   0.011
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    40   0.014
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    35   0.52 
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    34   0.92 
TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.4...    34   1.4  
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    33   2.5  
Smik_10.129 Chr10 complement(203537..208846) [5310 bp, 1769 aa] ...    32   5.5  
TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7....    32   5.6  

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/564 (95%), Positives = 540/564 (95%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVI                       
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLVAQAKLTASINAKQD
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQD 564

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/564 (86%), Positives = 522/564 (92%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q+DVKTIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLKAND EAE EV+ TIL+L+K AKNP+ILADACASRHDVKAET+KLIDITQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPA+K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKIKNATFPGVQMKF LQKLL  +                       
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TPLKQEW+WNQVGKFLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEE+DPKKRVILF G+GSLQLTVQEISTMVRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ+W+HL+LLPTFGAKDYENHRV+TTGEW KLT NKEFNQN+RIR+IEIML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLVAQA+LTA INAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAKQD 564

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/562 (84%), Positives = 515/562 (91%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q+D  TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI +APAEIDRCIRTTYV+QRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLKANDAEAE EV++ +L L+K+AKNP+ILADAC SRHDVK ETRKLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL  +                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQ+W+WNQVGKFLQEGDVVI+ETGTSAFGINQ+HFPN TYGISQVLWGSIGF TG
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGEKA YNDIQ W++L+LLPTFGAKDYE HRVSTTGEW+KLT++ EFN+N++IRMIE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
           PVMDAPS+LVAQA+LTASINAK
Sbjct: 541 PVMDAPSSLVAQAQLTASINAK 562

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/564 (85%), Positives = 517/564 (91%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLNQ+DVKTIFGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY+TQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK ND EAE EV++T+L+L+K+AKNP+ILADACASRHDVKAET+KLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL  +                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TPLKQEW+WNQV KFLQEGDVVI+ETGTSAFGINQT FPNN YGISQVLWGSIGF TG
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGEKA YNDIQNW+HL LLPTFGAKDYENHRV+TTGEWDKLT +KEFN+N++IRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAP++L+ QAKLTASINAKQ+
Sbjct: 541 PVMDAPTSLIEQAKLTASINAKQE 564

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  978 bits (2527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/563 (84%), Positives = 512/563 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL Q++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPID+SLKANDAE+E EVI+TIL LVK AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD++KI+NATFPGVQMKFVLQKLLTVI                       
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQ+G FLQEGDVVI+ETGTSAFGINQT FPNNTYGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG KA YN+IQNW+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN N++IRMIE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  974 bits (2518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/563 (83%), Positives = 512/563 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERLNQ++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPID+SLK NDAE+E EVI+TIL LVK AKNPIILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD++KI+NATFPGVQMKFVLQKLLT +                       
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQ+G+FLQEGDVVI+ETGTSAFGINQ  FPNNTYGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG KA YN+IQNW+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN+N++IRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  973 bits (2515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/564 (83%), Positives = 508/564 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERL Q+DVKTIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EV++TIL L+K AKNP+IL+DACASRHDVKAET++LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN++EFHSDY KI+NATFPGVQMKFVL+KLL  +                       
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPL QEW+WNQ  KF QEGDV+I+ETGTSAFGINQ+ FPNN+ GISQVLWGSIGF  G
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RWNLKPYLFVLNNDGYTIERLI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGEKA YNDIQNW+HL LL TFGAKDYENHRV+TTGEWD L  +KEFN+N+RIRMIE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLV QAK+TA+ NAKQD
Sbjct: 541 PVMDAPSNLVQQAKITAATNAKQD 564

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  972 bits (2514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/563 (83%), Positives = 510/563 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSE+TLGKYLFERL Q++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPID+SLK NDAE+E EVI+TI+ LVK AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS PA+K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKFVLQKLLT I                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQ+G FLQEGDVVI+ETGTSAFGINQT FPNNTYGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLF+LNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG KA YN+IQNW+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN N++IRMIEIML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/563 (83%), Positives = 508/563 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL Q++V T+FGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L TPID+SLK NDAE+E EVI+TIL LVK AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD++KI+NATFPGVQMKFVLQKLLT I                       
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQ+G FLQEGDVVI+ETGTSAFGINQT FPNNTYGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG KA YN+IQ W+HL+LLPTFGAKDYE HRV+TTGEWDKLT +K FN N++IRMIEIML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QAKLTA+ NAKQ
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAKQ 563

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/562 (84%), Positives = 511/562 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q++V TIFGLPGDFNL+LLDKIYE+PGMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAMVTD+A A +EIDRCIRTTYVTQR VYLGLPAN+ DLKV ASL
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLK NDA AE EV+ETIL LVK AKNPIILADAC SRHDVKAET+KLIDITQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PR+GGVYVGTLS+P +KQ+VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSD+IKIK+ATFPGVQMKFVLQKLL VI                       
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TP+KQEW+WN++ KF QEGDV+I+ETGTSAFGINQT FP N YGISQVLWGSIGFATG
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNN GYTIERLI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGEKA YNDIQ W HLNLL TFGAKDYENHRVSTTGEW+KLT+NK+FNQN+RIR+IEIML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
            VMDAPSNLVAQA+LTASINAK
Sbjct: 541 EVMDAPSNLVAQAQLTASINAK 562

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/563 (80%), Positives = 502/563 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q+D  TIFG+PGDFNLSLLDK+YE+ G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++ LITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDI  APAEIDRCIR  YV QRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK ND EAE EV++T+L+L+K AKNP+ILADAC SRHDVKAET+KLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLSSP +K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSD+IKI+NATFPGVQMKFVL+KLL  +                       
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            ST LKQEWLW QVG FL+EGDVVI+ETGTSAFGINQTHFPN TYGISQVLWGSIG+ TG
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A+YN IQ W+HL LL TFGAKDYENHRVST GEW+KLT + +FN+N+RIRMIE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
            VMDAPS+LVAQA+LTA+ NAKQ
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAKQ 563

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/562 (82%), Positives = 507/562 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q++V+TIFGLPGDFNLSLLD IYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TDI TAPAEIDRCIRTTYV+QRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLK ND EAE EVIE +L L+K AKNP+ILADAC SRHD KAET+KLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE+HPRFGGVYVGTLSSPA+K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDY KI++ATFPGVQMKF LQKLLT +                       
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+W QVG+FL+EGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN IQNW+HL LLPTFGAKDYE  RVSTTGEW+KLT++++F  NTRIR+IE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
           P MDAPSNLV QA+LTA+ NAK
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAK 562

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/564 (82%), Positives = 511/564 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL QI+V+TIFGLPGDFNLSLLDKIYE+ GMRWAGNANELNAAYAADG
Sbjct: 23  MSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 82

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 83  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 142

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS TTAM++DI +APAEIDRCIRT Y+TQRPVYLGLPAN+VDLKVPASL
Sbjct: 143 DFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPASL 202

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDL+LK ND EAEAEV+ET+L+++ +AKNP+IL+DACASRHDVKAET KLID+TQF
Sbjct: 203 LETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQF 262

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSI EQHPRFGGVYVGTLSSP +K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 263 PAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 322

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSD+IKI+NATFPGVQMK+VL+KL+  +                       
Sbjct: 323 YKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEID 382

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TPLKQEWLWNQVGKFL+EGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 383 SATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 442

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEE+DP +RVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIERLI
Sbjct: 443 ACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 502

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YNDIQ W+HLNLLPTFGAKDYE  RVSTTGEWD LT +K FN+N++IRMIE+ML
Sbjct: 503 HGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVML 562

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLV QA+LTA+ NAKQ+
Sbjct: 563 PVMDAPSNLVKQAELTAATNAKQE 586

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/562 (79%), Positives = 502/562 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+Y+FERL Q+DV T+FGLPGDFNL LLD+IYE+ GMRWAGN NELNA+YAAD 
Sbjct: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDL+LK ND +AE EVI T+L+++K AKNP+ILADACASRHDVKAET+KLIDITQF
Sbjct: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPA+K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSD+IKI+NATFPGVQMKFVLQ LL  +                       
Sbjct: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQ+WLWNQVG+FLQEGD+V++ETGTSAFGINQTHFPNNTYGISQVLWGSIG+ATG
Sbjct: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEE+D  KRVILFTGEGSLQLT QEISTMVRWNLKPYLFVLNN GYTIE+LI
Sbjct: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN+IQNW HL+LLPTFGAKDYE  RVSTTGEW+KL  +K+FN+N++IR+IE+ML
Sbjct: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 570 PVMDAPESLVKQAQLTAATNAK 591

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/563 (82%), Positives = 504/563 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q+ V+TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAM+TDIA APAEIDRCIRTTY+TQR VYLGLPAN+VDL VPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L TPIDLSLK ND EAE EV++TIL +VK AKNPIILADACASRHDVKAET++LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGSIDEQHPRFGGVYVGTLS P +K +VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNVVEFHSD+ KIK A+FPGVQMKFVLQKL+  I                       
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEWLWNQVGKFLQEGD+V++ETGTSAFGINQTHFPNNTYGISQVLWGSIGF  G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKR I+F G+GSLQLTVQEISTM+RWNLKPY+FVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQNW+HL++LPTFGAKDYE  RV+TTGE++KL  +K FN+N++IRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNLVAQAKLTASINAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTASINAKQ 563

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/562 (84%), Positives = 512/562 (91%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q++V TIFGLPGDFNLSLLDKIYE PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDAEAEAEV+E +L L+K+AKNP+ILADAC SRHDVK ETRKLIDITQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQ+PRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKFVLQKLL  +                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQVGKFLQEGD+VI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPK+RVILF G+GSLQLTVQEISTMVRWNLKPYLF+LNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ+WEHL LL TFGAKDYENHRV+TTGEW+KL  NKEFN N+RIR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
           PVMDAP +L+ Q +LTA INA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/564 (83%), Positives = 512/564 (90%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG YLFERLNQ+DVKTIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLK ND EAEAEV+ ++L+L+K AKNPIILADACASRHDVK ET++LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS+  +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL+ I                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQVG+FLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAA AAEE+D  KRVILF G+GSLQLTVQEISTM+RW L+PYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN+IQ W++L+LLPTFGAKDYE +RV+TTGEWDKL  ++ FN+N+RIRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLV QA+LTASINAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQD 564

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  947 bits (2447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/564 (82%), Positives = 514/564 (91%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERLNQ++V+TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA VTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLK ND EAEAEV+ T+L+L+K AKNP+ILADACASRH+VK+ET++LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPRFGGVYVGTLS+  +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKF LQKLL+ +                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WNQVG+FLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAA AAEE+D  KRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN+IQ W++L+LLPTFGAKDYE +RV+TTGEWDKL  ++ FN+N+RIRM+E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLV QA+LTASINAKQ+
Sbjct: 541 PVMDAPSNLVKQAQLTASINAKQE 564

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/564 (79%), Positives = 506/564 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEIT+G YLF+RL Q++V+TIFGLPGDFNL+LLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISE+TAM+TD+ATA  EIDRCIRT Y++QRPVYLGLPANLVD KVPASL
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPID SLK NDAEAE EV+ T+L+++ ++KNP+IL+DACASRHDVK ET++LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLSSP +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+ K++NATFPGVQMKFVL+KL+ V+                       
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TPL+QEW+W +V +FL+EGDVVI+ETGTSAFGINQTHFPN+TYGISQVLWGSIGF TG
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YNDIQ W+HL LLPTFGAKDYE  RVST GEW +LT +K F++N++IRMIE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLV QA+LTA+ NAKQD
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAKQD 564

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/563 (80%), Positives = 502/563 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M+EITLGKYLFERLNQ+ V+TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETTAM+TDIATAPAEIDRCIRTTYV QR VYLGLPANLVDL VPASL
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDAEAE EVIET+L+LV+ AKNPII+ADAC SRHDVK+ET +LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSI+E+HPRFGGVYVGTLS P +K +VESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IK+KNATFPGVQMKFVLQKL++ I                       
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TPLKQEWLWNQ+G FLQEGD+V++ETGTSAFGINQT FP +TYGISQVLWGSIGF  G
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           C LGAAFAAEEI+P KR ILF G+GSLQLTVQEIST++RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ W HL +LPTFGAKDYE  RV+TTGEW KLT++K F +N++IRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNLVAQAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAKQ 563

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 497/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL+Q+D  T+FGLPGDFNLSLLDK+YE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPID++LK NDAEAEAEV+ T++++++ AKNP+ILADACASRHDVKAET+KLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD+IKI+NATFPGVQMKF LQ+LL+ I                       
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STP+KQEW+WNQ+  FLQEGD+VI+ETGTSAFGINQT FP + Y I QVLWGSIGF  G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN++Q W+HL LLPTFGAKDYE HRV TTGEWDKLT +KEF  N+RIRMIE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/564 (80%), Positives = 503/564 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERLNQ+ V+TIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS++SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMSA ISETTAM+TDIA APAEIDRCIRTTYVTQR VYLGLPANLVDL VPASL
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDL+LK N  E+E+EVIETILD+VK+AKNPII+ADACASRH+VK ET +LIDITQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E+HPRFGGVYVGTLS P IKQ+VESADLILSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD++KIKNATF GVQMKFVL+KL+  I                       
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPLKQEWLWNQ+G FLQEGD+V++ETGTSAFGINQT FP +TYGISQVLWGSIGF  G
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           C LGAAFAAEEI+P KR ILF G+GSLQLTVQEIST++RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ W HL +LPTFGAKDYE  RV+TTGEWDKLT++K FN+N++IRMIEIML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAPSNLVAQA+LTA+INAKQD
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAKQD 564

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/563 (79%), Positives = 500/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERL Q+  +TIFGLPGDFNLSLLDKIYE+PGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK ND +AE EV+  IL+L+K AKNPIILADACASRHDVKAET+ LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD+IKI+ A+FPGVQMKFVL+KL+  +                       
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPLKQEWLWNQVGKFL+EGD+V++ETGTSAFGINQTHFP NTYGISQVLWGSIGF  G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKR I+F G+GSLQLTVQEISTM+RWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQNW+HL++LPTFGAKDYE  RV+TTGEWDKL S+K FN+N++IRMIEIML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNL+AQAKLTA+ NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAKQ 563

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 500/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS+ITLGKYLFERL Q+   TIFGLPGDFNLSLLDKIYE+PGMRWAGN NELNAAYAADG
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSA ISETT+M+TDIA+A AEIDRCI+ TY++QR VYLGLPAN+VDL VPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK ND +AE EV+  IL+L+K AKNPIILADACASRHDVKAET+ LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDEQHPRFGGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y TKN+VEFHSD+IKI+ A+FPGVQMKFVL+KL+  +                       
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPLKQEWLWNQVGKFL+EGD+V++ETGTSAFGINQTHFP NTYGISQVLWGSIGF  G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDPKKR I+F G+GSLQLTVQEISTM+RWNLKPY+FVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN+IQNW+HL++L TFGAKDYENHRV+TTGEWDKL S++ FN+N++IR+IEIML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNL+AQAKLT + NAKQ
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAKQ 563

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/563 (79%), Positives = 499/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q+DVKTIFGLPGDFNL+LLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTA++TDIATA AEIDRCI+TTY+TQRPVYLG+PAN+ D K+PA L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK ND EAE EVI+ IL LVK+AKNP+IL+DACASRH+V+ ETR+LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSIDEQHPR+GGVYVGTLS P +K++VES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSDY KIKNATFPGVQMKFVLQKL  VI                       
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPL QEW+WNQ  KF QEGD++I+ETGT+AFGINQ+ FP +  GISQVLWGSIGF  G
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEE+D  +RVILF G+GSLQLTVQEISTM+RWNL+PYLFVLNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN+IQNW+HL LL TFGAKDYENHR++TTGEWD L SNK+FN+N+RIR+IEIML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNLV QAK+TA+ NA+Q
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQQ 563

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/563 (78%), Positives = 496/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL+Q+   T+FGLPGDFNLSLLDK+YE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG++C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDIA APAEIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDAEAEAEV+ T+++++K AKNP+ILADACASRHDVKAET+KLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLS P +K+ VE+ADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKF LQKLL  I                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TP+KQEW+WNQ+  FLQEGD+VI+ETGTSAFGINQT FP + Y I QVLWGSIGF  G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEEIDPKKRVILF G+GSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  ADYN+IQ W+HL LLPTFGAKDYENHR++TTGEWDKLT +K+F  N+RIR+IE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QA+LTASINAKQ
Sbjct: 541 PVFDAPENLVQQAQLTASINAKQ 563

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/563 (78%), Positives = 498/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL+Q++  T+FGLPGDFNLSLLDK+YE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA+AP+EIDRCIRTT+ TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPID+SLK NDAEAEAEV+ T+++++K AKNP+ILADACASRHDVKAET+KLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKG+IDEQHPR+GGVYVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSD+IKI+NATFPGVQMKF LQKLL  I                       
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +T +KQEW+WNQ+G FLQEGD+VI+ETGTSAFGINQT FP + Y I QVLWGSIGF  G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEE+DPKKRVILF G+GSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN++Q+W+HL+LLPTFGA+DYE HR++TTGEWDKLT +K+F  N+RIRMIE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/562 (81%), Positives = 505/562 (89%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q++  TIFGLPGDFNL LLD+IYE  GMRWAGNANELNAAYAAD 
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM++D+ATAPAEIDRCIRTTYV QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDA AE EV+ T+LDL+K+AKNP+ILADACASRHDVKAET+KLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPA+K++VES+DLILSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKFVLQKLLT +                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQ+WLWNQVGKFLQEGDVVI+ETGTSAFGINQTHFPNNTYGISQVLWGSIGF TG
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEE+D  KRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNN+GYTIE+LI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN+IQ W HL+LLPTFGAKDYE  RV+TTGEW+KL  ++EFN+N++IRMIE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPESLVKQAQLTAATNAK 562

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/563 (79%), Positives = 499/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q++V TIFGLPGDFNLSLLDKIYE+ G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+S LITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS NISETT+M+TDIATAP+EIDR IRTT+VTQRP YLGLPANLVDLKVPASL
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+ PIDLSLK ND EAE EVI+T+L+L++ +KNPIIL+DACASRH VK ET+KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS P +KQ+VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSDYIK+KNATFPGVQMKF LQKLL+VI                       
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEWLWN++ KFLQEGDV++SETGTSAFGINQT FP + YGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEE+DP +RVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN+IQ W+HL LLPTFGAK YENH+V+TTGEWDKLT + EF +N+ IR+IE+ L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP +L+ QA+LTA+ NAKQ
Sbjct: 541 PVFDAPESLIKQAELTAATNAKQ 563

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/563 (77%), Positives = 496/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL+Q++  T+FGLPGDFNLSLLDK+YE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAM+TDIA APAEIDRCIRTTY TQRPVYLGLPANLVDL VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSLK NDAEAEAEV+ T+++L+K AKNP+ILADACASRHDVKAET+KL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P +VTPMGKG+IDEQHPR+GGVYVGTLS P +K++VESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+IKI+NATFPGVQMKF LQKLL  I                       
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            +TP+KQEW+WN +G FL+EGD+VI+ETGTSAFGINQT FP + Y I QVLWGSIGF  G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA  AAEE+DPKKRVILF G+GSLQLTVQEISTM+RW LKPY+FVLNN+GYTIE+LI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN+IQ W+HL LLPTFGA++YE HRV+TTGEW+KLT +K+F  N++IRMIE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP NLV QA+LTA+ NAKQ
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAKQ 563

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/563 (78%), Positives = 496/563 (88%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL Q++V TIFGLPGDFNLSLLDKIYE+ G+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KG+S L+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPSIS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETT+M+TDIATAP+EIDR IRTT++TQRP YLGLPANLVDLKVP SL
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+ PIDLSLK ND EAE EVI+T+L+L++++KNP+IL+DACASRH+VK ET+KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDEQHPR+GGVYVGTLS   +KQ+VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKNVVEFHSDY+K+KNATF GVQMKF LQ LL VI                       
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEWLWN++ KFLQEGDV+ISETGTSAFGINQT FP + YGISQVLWGSIGF TG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAAFAAEEIDP KRVILF G+GSLQLTVQEISTM+RW LKPYLFVLNNDGYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A+YN+IQ W+HL LLP FGAK YENH+++TTGEWD LT++ EF +N+ IR+IE+ L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PV DAP +L+ QA+LTA+ NAKQ
Sbjct: 541 PVFDAPESLIKQAQLTAATNAKQ 563

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/563 (75%), Positives = 486/563 (86%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL+Q+ V TIFGLPGDFNL+LLDK+YE+ GMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG PS +SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETTAM+TDI  APAEIDRCIRTTY+ QRPVYLG+PAN  DLKVPA+L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSL  N+ EAE E +  +L+LVK +KNPII+ DACASRHDVKAET KLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVGTLS P +K++VESADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y TK+VVEFHSDY++IK ATFPGVQMKF+L KL  +I                       
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            ST LKQ WLWNQ+ KFL+EGD+VI ETGTS FGIN+T FP N   ISQVLWGSIGFATG
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           CTLGA  AAEE+DPK+RVILFTG+GSLQLTVQEISTM+RWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ+WEHL LL TFGAKDYEN+RVSTTG W+++T +K+FN+N++IRMIE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAP +L+ Q +LTA IN+K 
Sbjct: 541 PVMDAPESLIKQGELTAQINSKH 563

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 490/563 (87%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS++TLG+YLFERLNQI ++TIFGLPGDFNL LLDKIYEIPGMRW GNANELNAAYAADG
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+ +QAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  F+RMS+ ISET  M+ D+ TAPAEIDRCI+T YV QRPVYLGLP NLV+  VP SL
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L TPIDLSL+ NDA++E+EVI+TIL++VK AKNPII+ADACASRHDVKAET KLIDITQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSFVTPMGKGSI+EQHPRFGGVYVGTL+ P +K++VESADLILS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNV+EFHSD+ KIKNA + G+QMKFVL KL+T I                       
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPL+QEWLWNQ+G FLQEGD+V++ETGTSAFGINQT+FP NTYGISQVLWGSIGF  G
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           C LGAAFAAEEIDPKKRV+LF G+GSLQLTVQEISTMV WNLKPYLFVLNNDGYTIERLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ W +L LL TFGAKDY+  RV+TTGEW+ LT N EFNQN++IRMIE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           P MDAPSNL++QA+LTASINAKQ
Sbjct: 541 PTMDAPSNLISQAELTASINAKQ 563

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/563 (76%), Positives = 493/563 (87%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q+ V+TIFGLPGDFNLSLLDKIYE+PG+RWAGNANELNAAYAADG
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSC++TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS+SSQA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+ ISETTA++TDI  AP EIDRCI+ TY  QRPVYLGLPANLVDLKV ASL
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLS+  NDA+AE EV+ET+L +V  AKNP+ILADAC +RHDVK ET+KLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPRFGGVYVGTLS P +K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDY K++NATFPGVQMK VLQKLL+ +                       
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+WN +  +L+EGDVVI+ETGTSAFGINQ+ FPN+TYGISQVLWGSIG++ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEE+D  +RVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YND+Q W HLNLLPTFGAKDY++ R+STTGE+ KLT ++ F++N++IR+IE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPS LV QA+LTA+ NAKQ
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAKQ 563

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/564 (77%), Positives = 489/564 (86%), Gaps = 2/564 (0%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS I+LG+YLFERL+Q+ V TIFGLPGDFNL+LLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS SSQAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMS+NISETT++VTD+A APAEIDRCIR TY+ QRPVYLG+PAN  DL + A L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLSL  ND EAE E I+ +L LVK A NPIIL DACASRHDVK ET+KLIDITQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+I+EQHPR+GGVYVG L+ PAIK++VESADLILSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
            KTKNVVEFHSDY+KI+NA+FPGVQMKFVLQKL   +                       
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STP+KQEW+WNQ+ KFLQEGD+VISETGTS FGINQT FPNNT GISQVLWGSIGFATG
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           CTLGA  AAEEIDPKKRVILFTG+GSLQLTVQEISTMVRWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKD--YENHRVSTTGEWDKLTSNKEFNQNTRIRMIEI 538
           HGE A YN+IQ W HL L   FGAK+  +ENHRVSTTGEW+KLT +K+F  NT+IRMIE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 539 MLPVMDAPSNLVAQAKLTASINAK 562
           MLPVMDAP++L+ QAKLTASINAK
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAK 564

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/562 (77%), Positives = 493/562 (87%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLG+YLFERL Q++V+TIFG+PGDFNLSLLDK+YE+ GMRWAGNANELNA+YAADG
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+K +SCL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANIS+TTA++TDI++APAEIDRCIR  YV QRPVYLGLPAN+VDL VPASL
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+T IDLSLK ND EAE EV+ T+L+LV +AK+P+IL+DACASRHDVK ET++LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDEQHPRFGGVYVGTLS+P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSD+ KI++ATFPG++MK VLQ L+  I                       
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPLKQEWLWNQV  FL+EGD+VI+ETGT+AFGINQT FP++T GISQVLWGSIGF TG
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDP KRVILF G+GSLQLTVQEISTMVRW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HGE A YN IQ W+HL+LLPTFGAKDYE HRV+TTGEW  LT  +EFN+N+ IRMIEIML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
            VMDAPS+L+ QAKLTA+ NA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/563 (77%), Positives = 491/563 (87%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M ++TLG+YLFERL Q+DVKTIFGLPGDFNLSLLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFTVFHRMSANISETTAMVTDI TAPAEIDRCIRTTYVTQRPVYLGLPANLVDL VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDL+LK ND EAE EVIET+L+L++ A NP+ILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  ++ +VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           YKTKN+VEFHSDYIKI+NATFPGVQMKFVL KLL V+                       
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             T L+QEW+WN+V KF ++GD++++ETGT+AFGINQ+ FPNNT GISQVLWGSIGF  G
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGA+FAAEEIDP KRVILF G+GSLQLTVQEIST++RW+LKPYLFVLNN+GYTIERLI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN IQ W H  LL  FGA DYEN +++TTGEW  LT +K+FN+ ++IRMIE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNL+AQAKLTA IN+K+
Sbjct: 541 PVMDAPSNLIAQAKLTACINSKK 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/564 (74%), Positives = 487/564 (86%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS ++LG YLFERL Q+ V TIFGLPGDFNL LLDKIY+IPGMRW GNANELNA+YAADG
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  SQAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETTA++TD++ A +EIDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLKAN+ E+E+EV++TILDLV  AKNPIILADACASRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTPMGKGSIDE HPR+GG+YVGTLSSPA+K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD+IKI+NA FP +QMK +LQKL+T I                       
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
            STPLKQEW+W ++G FLQEGD+VI+ETGTSAFGIN T FP NT GISQVLWGSIGF  G
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LGAAFAAEEIDP +RVILF G+GSLQLTVQEIST ++WNLKPYLF+LNN+GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ+WEHL LLPTFGAKDYE  R++T GEW+KLT +KEFN+N+RIR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQD 564
           PVMDAP +L+ Q +LTA+INAK+D
Sbjct: 541 PVMDAPESLIKQGQLTAAINAKKD 564

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/563 (74%), Positives = 483/563 (85%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEITLGKYLFERL Q++V TIFGLPGDFNL+LLDKIYE+PGMRWAGNANELNAAYAADG
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPS +SQAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMS  ISETTAM+TD++ A ++ID CIR TY TQRPVYLG+PAN+ D  +PA L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPI++ L  N+ E+E EV+ETIL +VK AKNP+I+ADAC SRH+VKAET KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+F TPMGKGSI+E HPRFGGVYVGTL+ P +K++VESADLILSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKN+VEFHSD+IKIKNATF GVQMKFVL +L+  I                       
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPL+QEWLWNQ+G FLQEGD+V++ETGTSAFGIN T FP NTYGI+QVLWGSIGF  G
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
           C LGAAFAAEEIDPKKRV LF G+GSLQLTVQEISTM+RWNLKPYLFVLNN+GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQ W+HL++LPTFGA DYE  RV+T GEW+KLT++ +FN+N++IRMIEIML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           PVMDAPSNL+AQ KLT +INA Q
Sbjct: 541 PVMDAPSNLIAQGKLTEAINAAQ 563

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/520 (76%), Positives = 449/520 (86%)

Query: 43  MRWAGNANELNAAYAADGYARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP 102
           MRWAGNANELNAAYAADGYAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLHVVG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 103 SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
           S +SQAK LLLHHTLGNGDFTVFHRMS+N+SETTAM+TD+ TAPAEIDRCIRTTY+ QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 163 VYLGLPANLVDLKVPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACA 222
           VYLG+PAN  DLKVPA+LL+TPIDL L  N+ EAE E ++ IL+L+K +KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 223 SRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLI 282
           SRHDVKAET KLI++TQFP FVTPMGKG+I+EQHPR+GGVYVGTLS P +K++VESADLI
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 283 LSVGALLSDFNTGSFSYSYKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXX 342
           LSVGALLSDFNTGSFSYSYKTKN+VEFHSDYIKI+NATFPGVQMKFVL KL  +I     
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 343 XXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPN 402
                              +TPLKQ W+WNQ+ KFL+EGDVVI ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 403 NTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNL 462
           N  GISQVLWGSIG+ATGCTLGA  AAEE+DP KRVILFTG+GSLQLTVQEISTM+RWNL
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 463 KPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLT 522
           +PYLF+LNN+GYTIE+LIHG  A YN+IQ+W+HL LL TFGAKDYENHRV+TTGEW KLT
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 523 SNKEFNQNTRIRMIEIMLPVMDAPSNLVAQAKLTASINAK 562
            NK+FN+N+RIR+IE+MLPVMDAP +L+ Q +LTA INAK
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAK 520

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/562 (73%), Positives = 475/562 (84%), Gaps = 1/562 (0%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS I+LG YLFERL Q+ V TIFGLPGDFNL LLDKIY++PG+RWAGNANELNAAYAADG
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVG PS  SQA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSA ISETT M+TD   A  +IDRCIRTTYV QR VYLG+PAN+ D ++P SL
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSLKAN+  +E +V++TIL  VK AKNPII++DACASRHDVK ET++LI+ITQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P+FVTP+GKGSIDE HPR+GG+YVGTLS P +K++VESADLILSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y+TKNVVEFHSD++KIKNA FPGVQM+ +L+KLL  I                       
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 361 XST-PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFAT 419
            +T PL+QEW+WNQ+ +FLQEGD++I+ETGTSAFGIN T FP N  GISQVLWGSIGF  
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERL 479
           G  LGAAFAAEEIDPKKRVILF G+GSLQLTVQEISTM++WNLKPYLF+LNN+GYTIE+L
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 480 IHGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIM 539
           IHG  A+YN+IQ+W+HL LLPT GAKDYE  RV+T GEW+KLT +KEFN+N+RIR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 540 LPVMDAPSNLVAQAKLTASINA 561
           LPVMDAP +L+ Q KLT  INA
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINA 562

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/562 (73%), Positives = 470/562 (83%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS ITLG+YLFERL Q++  TIFGLPGDFNL LLD+IYE+ GMRWAGN NELNAAYAADG
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKG++CLITTFGVGELSALNG+ GSYAEHVGVLHVVGVPS++SQAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF VFHRMSANIS+TTAMVTD+ATAP EIDRCIRTTYVTQRPVYLGLPAN+V+  V   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDLSL+ ND + E EV+  +L LV+ A+NPIILADAC SRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P FVTPMGKGS+ E+HPRFGGVYVGTLSSP +K +VE+ADLILS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y T+NVVEFHSD+ K++NA FP V MKFVLQKL+  I                       
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPL QEWLW Q+G+FL+EGDVV++ETGTSAFGINQT FPNNTYGISQVLWGSIGF TG
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
            TLGAA AAEE+D  KRVILF G+GSLQLTVQEIS+MVRW L+PYLFV NNDGYTIE+LI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG  A YN+IQNW HL LLPTFGA DYE  RV+TTGEWD LT++  FN+N+RIR++E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
            VMDAPS+LV QA+LTA+ NA+
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQ 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/563 (70%), Positives = 466/563 (82%), Gaps = 1/563 (0%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M+EITLG+YLFERL+QI + TIFGLPGDFNL+LLDKIYE+ G+RWAGNANELNAAYAADG
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YARLKGM+CL+TTFGVGELSALNGIAGSYAEHVGVLHVVGVPS  S+AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DF  FHRMS+ ISETT +V+D  TAPAEIDRCIR  Y+TQRPVYLG+PAN+ D KV + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           LDTPIDL+L+ N  +AE EV++ I+ ++K++K PIILADAC SRHDVK ET++LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           PSF TPMGKGSIDE  PRFGGVYVG LS P +K  VE +DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
             T+NV+EFHSD++KI+NATFPGVQMKFVL+KLL  +                       
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 361 XST-PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFAT 419
                +KQEW+W  VGKFLQEGDVV++ETGTS FGI ++ FP NT GISQVLWGSIG+A 
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERL 479
           G T+GAAFAA+EIDPKKRVILF G+GSLQLTVQE+ST  RW L PY+FVLNN+GYTIERL
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 480 IHGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIM 539
           IHGE   YNDIQ+W+H  +LP FGAK+YEN RV+T GEW+ + ++K+FN+N ++RMIE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 540 LPVMDAPSNLVAQAKLTASINAK 562
           LP MD P NL  QAKLTASINAK
Sbjct: 541 LPTMDGPENLKKQAKLTASINAK 563

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/563 (64%), Positives = 447/563 (79%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MSEI++G+YLFERLNQ+ VKTIFGLPGDFNLSLLDK+YE+PG+RWAGNANELNAAYAADG
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120
           YAR+ GM CL+TTFGVGELSA+NGIAGSYAE + VLHVVGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180
           DFT FHRM   I++TTA+++D ATA +EIDRCI+T  +T  PVYLG+PAN+    + ASL
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           L+TPIDLS + ND +AE EVI+ +L L+++A+NPIIL+DACASR+D+K E + LIDITQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P++VTPMGK S++EQHPR+GGVY G++S P +K++VESADLILS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX 360
           Y TK++VEFHS +  IKNATF GVQMKFVLQKL   +                       
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 361 XSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
             TPL Q+WLW +V  FL+EGD+VI+E+GT AFGIN+   P  T  ISQ+LWGSIG+  G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480
             LG   A +EIDP +RVILF G+GSLQL VQE+STM+RW LKPYLFVLNNDGYTIERLI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
           HG +A YNDIQ W HL LLP FGAK+YE  R+ST G W +LT + EFN++++IR+IE++L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 541 PVMDAPSNLVAQAKLTASINAKQ 563
           P +D+   LV QAK+   IN+K+
Sbjct: 541 PRLDSTDALVKQAKMITDINSKR 563

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/548 (59%), Positives = 427/548 (77%), Gaps = 1/548 (0%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I+LG YLF+RL Q+ V+TIFGLPGDFN++LLDKIYE+PG+RWAGN NELNAAYAADGYAR
Sbjct: 14  ISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNAAYAADGYAR 73

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           +KG+ CL+TTFGVGELSA+NGIAGS+AEHV VLHVVG+P+  +Q K+LLLHHTLGNGD+ 
Sbjct: 74  IKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLHHTLGNGDYA 133

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM+AN++  T +++D  TA  EID+C++  +  QRPVYLG+P NL ++ V  S+L  
Sbjct: 134 VFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANMIVDGSMLQI 193

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           P+DLSLK ND E E +V+ +I+  +K AKNP+I+ADAC +RHDV  ETR+L+D+TQFP F
Sbjct: 194 PLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRLVDLTQFPVF 253

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+IDEQHPRFGGVYVG++SSP +++ V+ AD IL  G +LSDFNT SF++SYK 
Sbjct: 254 VTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNTSSFNFSYKA 313

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           KNVV  ++++ K+KNA +P +++KFVLQ LL  +                        + 
Sbjct: 314 KNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIKPRVTLQDNV 373

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
           PL+QEW+WNQ+  +  EGD+VI+ETGTSAFGINQT FPNNT  ISQVLWGSIG++ G  L
Sbjct: 374 PLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGSIGYSLGACL 433

Query: 424 GAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIH-G 482
           GA+FA EE+  K RVILF G+G+LQLTVQEISTM+RW LKPYLFV+NN GYTI+RL+H  
Sbjct: 434 GASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGYTIDRLLHKS 493

Query: 483 EKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLPV 542
             A Y+DIQ W++L LLP FGA +Y+  +V+T G++ KL  + +F  + +++MIE++LP 
Sbjct: 494 STAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKLKMIEVVLPS 553

Query: 543 MDAPSNLV 550
           MDAP  L+
Sbjct: 554 MDAPPALL 561

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/549 (51%), Positives = 397/549 (72%), Gaps = 1/549 (0%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           EI L +Y+  RL Q+ + TIFG+PG FN+ LL +I  +P M+WAGN NELNAAYAADGY+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K ++CL+TTFGVGELSA+NG+AGS+AEHVG+LH VG+P +++Q ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            VFHR+ +++++ T+++TD  T   E+D+CI   +  QRPVYLG+P N+ D  V ++LL+
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
            P+DLS    + E + + +  IL  +   ++P I+ DAC SRH+V AE R+L+++TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKG+I+E HPRFGG +VG++S P +++ V+ +D +L VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
            KN     S Y ++KNA +P +++K  L+ LLT +                        +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 363 TPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCT 422
            PL+QEW+WNQ+  + +EGD+VI+ETGTSAFG+NQ+ FPNNT  I+Q LWGS+G++ G  
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF G+G+LQLTVQE+STM+RW LKP +FV+NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 483 E-KADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLP 541
           +  A Y+DIQ W++L LLP FGA DY+   V T G++  L S+  F  N +I+M+E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 542 VMDAPSNLV 550
            MDAP  L+
Sbjct: 554 PMDAPPALM 562

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/546 (52%), Positives = 387/546 (70%), Gaps = 1/546 (0%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           IT+  Y F RL Q++V TIFGLPG+FN  L+DK+Y I G+RWAGN NELNAAYAADGYAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ C+I+TFGVGELSA+NGIAGSYAEHVG+LHVVG+P  S+Q +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM+  +S  +A++ D      E+D CIR  Y+ QRPVY+G+P NLV + V +  L+ 
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           PIDLS+  ND   E EVI+ IL     A NP+I+ADAC +RH ++AET +L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKGS+DE  P+FGGVY G++SSP++++ V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
             +V  +   +K K+AT+P + +K +L  LL  +                        + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
           PL+QEW+WNQ+ ++  EGDV+I+ETGTSAFGINQT+FP +T GISQ LWGS+G++ G  L
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 424 GAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGE 483
           GAA A +E     RV+LF G+G+ QLT QE+ST++RW L PY+F++NN GY+++R +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 484 KADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLPVM 543
            A Y DIQ W +  L   FGAKDYE+ ++ T G++  + ++  F+   RIR++EIMLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 544 DAPSNL 549
           D P  L
Sbjct: 551 DVPQAL 556

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/554 (50%), Positives = 393/554 (70%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y IP +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           P+DL L  ND + E EVI  IL  +  ++NP I+ DAC SR ++  ET++L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P +++ V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           KN    +S  +K+KNAT+P + +K +LQK+L  +                        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
            L+QEW+WN++  + Q GD++I+ETG SAFG+NQT FP NT GISQ LWGS+G+  G  L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF G+G+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+  + S+  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/554 (50%), Positives = 392/554 (70%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y+IP +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + +  L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           P+DL L  ND + E EVI  IL  +  +KNP I+ DAC SR ++  E ++L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P +++ V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           KN    +S  +K+KNAT+P + +K +LQKLL  +                        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
            L+QEW+WN++ ++ Q GD++I+ETG SAFG+NQT FP NT GISQ LWGS+G+  G  L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF G+G+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+  + ++  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/549 (50%), Positives = 394/549 (71%), Gaps = 1/549 (0%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           +ITL ++L  RL Q+ + TIF +PG F++  + +IY+ P M+WAGN NELNAAYAADGY+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K + CL TTFGVGELSA+NG+AG++AEHVG+LHVVG+P +++Q KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            VFHR+ +++++   ++ D      E+D+CI      QRPVYLG+P N+ ++ V + LL+
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
            P+DL   A + + E   + T+L+ +    NP I+ADAC SRH+V+AE + L+D+TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           F TPMGKGSIDEQHPRFGG +VG++SSP +++ V+ +D +L VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
           TKN V   SDY K+KNA +P + +K VL+ +L  +                        +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 363 TPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCT 422
            PL+QEW+W Q+ ++ +EGD+VI+ETGTSAFG+NQ  FP++T  I+Q LWGS+G++ G  
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 423 LGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHG 482
           LGA+FAA E     RVILF G+G+LQLTVQEISTM+RW L P +F++NN GYTI+RL+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 483 EK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLP 541
           +  A Y+DIQ W++L +LPTFGA +YE   V T G++  L  + +F  N +I+M+E++LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 542 VMDAPSNLV 550
            MDAP  L+
Sbjct: 554 PMDAPPALM 562

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/557 (50%), Positives = 391/557 (70%), Gaps = 9/557 (1%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           +IT+  YLF RL Q+ VKTIFGLPG+FN+ LLDKIY IP MRWAGNANELNAAYAADGY+
Sbjct: 16  QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGNANELNAAYAADGYS 75

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K + CL+TTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 76  RIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDY 135

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            VF+RM+ +++  T +V D      E+D+C+   +  Q+P YLG+P N VDL V +  LD
Sbjct: 136 NVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIPVNQVDLTVDSVRLD 195

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
           TP++L  + N+ E E +V++TIL  + + +NP I+ DAC  RHD+  ET++   +T FP+
Sbjct: 196 TPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLVEETKQFRQMTNFPT 255

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG++DE    FGGV+ G+LSSP++++ V+ AD I+ +G+LL++F+T +F + YK
Sbjct: 256 FVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSLLAEFSTPTFHFFYK 315

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
           TKN    HS  +K+KNAT+P + +K ++Q LL+ +                        +
Sbjct: 316 TKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRNTPPINVSRPKLSGN 375

Query: 363 TPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCT 422
             LKQEW+WN++  + Q+GD++I+E GTSAFGINQT FP  T GISQ LW S G++ G  
Sbjct: 376 QLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFPPRTKGISQALWASSGYSVGAC 435

Query: 423 LGAAFAAEEIDP--------KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGY 474
           LGA+FAA+E+          + RV+LF G+G+ Q+T+QEISTM+RW L PY+F+LNN GY
Sbjct: 436 LGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQEISTMIRWKLTPYIFLLNNQGY 495

Query: 475 TIERLIHGE-KADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRI 533
           +++R +H   KA Y D+Q W +L     FGA DYE  ++ T G+   + ++K F ++ +I
Sbjct: 496 SVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKIVTLGDLRDVMNDKHFCKDDKI 555

Query: 534 RMIEIMLPVMDAPSNLV 550
           RM+EIMLP  D P  LV
Sbjct: 556 RMLEIMLPSTDVPQVLV 572

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/567 (49%), Positives = 396/567 (69%), Gaps = 8/567 (1%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I++ +YLF RL Q+ ++TIFGLPG FN +LLDK+ EIPG+RWAGN NELNAAYAADGY+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ C+ITTFGVGELSA+NG+AGS+AEHVG+LHVVG+P  S+Q KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHRM++ ++  + ++ D      E+D CI   +  Q+PVY+G+P NLVD  V +  L+T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
            ++L+L +ND + E E+++ IL  +  +KNP+I+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
            TPM KG+IDE  P FGGV++G++SSP +++ V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           K  V  +   +K K+A +P +++K ++  LL  +                          
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
            L+ EW+WNQ+  + QEGD++I+ETGTSAFGINQTHFP+++ GISQ LWGS+G+  G  L
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 424 GAAFAAEEIDPKK------RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           GA+FAA E+   +      RVILF G+G+ QLTVQE+STM+RW L PY+FV+NN GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 478 RLIHGE-KADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMI 536
           R +H    A Y DIQ WE+L L+P FGA+ YE  ++ T G++ ++  +  F  N +IRM+
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 537 EIMLPVMDAPSNLVAQAKLTASINAKQ 563
           EIMLP MD P  L+ +  LT   N K+
Sbjct: 553 EIMLPPMDVPQALMDRW-LTEQENKKR 578

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/554 (50%), Positives = 395/554 (71%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I +  YLF RLNQ+++ TIFGL G+F++ LLDK+Y+IP +RWAGN+NELNAAYAADGY+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T ++ D      E+D+CI+  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           P+DL L  ND + E EVI  IL ++  ++NP I+ DAC SR ++  ET++L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P +++ V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           KN    +S  +K+KNAT+P + +K +LQKLL  +                        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
            L+QEW+WN++ ++ Q GD++I+ETG SAFG+NQT FP NT GISQ LWGS+G+  G  L
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI+       K RVILF G+G+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+  L ++  F  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQALL 568

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/581 (49%), Positives = 391/581 (67%), Gaps = 19/581 (3%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGY 61
           S+I++ +YLF RLNQ+ + TIFGLPGDFN+ LLDK+Y IP MRWAGN NELNAAYAADGY
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 62  ARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +RLK + CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           ++VF+R++ +I+  TA++ D      E+D CIR  +  Q+PVYLG+P N VD+ V +S L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 182 DTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFP 241
           + PIDLS+     E +A+VI+ +L  + SA  PII+ DAC  RHD   ET  L ++T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +  FGGVY G+LSSP +++  + AD +L +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 302 KTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXX 361
           K KN        +KIK ATFP + +K  LQ L+  I                        
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           S  L+QEW+WN++  + +E D++I+ETG+SAFGINQT FP NT GI+Q LWGS+GFA   
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 422 TLGAAFAAEE------------------IDPKKRVILFTGEGSLQLTVQEISTMVRWNLK 463
            LGA FA EE                  I  + R ILF G+G+ QLTVQE+ST++RW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 464 PYLFVLNNDGYTIERLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLT 522
           PY+F++NN+GY+++R +H    A Y D+Q W +L LL  FG   +E  ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 523 SNKEFNQNTRIRMIEIMLPVMDAPSNLVAQAKLTASINAKQ 563
           +++ F +  +IRMIEIMLP  D P  L+A+ +    ++ K+
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKR 591

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/554 (50%), Positives = 392/554 (70%), Gaps = 7/554 (1%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I++  YLF RLNQ+++ TIFGL G+F++ LLDK+Y IP +RWAGN+NELNAAYAADGY+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
           LKG+ CLITTFGVGELSA+NG+AGSYAEHVG+LH+VG+P  S+Q KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           VFHR++++++  T ++ D      E+D+CIR  ++ QRPVY+G+P N V+L + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
           P+DL L  ND + E EVI  IL  +  ++NP I+ DAC SR ++  E+++L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           VTPMGKG+++E  P+FGGV+ G++S+P +++ V+ AD I+ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXST 363
           KN    +S  +K+KNAT+P + +K +LQKLL  +                        + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 364 PLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTL 423
            L+QEW+WN++  + Q GD++I+ETG SAFG+NQT FP NT GISQ LWGS+G+  G  L
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 424 GAAFAAEEIDP------KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           GA FA +EI        K RVILF G+G+ QLTVQE+ST+V+W L PY+FV+NN GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 478 RLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMI 536
           R +H    A Y DIQ W +L LL  FG  +YE  ++ T GE+  +  + EF  N +IRMI
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 537 EIMLPVMDAPSNLV 550
           EIMLP  D P  L+
Sbjct: 555 EIMLPPRDVPQVLL 568

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/593 (49%), Positives = 402/593 (67%), Gaps = 43/593 (7%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           E+T+ +YLF RL Q++V TIFGLPG+FN+SLLDK+Y + GMRWAGNANELNA+YAADGY+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RLK + CL+TTFGVGELS +NGIAGS++E+VG++H+VG+P I  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            +FHR+S +I   +A+VT       EID+C+   +++Q+PVYLGLP NLV +KV ++LL+
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
           TP+DL L  ND + E   I+ IL  + SAKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG +DE   +FGGV+VG++SS  +++ V+ ADLI+ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXX----------XXXXXXX 352
           TK++V   S  +K+KN  +P + +K  L KL+  I                         
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 353 XXXXXXXXXSTP-----------LKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFP 401
                     TP           LKQEW+WN+   + +EGD++I+ETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 402 NNTYGISQVLWGSIGFATGCTLGAAFAAEEI---DP---KKRVILFTGEGSLQLTVQEIS 455
           N T GISQ LWGS G++ G  LGA+FAAEEI   +P   K RVILF G+G+ QLT+QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 456 TMVRWNLKPYLFVLNNDGYTIERLIHGE----------------KADYNDIQNWEHLNLL 499
           TMV+WNL PY+F++NN GY+++R +  +                  DY DIQ W++LNL 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 500 PTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLPVMDAPSNLVAQ 552
             F A +YE ++V +  +  K+ ++K F+   RIRM+EI+LP MD P +L+ +
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/556 (48%), Positives = 383/556 (68%), Gaps = 8/556 (1%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           EIT+  YLF RL Q+ V+TIFGLPG+FN+ LLD++Y IPG++WAGNANELNA YAADGYA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RLKG+ C+ITTFGVGELSA+NGIAG++AEHVGVLHVVG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            VFHRM+ ++S  + ++ D      E+D+CI   Y+ Q+PVYLG+P N V+LKV ++ L+
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
             +   +  N+ + E E I  IL  + + ++P I+ DAC +R D   ET + I +T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKGSIDE  P FGGV+ G++SSP +++ V+ AD ++ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
           +KN V    D ++ K + +P + +K +++ +L+ +                        S
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 363 TP--LKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420
               L+QEW+W++   + QEGD++I+E GTS+FGINQ  FP++T GISQ LWGS G++ G
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 421 CTLGAAFAAEE-----IDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYT 475
             LGA FA  E        ++RVILF G+G+ Q+T+QEISTM+RWNL PY+F+LNN GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 476 IERLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIR 534
           I+R +H  K     D+Q W +L+    FGA DYE  ++ T G+  ++  N++F++  RIR
Sbjct: 492 IDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRIR 551

Query: 535 MIEIMLPVMDAPSNLV 550
           M EIMLP MD P  +V
Sbjct: 552 MAEIMLPSMDVPKAIV 567

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/568 (47%), Positives = 387/568 (68%), Gaps = 15/568 (2%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           +IT+ +YLF RL Q+ ++TIFGL G++N+ L+DK+Y++  +RWAGNANELNAAYAADGYA
Sbjct: 12  QITISEYLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAYAADGYA 71

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           RLKG+  LITTFGVGELSALNG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
           +VFHR++++I+    ++ D      E+D+CI   ++ QRPVY+G+P N V+L V +  LD
Sbjct: 132 SVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLVDSKFLD 191

Query: 183 TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
            P+DL +  N  E  +E+   IL  +   K+P I+ DAC  RH+   E  +    T+FP 
Sbjct: 192 IPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCRRTKFPV 251

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
           FVTPMGKG+I+E  P FGGV++G+LSSP++++ V+ AD I+ +G++LS+F+T +F + +K
Sbjct: 252 FVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTSTFHFVFK 311

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
            K+ V   SD +KIKN+ +  + +K +++ LL  +                         
Sbjct: 312 VKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPKTKIPDD 371

Query: 363 TPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCT 422
             L+QEW+WN++  + +EGD++I+E GTSAFGINQT FPN   GISQ LWGS G++ G  
Sbjct: 372 VLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSGYSLGAC 431

Query: 423 LGAAFAAEEID--------------PKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFV 468
           LG +FA +E +               K RVILF G+G+ QLT+QE+ST++RWNL PY+FV
Sbjct: 432 LGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNLTPYIFV 491

Query: 469 LNNDGYTIERLIHGE-KADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEF 527
           LNN+GY+++R +H E  A Y DIQ W +L+L+ TF AK+YE  ++ T G++  +  +  F
Sbjct: 492 LNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDMVQDPLF 551

Query: 528 NQNTRIRMIEIMLPVMDAPSNLVAQAKL 555
             N +IRM+EI+LP  D P  LV   KL
Sbjct: 552 AINDKIRMVEILLPSTDVPQALVDTWKL 579

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/586 (47%), Positives = 392/586 (66%), Gaps = 24/586 (4%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGY 61
           ++ITL  YLF RLNQ  + T+FGLPG+FN+ L+DK+  IP ++WAGNANELNAAYAADGY
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 62  ARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR+KG+ CL+TTFGVGELS++NGIAGSYAEHVGVLH++G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P N +   + ++LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 182 DTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFP 241
           +  +D +L++N+  ++ +VIE IL  +   K P+I+ DAC +RH+++ ET +L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSY 301
             VTPM KGS+DE  P F GV+ G++SSP +++ ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 302 KTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXX 361
           K+K+ +   SDYIK +N TF  + +K +++KLL  +                        
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLLLALDVSKIKNFQLQENNNGNIYIPNIK 370

Query: 362 STP---LKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFA 418
             P   L+QEW+WNQ+  + Q+GD++I+ETGT+AFGINQT FP+N  GISQ LWGS G++
Sbjct: 371 LNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTGYS 430

Query: 419 TGCTLGAAFAAEEI--------------------DPKKRVILFTGEGSLQLTVQEISTMV 458
            G  LGA+FA  EI                     PK RVILF G+G+ QLTVQE+ST++
Sbjct: 431 LGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELSTII 490

Query: 459 RWNLKPYLFVLNNDGYTIERLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGE 517
           RW L PY+F++NN GY+ +R +H    A Y DI  W++L LL  FGAK YE+ ++ T G+
Sbjct: 491 RWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITVGD 550

Query: 518 WDKLTSNKEFNQNTRIRMIEIMLPVMDAPSNLVAQAKLTASINAKQ 563
           ++K+ +N  F  ++ +RMIEI+LP MD P  L+ + +L      K+
Sbjct: 551 FEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKKK 596

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/568 (47%), Positives = 382/568 (67%), Gaps = 15/568 (2%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGY 61
           S IT+ +Y+F RL Q+ ++TIFGLPG+FN+ L+DK+Y+IP +RWAG+ANELNAAYAADGY
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 62  ARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           +RLKG+  L+TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  S+Q KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           + VF R+++ ++  T ++ D      E+D+CI   +  Q+PVY+G+P N VD+ V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 182 DTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFP 241
           + P+ LS   N  +   +V++ +L  +  + +P+I+ D C  RH    E  + I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSY 301
            FVTPMGKG+IDE +P F GV+ G++SSP++++ V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 302 KTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXX 361
           K+KN    +SD IK  NAT+P V +K +LQ LL  +                        
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
              L+QEW+WN++  + QEGD++I+ETGTSAFGINQT FPN   GISQ LWGS+G++ G 
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 422 TLGAAFAAEEID--------------PKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLF 467
            LG+ FA +E                 K RVILF G+G+ QLT+QE+ST+VRW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 468 VLNNDGYTIERLIHGEK-ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKE 526
           +LNN GY+++R++H    A Y DIQ W++LNL+ TF A D +  ++ T G+   +  + E
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 527 FNQNTRIRMIEIMLPVMDAPSNLVAQAK 554
           F  + RIRMIE+MLP MD P  LV   K
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALVDTWK 578

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/560 (46%), Positives = 372/560 (66%), Gaps = 12/560 (2%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYA 62
           +I LGKYLF RLNQ++V TIFGLP +FN  LLD+IY+IP MRW GNANELNA+YAADGY+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           R+K +SCL+TTFGVGE+S LNGIAGS++EHV VLHVVG+P  S+Q K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            +FHR++++I   TA++ +       ID CI   Y  Q+PVY G+P NL    V +  LD
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 183 TPIDLSLKAND--AEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
           +P+ L    N   ++A  E+++ +L+ + SA++P+I+AD CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300
           P   TPMGKGS DEQ  R+ GVY+G++SSP +++ V+ AD +L  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 301 YKTKNVVEFHSDYIKIKNA-TFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXX 359
           YK KN+V     Y K+    T+P V++K VLQ L   +                      
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 360 XXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFAT 419
             +TPL+QEW+W ++  + + GDV+++E GTS  G+NQ  FP+ T  +SQ LWGS+G++ 
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 420 GCTLGAAFAAEEID-----PKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGY 474
           G  LG   A +E          R+ILF G+G+LQLTVQEIST+++W L PY+FV+NN GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 475 TIERLI----HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQN 530
           TI+RL+    H   ADY +IQ W +L+++P FG  +Y+  +V   G+ D+L  ++ F+  
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 531 TRIRMIEIMLPVMDAPSNLV 550
             ++M+EI+LP MDAP  L+
Sbjct: 553 DILKMVEIILPSMDAPQALL 572

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  513 bits (1321), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/553 (44%), Positives = 350/553 (63%), Gaps = 6/553 (1%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGY 61
           S I L +YLF RL Q+ V T FGLP D+N+ LLD +  +  M    N NELNA+YAADGY
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 62  ARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           AR++ +SCL++TFGVGELS +NGIAGS+AEHV VL +VG+P  S+Q ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           + VF R++++I   + +V    TA   +D CI   Y  Q+PVY G+P NL +  +P++ L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 182 DTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFP 241
           D P+ L L    A  + E++  +LD + +AK+P+++ DAC +RH    + ++L   T FP
Sbjct: 192 DVPLPL-LDEPCAPLD-ELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSY 301
              TPMGKG +DEQ  RF GVYVG+LS+P +++ V+ AD +L VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 302 KTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXX 361
           K KN+   H+ + ++    FP   ++ +L  L+                           
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           +TPL+ EWLW ++ ++   GD+++SETGTSAFG+ QT  P     +SQ LWGS+G++ G 
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 422 TLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI- 480
            LG   A     P +RV+LF G+G+LQLTVQE+STMVR  L P +FVLNN GY+ +RL+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 481 ---HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIE 537
              H   A Y D+Q W +L L P FGA  Y+   V+T GE D L S+  F Q + ++M+E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 538 IMLPVMDAPSNLV 550
           + LP MD P  L+
Sbjct: 550 VALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  446 bits (1146), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 236/559 (42%), Positives = 335/559 (59%), Gaps = 38/559 (6%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGY 61
           S IT+ +YLF RL Q+D++TIFGLPG+FN+ L+DK+Y+IP +RWAGNANELNAAYAADGY
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 62  ARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGD 121
           ARLK + CLITTFGVGELSALNGIAGS++EH+G+LHVV +P +      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLL 181
           +                  DI   P    R +    +     ++     L       S +
Sbjct: 130 YKF-----------PMKARDILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 182 DTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFP 241
                   K   A+   + ++     + S    +   + C  R +     RK     +FP
Sbjct: 179 P-------KGKGADXXXKNLQCRTSYLSSRS--LRFKEQC-RRCNSDYSVRK----QKFP 224

Query: 242 SFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSY 301
            FV P  +    E + +FGGV+ G++SSP +++ V+ ADL++ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 302 KTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXX 361
           + K+VV   S Y+KI+N  +P + +K +L  LL+ +                        
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKLPS-- 341

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
            + L+QEW+WN++  + QE DV+I+ETGTSAFGINQT FP  ++GISQ LWGS+G++ G 
Sbjct: 342 KSVLRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYSLGA 401

Query: 422 TLGAAFAAEEIDPK-------KRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGY 474
            LGA+FA +E+           RVILF G+G+ QLT+QE+STM++WNLKPY+F++NN GY
Sbjct: 402 CLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNNQGY 461

Query: 475 TIERLI-HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRI 533
           +I+R + H   A Y DIQ WE+LNLL  FGA DYE  ++ T  ++  +  +  F +N +I
Sbjct: 462 SIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARNDKI 521

Query: 534 RMIEIMLPVMDAPSNLVAQ 552
           RMIEIMLP MD P +L+ Q
Sbjct: 522 RMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  339 bits (870), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/553 (34%), Positives = 309/553 (55%), Gaps = 34/553 (6%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           I L +YLF RL Q++ +T+FG+  +++ + L +     G++W    N+LN ++A D Y R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 64  LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFT 123
             G+SC +T+    EL  +NG  GS+ E+V +L VV V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 124 VFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDT 183
           +FH              D+   P+EID C+RT +  +RPVY+GL +      VP+S L+ 
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 184 PIDLSLKANDAEAEAEVIETILDL----VKSAKNPIILADACASRHDVKAETRKLIDITQ 239
            I   +   +   + + I+ ++D     V ++  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 240 FPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSY 299
            P   T M KGSIDE  P F G ++GT+S P +++ + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 300 SYKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXX 359
           +YK+KN +   +D +KI+N   P + +  +L +L+  +                      
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNMIPRVEP 362

Query: 360 XXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFAT 419
              T L+QE+LW ++  +L++GDV+ISE+GTSA G+ Q  FP+NT  +SQ +W S G++ 
Sbjct: 363 QPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYSI 422

Query: 420 GCTLG--AAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
           G  LG  AA+       K R+IL  G+GSLQ T QE+ST++    KPY+FV+NN GYT++
Sbjct: 423 GACLGILAAYRDMGTLDKHRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYTVD 482

Query: 478 RLIHGEK----ADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRI 533
           R ++ EK    A Y DIQ WE L L   F +++Y   R  + GE + L S+KEFN++ ++
Sbjct: 483 RTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSDQL 542

Query: 534 RMIEIMLPVMDAP 546
           +++E++LP MD P
Sbjct: 543 KIVELILPSMDVP 555

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/602 (35%), Positives = 308/602 (51%), Gaps = 56/602 (9%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYE---IPGMRWAGNANELNAAYAAD 59
           EIT G+Y+F RL     K++FG+PGDFNL+LL+ +Y+      +RW GN NELNAAYAAD
Sbjct: 30  EITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAAD 89

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQL---LLHH 115
           GY+R    + CLITT+GVGELSALNG+AGS+AE V VLH+VGV S  +  K      +HH
Sbjct: 90  GYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHH 149

Query: 116 ---TLGNGDF------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLG 166
               L + +F      T +  +   +      + DI  A   +D+ I   Y   +P YL 
Sbjct: 150 LIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLF 209

Query: 167 LPANLVDLKV--------PASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILA 218
           +PA+  D+ V        P   L+  I   +   +++ EA ++  +  L+ ++ NP IL 
Sbjct: 210 IPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEA-IVAKVAQLIYNSSNPCILG 268

Query: 219 DACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVES 278
           D    R+ V  +   LI   Q  +F T MGK  IDE +P + G+Y G   S ++ +    
Sbjct: 269 DVLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSK 328

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK---NVVEFHSDYIKIKNAT------FPGVQMKFV 329
            DLIL  G   ++ N G ++  Y      NVVEFHSDYI+  N+         GV    V
Sbjct: 329 CDLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHV 388

Query: 330 LQKLLTVIXXXXXXXXXXXXXXXXXXXXX--XXXSTPLKQEWLWNQVGKFLQEGDVVISE 387
           L +L   I                          S  + QE+L + + ++L  GDV++ E
Sbjct: 389 LNRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCE 448

Query: 388 TGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFA-----------AEEIDPKK 436
           TG+  FG+    FP+N   +SQ  + SIG A   +LG                EEI+ + 
Sbjct: 449 TGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEP 508

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHL 496
           ++ILF G+GS Q+T+QE+STM+  N+K  +F+ NNDGYTIER I G    YNDI  W   
Sbjct: 509 KLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWNWT 568

Query: 497 NLLPTF----GAKDYENHRVSTTGE--WDKLTSNKEFNQN---TRIRMIEIMLPVMDAPS 547
            +   F    G+K    ++V +T E    +L   K+   N    +I ++E+ + V+D P 
Sbjct: 569 KMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVLDFPE 628

Query: 548 NL 549
            L
Sbjct: 629 QL 630

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  335 bits (860), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 206/600 (34%), Positives = 315/600 (52%), Gaps = 50/600 (8%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAYAAD 59
           I  G+Y+FERL     K++FG+PGDFNLSLL+ +Y    +   ++W G  NELNAAYAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT-- 116
           GY+R    + C+ITT+GVGELSA+NG+AG++AE+V VLH+VGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 117 -----LGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
                + N +F       +H M    IS +T  V ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 166 GLPANLVDLKVPASLLDTPIDLSLKANDAEA-EAEVIET----ILDLVKSAKNPIILADA 220
            +PA+  D  V A  L T   ++L+   ++    EV+++    I+DL+  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 221 CASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESAD 280
              R     E R  + IT+  +F + MG+  +DE  P F GVY G  SSP I Q++ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 281 LILSVGALLSDFNTGSFSYSYKTKNV-VEFHSDYIKI------KNATFPGVQMKFVLQKL 333
           LIL  G L ++ N G +S+S+      VE HSDY+              GV    VL ++
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 334 LTVIXXXXXXXXXXXXXXXXXXXXXXXXSTP---LKQEWLWNQVGKFLQEGDVVISETGT 390
           + +I                         +P   + Q++L N + ++L  GDV + ETG+
Sbjct: 392 IQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGS 451

Query: 391 SAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEE-------------IDPKKR 437
             F +    FP N   ISQ  + SIG A    LG   A ++             +D   +
Sbjct: 452 FQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPK 511

Query: 438 VILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLN 497
           +IL  G+G+ Q+T+QE+++ +R+ +   +F+ NN GYT+ER I G    YNDI  W+   
Sbjct: 512 LILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTK 571

Query: 498 LLPTFGAKD---YENHRVSTTGEW-DKLTSNKEFNQNTRIRMIEIMLPVMDAPSNLVAQA 553
           LL  FG  D    E  +V   GE+ D + S K   + +++R+IE+ML +MD P  L+A A
Sbjct: 572 LLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA 631

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 217/606 (35%), Positives = 315/606 (51%), Gaps = 53/606 (8%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAYAAD 59
           +  G+Y+F RL  I  K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAYAAD
Sbjct: 25  MPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQWVGTCNELNAAYAAD 84

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP----SISSQAKQLLLH 114
           GY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV     S S+  K+  LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSTDSRSNNFKERNLH 144

Query: 115 H---TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M   N++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVDAVIRDIYRYSKPGYV 204

Query: 166 GLPANLVDLKVPA-SLLDTPIDLSLKANDAEAEAE---VIETILDLVKSAKNPIILADAC 221
            +PA+  D+ V   +L++ P         + +E +   +I+ I   + S++ P IL D  
Sbjct: 205 FVPADFPDMSVRLDNLINVPHISQQDCITSSSETQLFNIIDKITTWMYSSRTPAILGDVL 264

Query: 222 ASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADL 281
             R+ V     KLI  ++  +F T MGK  IDE +P + G+Y G      + +  ES DL
Sbjct: 265 TDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLYNGKEGLKQVYEHFESCDL 324

Query: 282 ILSVGALLSDFNTGSFSYSYK-TKNVVEFHSDYIKI------KNATFPGVQMKFVLQKLL 334
           IL  G  +++ N G +S++YK    +++FH +YI+       +   F GV    VLQ+L 
Sbjct: 325 ILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYGEEQIFEGVNFVPVLQELY 384

Query: 335 TVIXXXXXXXXXXXXXXXXXXXXXXX------XSTPLKQEWLWNQVGKFLQEGDVVISET 388
             I                              ST + Q  L   + KFL  GDVV+ ET
Sbjct: 385 QCIDVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHLQKVIPKFLNPGDVVVCET 444

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDP-------------K 435
           G+  F +    FP     ISQ  + SIG A    LG   A ++  P             K
Sbjct: 445 GSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQD-HPNTHINGGNINEGYK 503

Query: 436 KRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEH 495
            R+ILF G+G+ Q+T+QE+ST++++++   + + NN+GYTIER I G    YNDI +W+ 
Sbjct: 504 PRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIERAIMGPTRSYNDIMSWKW 563

Query: 496 LNLLPTFGAKD--YENHRVSTTGEWDKLTSNKEFNQNT--RIRMIEIMLPVMDAPSNLVA 551
             L   FG  D  Y N+ +  T     L      N +T  RI ++E+ L V+D P  L  
Sbjct: 564 TKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIELLEVKLGVLDFPEQLRC 623

Query: 552 QAKLTA 557
             +  A
Sbjct: 624 MVEAAA 629

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  327 bits (839), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 208/601 (34%), Positives = 311/601 (51%), Gaps = 51/601 (8%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYE----IPGMRWAGNANELNAAYAA 58
            I LG+Y+FER+     +TIFG+PGDFNLSLL+ IY     + G++W G  NELNAAYAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 59  DGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSI----SSQAKQLL 112
           DGY+R    + CLITT GVGELSALNGIAG++AE V +LH+VGV PS     S+Q+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 113 LHHTLGNGDFTVF---HRM-----SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
            H      D  +    HR+        +S ++  + DI++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 165 LGLPANLVDLKVPASLLDTPIDLSLK-------ANDAEAEAEVIETILDLVKSAKNPIIL 217
           + +PA+  D  V A  L+    + L+        ND + + E+ E IL+ + S+  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQ-ELAEYILESMYSSSRPAII 259

Query: 218 ADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVE 277
           AD    R+D+ +  R+L++ T   +F + MGK  +DE +  F GVY G+ S   + +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 278 SADLILSVGALLSDFNTGSFSYSYKT-KNVVEFHSDYIKI------KNATFPGVQMKFVL 330
           + D +L VG + ++ NTG +SY +    N+VE H  Y+        KN    G     VL
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 331 QKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGT 390
             +  +I                         + +   +L     KFL  GDV + +TG+
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGPPHSSVTHSYLQTHFPKFLSSGDVFVVDTGS 439

Query: 391 SAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI-------------DPKKR 437
             FG+    FP++   ISQ  + SIG A  C LG     ++              + + R
Sbjct: 440 FQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQRNYQPR 499

Query: 438 VILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLN 497
           +IL  G+G+ Q+T+QE+++ +R+ +   LF+ NN GYT+ER I G    YNDI  WE   
Sbjct: 500 LILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMAWEWTE 559

Query: 498 LLPTFGAKDYEN---HRVSTTGEWDKL--TSNKEFNQNTRIRMIEIMLPVMDAPSNLVAQ 552
           LL  FG    EN    +VS+  +  +L  T      ++  +R++E+ML VMD P  L A 
Sbjct: 560 LLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPEQLKAM 619

Query: 553 A 553
           A
Sbjct: 620 A 620

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  324 bits (831), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/590 (33%), Positives = 303/590 (51%), Gaps = 47/590 (7%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY------EIPGMRWAGNANELNAAYA 57
           +  G Y+F+RLN    K+IFG+PGD+NL+LL+ +Y      +   + W G  NELNAAYA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 58  ADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHT 116
           ADGY+R    + C++TT GVGELSA+NGI+GS+AEHV VLH+VG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 117 LGN--------GDFTVFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGL 167
           L N         ++ VF  M   ++S +T  + ++ TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 168 PANLVDLKV-PASLLDTPI-----DLSLKANDAEAEAEVIETILDLVKSAKNPIILADAC 221
           P N   L V P +L +TP       +++  +  E    + + I   +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 222 ASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADL 281
             R+   +   + I  T   +F T MGK  +DE    + GVY G      +++++ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 282 ILSVGALLSDFNTGSFS---YSYKTKNVVEFHSDYIKI------KNATFPGVQMKFVLQK 332
           IL  G   ++ N+G+++   Y  K   ++EFH  YI++          F GV+  ++L++
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 333 LLTVIXXXXXXXXX-XXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTS 391
           +L ++                         +  + Q+ +   +  +++ GDVV+ +TGT 
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAVANNQITQDHISTTMESYIKPGDVVLCDTGTF 443

Query: 392 AFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI------------DPKKRVI 439
            F +    F +    +SQ  + SIG+A    LG   A  +             + K R+I
Sbjct: 444 QFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRLI 503

Query: 440 LFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLNLL 499
           LF G+G+ Q+TVQE+STM+R+ +   +F+ NNDGYTIER I G    YNDIQ W    L 
Sbjct: 504 LFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYLF 563

Query: 500 PTFG-AKD--YENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIMLPVMDAP 546
             FG AK+   +NH+V TT E D + +         I  +E+ L +MD P
Sbjct: 564 KAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMP 613

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 214/609 (35%), Positives = 314/609 (51%), Gaps = 53/609 (8%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAY 56
           ++ I  G+Y+F RL  I  K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAY
Sbjct: 22  LATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLRWVGTCNELNAAY 81

Query: 57  AADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQA---KQL 111
           AADGY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++   K+ 
Sbjct: 82  AADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSNNFKER 141

Query: 112 LLHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            LHH    + N +F      V+H M  + ++ + A + DI TA  ++D  IR  +   +P
Sbjct: 142 NLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVDNVIRDIFKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLDTPIDLSLKANDAEAEAE---VIETILDLVKSAKNPIILA 218
            Y+ +PA+  D+ V A +L+  P            E +   +I+ I   + S+K P IL 
Sbjct: 202 GYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQLLDIIDKITSWMYSSKTPAILG 261

Query: 219 DACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVES 278
           D    R+ V     +LI  T+  +F T MGK  IDE +P + G Y G      + +  ES
Sbjct: 262 DVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYKHFES 321

Query: 279 ADLILSVGALLSDFNTGSFSYSYK-TKNVVEFHSDYIKIKNAT------FPGVQMKFVLQ 331
            DL+L  G  +++ N G ++++YK    +++FH +YI+  +        F GV    VL+
Sbjct: 322 CDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDEQMFEGVNFVPVLK 381

Query: 332 KLLTVIXXXXXXXXXXXXXXXXXXXXXXX------XSTPLKQEWLWNQVGKFLQEGDVVI 385
           +L  +I                              S+ + Q  L   +  FL  GDVV+
Sbjct: 382 ELYKLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQAHLQKVMPGFLNPGDVVV 441

Query: 386 SETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI------------D 433
            ETG+  F +    FP     ISQ  + SIG A    LG   A ++             D
Sbjct: 442 CETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDYSNAHINGSNVKED 501

Query: 434 PKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNW 493
            K R+ILF G+G+ Q+T+QE+ST+++ N+   + + NN+GYTIER I G    YNDI +W
Sbjct: 502 YKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTIERAIMGPTRSYNDIMSW 561

Query: 494 EHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFN-----QNTRIRMIEIMLPVMDAPSN 548
           +   L   FG  D   H  ST  E+    + K        +  +I ++E+ L V+D P  
Sbjct: 562 KWTKLFEAFGDFD-GKHTSSTLIEFPSKLALKLKELKNSARRNQIELLEVKLGVLDFPEQ 620

Query: 549 LVAQAKLTA 557
           L    +  A
Sbjct: 621 LKCMVEAAA 629

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 212/606 (34%), Positives = 315/606 (51%), Gaps = 53/606 (8%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAYAAD 59
           I  G+Y+F+RL  ID K++FG+PGDFNLSLL+ +Y    E  G+RW G  NELNAAYAAD
Sbjct: 25  IPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVESAGLRWVGTCNELNAAYAAD 84

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + CLITT+GVGELSALNGIAGS+AE+V VLH+VGV  SI S++       LH
Sbjct: 85  GYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAKSIDSRSSNFSDRNLH 144

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P Y+
Sbjct: 145 HLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKPGYI 204

Query: 166 GLPANLVDLKVPA-SLLDTPI----DLSLKANDAEAEAEVIETILDLVKSAKNPIILADA 220
            +PA+  D+ V   +L++ P     D  +  ++ +  +++I  I   + S+K P IL D 
Sbjct: 205 FVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQL-SDIINKITSWIYSSKTPAILGDV 263

Query: 221 CASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESAD 280
              R+ V     KLI  T   +F T MGK  IDE +P + G Y G      + +  E  D
Sbjct: 264 LTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMGQYNGKEGLKQVYEHFELCD 323

Query: 281 LILSVGALLSDFNTGSFSYSYK-TKNVVEFHSDYIKI------KNATFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++++YK    +++FH +YI++          F G+    +L++L
Sbjct: 324 LVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTRQGNEQMFKGINFAPILKEL 383

Query: 334 LTVIXXXXXXXXXXXXXXXXXXXXXXX------XSTPLKQEWLWNQVGKFLQEGDVVISE 387
              I                              S+ + Q  L   + KFL  GDVV+ E
Sbjct: 384 YKRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQVHLQKTMPKFLNPGDVVVCE 443

Query: 388 TGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI------------DPK 435
           TG+  F +    FP+    ISQ  + SIG A    LG   A ++             D K
Sbjct: 444 TGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIAMQDHSNAHINGGNVKEDYK 503

Query: 436 KRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEH 495
            R+ILF G+G+ Q+T+QE+ST+++ N+   + + NN+GYTIER I G    YND+ +W+ 
Sbjct: 504 PRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTIERAIMGPTRSYNDVMSWKW 563

Query: 496 LNLLPTFGAKD--YENHRV--STTGEWDKLTSNKEFNQNTRIRMIEIMLPVMDAPSNLVA 551
             L   FG  D  Y N  +    +    KL   K  N+ + I ++E+ L  +D P  L  
Sbjct: 564 TKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSGIELLEVKLGELDFPEQLKC 623

Query: 552 QAKLTA 557
             +  A
Sbjct: 624 MVEAAA 629

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/612 (33%), Positives = 320/612 (52%), Gaps = 54/612 (8%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIP----GMRWAGNANELNAAYAAD 59
           I  G+YL +R+     K+IFG+PGDFNLSLL+ +Y       G+RW G  NELNAAYAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL---LH 114
           GY+R    MSCLITT+GVGELSA+NG+AG++AE V VLH+VGV  S+ S++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 115 H---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H    L + +F      V+  M  + ++ + A + +I TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 166 GLPANLVDLKV-PASLLDTPIDLSLKANDAEAEA----EVIETILDLVKSAKNPIILADA 220
            +PA+  D+ V P++L+  P+ ++L+    E  +    EV + +L  +  +K P I+ D 
Sbjct: 208 FVPADFSDMLVNPSNLVSNPV-ITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDV 266

Query: 221 CASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESAD 280
              R     E  KLI +T   +F T MGK  IDE +P++ G+Y G     ++ +     D
Sbjct: 267 LTDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCD 326

Query: 281 LILSVGALLSDFNTGSFSYSY-KTKNVVEFHSDYIKI------KNATFPGVQMKFVLQKL 333
           L+L  G  +++ N G ++Y Y +   +VE H +Y++       +   F GV    +L++L
Sbjct: 327 LVLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRL 386

Query: 334 L-----TVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISET 388
           L     T +                           + Q  L N++  +  +GDVV+ ET
Sbjct: 387 LEKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCET 446

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKK------------ 436
           G+  F +    FP+    ISQ  + SIG A   ++G   A ++  PK             
Sbjct: 447 GSFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDF-PKSHLIANGKEHSYQ 505

Query: 437 -RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEH 495
            R+ILF G+G+ Q+TVQE++TM+R  +   + +LNN+GYTIER I G    YNDI  W+ 
Sbjct: 506 PRLILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKW 565

Query: 496 LNLLPTFGAKDYE---NHRVSTTGEWDKLTSNKEFNQ-NTRIRMIEIMLPVMDAPSNLVA 551
             L   FG  D +   N  V T  E D++  + ++ + +  I ++E+ L VMD P  L +
Sbjct: 566 TKLFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQLQS 625

Query: 552 QAKLTASINAKQ 563
                A   +K+
Sbjct: 626 MVDAAAFKRSKK 637

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  318 bits (816), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 210/604 (34%), Positives = 309/604 (51%), Gaps = 59/604 (9%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAY 56
           ++ I+ G+Y+F RL     K++FG+PGDFNLSLL+ +Y    E  G++W G  NELNAAY
Sbjct: 22  LATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLKWIGTCNELNAAY 81

Query: 57  AADGYARL-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL-- 112
           AADGY+R    + CL+TTFGVGELSALNG+AGS+AE+V VLH+VGV  SI S++      
Sbjct: 82  AADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAKSIDSRSDNFRDR 141

Query: 113 -LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRP 162
            +HH    L   +F      V+H M  + ++ + A + DI TA  ++D  IR  Y   +P
Sbjct: 142 NMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVDNVIRDIYKYSKP 201

Query: 163 VYLGLPANLVDLKVPA-SLLDTPIDLSLKANDAEAEA------EVIETILDLVKSAKNPI 215
            Y+ +PA+  D+ V   +L++ P    +   D           ++++ I   + S+K P 
Sbjct: 202 GYIFVPADFADMSVTCENLINVP---HISQQDCITYPSQIQLFDILDRITSWMYSSKTPA 258

Query: 216 ILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQS 275
           IL D    R+ V     KLI  T   +F T MGK  IDE +P++ G Y G      + + 
Sbjct: 259 ILGDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNGKEGLRQVYEH 318

Query: 276 VESADLILSVGALLSDFNTGSFSYSYK-TKNVVEFHSDYIKIKNA------TFPGVQMKF 328
            ES DL+L  G  +++ N G ++++YK    +++FH +YI+  +        F G+    
Sbjct: 319 FESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHEQMFEGINFAP 378

Query: 329 VLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXX------XSTPLKQEWLWNQVGKFLQEGD 382
           VL +L   I                              S  + Q  L   + KFL  GD
Sbjct: 379 VLMELYKGIDVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQVHLQKVMPKFLSPGD 438

Query: 383 VVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDP-------- 434
           VV+ ETG+  F +    FP     ISQ  + SIG A    LG   A ++           
Sbjct: 439 VVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQDFPNAHISDENI 498

Query: 435 ----KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDI 490
               K R+ILF G+G+ Q+T+QE+ST+++ ++   +F+ NN+GYTIER I G    YND+
Sbjct: 499 GEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTIERAIMGPTRAYNDV 558

Query: 491 QNWEHLNLLPTFGAKDYENHRVSTTGEWD-----KLTSNKEFNQNTRIRMIEIMLPVMDA 545
            +W+   LL  FG  D   H  ST  E+      KL   K  N    I ++E+ L V+D 
Sbjct: 559 MSWKWTKLLEAFGDFD-RKHTNSTVIEYPSKLAMKLEELKSSNTRDGIELVEVKLGVLDF 617

Query: 546 PSNL 549
           P  L
Sbjct: 618 PEQL 621

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  310 bits (794), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 200/601 (33%), Positives = 312/601 (51%), Gaps = 54/601 (8%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYE----IPGMRWAGNANELNAAYA 57
           +E+ LG+Y+F RL     KT+FG+PGDFN+ LL+ +Y       G++W G  NELNAAYA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 58  ADGYAR-LKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLL---L 113
           ADGY+R    + C++TT GVGELSALNG+AG++AEHV VLH+VGV   ++Q    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 114 HH---TLGNGDFT-----VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L N +F      V+  M S  +S     + D+ TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 165 LGLPANLVDLKV--------PASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPII 216
           L +PA++ ++KV        P  +L++ +    + N A  +   IE +  L +S+  P I
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAV--LERTNLAACDRIGIEILQHLYQSS-TPAI 264

Query: 217 LADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSV 276
           L D    R  +  + R+L+++T   +F T MGK  +DE  P + GVY G   S      +
Sbjct: 265 LCDGLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGA-GSKERNALL 323

Query: 277 ESADLILSVGALLSDFNTGSFSYSYKTKN-VVEFHSDYIKI----KNATFPGVQMKFVLQ 331
           +  DLIL +G +  + NT  +++ +  ++ ++E H +Y+ +    +        +  VL+
Sbjct: 324 QECDLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLR 383

Query: 332 KLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTS 391
            +L  +                          P+ Q  L + + + L  GDV++ +TGT 
Sbjct: 384 SILAHLNVANLSFNYPTAKKRVPREHQYAADEPITQGMLQHMIPECLNPGDVMVVDTGTF 443

Query: 392 AFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEE-----IDPK-------KRVI 439
            F +    FP +   ISQ  + SIG A    LG A A  E     + PK        R++
Sbjct: 444 QFSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLV 503

Query: 440 LFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLNLL 499
           L  G+G+ Q+T+QE+ST +R+ L   + + NNDGYT+ER+I G    YNDI +W+   LL
Sbjct: 504 LCEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLL 563

Query: 500 PTFGAKDYENHRVSTTGEWD------KLTSNKEFNQNTRIRMIEIMLPVMDAPSNLVAQA 553
             FG  D++  R  +    D       L+S K   + ++IR++E++L  MD  + L   A
Sbjct: 564 RVFG--DFDGTRSESVRVKDFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELA 621

Query: 554 K 554
           K
Sbjct: 622 K 622

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  310 bits (793), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 213/626 (34%), Positives = 319/626 (50%), Gaps = 77/626 (12%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY-------EIPGMRWAGNANELNAAY 56
           ITL +Y+F RL      ++FG+PGDFNL LL+ +Y       E+  + W G  NELNAAY
Sbjct: 17  ITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNAAY 76

Query: 57  AADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISS-QAKQLLLH 114
           AADGY+R    + CL+TTFGVGE+SALNGI G+  E+V VL++VG+P      + Q  +H
Sbjct: 77  AADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYNIH 136

Query: 115 HTLGN--------GDFTVFHRMSAN-ISETTAMV--TDIATAPA-----EIDRCIRTTYV 158
           H++ N         ++  +  M  N I+     +  +DI    +     +ID+ I+  ++
Sbjct: 137 HSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNIFI 196

Query: 159 TQRPVYLGLPANLVDLKVPAS----LLDTPIDLSLKANDAE----AEAEVIETILDLVKS 210
           + +P YL +P+N+ ++ V ++    L    +D +LK+  +      E ++IE I  L+  
Sbjct: 197 SSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLLYK 256

Query: 211 AKNPIILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSP 270
           +K P IL D    R D + +  +LI      +F T +GK  IDE + RF G Y G  S  
Sbjct: 257 SKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTSDS 316

Query: 271 AIKQSVESADLILSVGALLSDFNTGSFSYSYKTKNV-VEFHSDYIKIK------NATFPG 323
            +K + ES DLIL +G   ++ NTG +S+SY    V +E   DYIKI       +     
Sbjct: 317 YVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKIIND 376

Query: 324 VQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTP-------------LKQEWL 370
           + ++ V+QKLL  I                        S               + Q+ L
Sbjct: 377 IMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQDDL 436

Query: 371 WNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFA-- 428
             ++     +GDVV+ ETG+  F I    FP  T  I+Q  + SIG A   +LG      
Sbjct: 437 QVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIGMR 496

Query: 429 ----------AEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIER 478
                     +E+  PKK +ILF G+G+ Q+T+QE+S+++R+ +   +F+ NN+GYT+ER
Sbjct: 497 DYPNCHINDNSEDATPKK-LILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTVER 555

Query: 479 LIHGEKADYNDIQNWEHLNLLPTFGAKDYE-----NHRVSTTGEWD-KLTSNKEFNQNTR 532
           +  GEK  YNDI  W+ +NLL  FG  D+E     +  +ST  E   K+   K  N    
Sbjct: 556 IFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQKI 613

Query: 533 IRMIEIMLPVMDAPSNL---VAQAKL 555
           I +IE+ L  MD P NL   V Q KL
Sbjct: 614 IELIEVKLGEMDIPKNLKHIVEQMKL 639

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 201/605 (33%), Positives = 309/605 (51%), Gaps = 50/605 (8%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIP----GMRWAGNANELNAAYAA 58
            I  G+YLF++L Q   K+IFG+PGD+NL LL+ +Y+      G RW    NELNAAYAA
Sbjct: 15  RIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIACCNELNAAYAA 74

Query: 59  DGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTL 117
           DGY+R    ++ LITT+GVGELSA+NG+AGS AE+V VLH+VGV  + S A +   HH +
Sbjct: 75  DGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKSDAPECNYHHLI 132

Query: 118 ---------GNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
                    G      +  +   ++ +   + DI TAP ++D+ I   Y   +P YL +P
Sbjct: 133 PQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIYKHSKPGYLFVP 192

Query: 169 ANLVDLKVPASLLDTPIDL--SLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHD 226
           A+  D  V  + L+  I+L  S++   +E    +++ +L  +  ++ P ILAD    R  
Sbjct: 193 ADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFG 252

Query: 227 VKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVG 286
           + ++  + I+ TQ  +F T MGK  IDE +PR+ G+Y G   +  ++    S DLIL  G
Sbjct: 253 LISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFG 312

Query: 287 ALLSDFNTGSFSYSYKTK-NVVEFHSDYIKI------KNATFPGVQMKFVLQKLLTVIXX 339
              ++ N  +  + Y  +  V+EFH  YI++          F  V    VL  L   I  
Sbjct: 313 VEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDI 372

Query: 340 XXXXXXXXXXXXXXXXXXX----XXXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGI 395
                                     ++ + Q +L  +  + L  GD+++S+TG+  FG+
Sbjct: 373 SKLNLQYDKAIFTTYEPSQLNLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFGV 432

Query: 396 NQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDP-------------KKRVILFT 442
                P  +  ++Q  W SIG      LG     ++                K +++L  
Sbjct: 433 RDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLGV 492

Query: 443 GEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHLNLLPTF 502
           G+G+ Q+TVQE++TM+R+++   +FV NN+GYTIER I GE +DYNDI  W    L   F
Sbjct: 493 GDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEAF 552

Query: 503 GAKD--YENHR-VSTTGEWDKLTSNKEFNQNTR-IRMIEIMLPVMDAPSNLVAQAKLTAS 558
           G  D  Y N   V T  E D+    ++ N+  + I ++E+ L VMD P+ L  Q  L+  
Sbjct: 553 GDFDGKYSNSSLVKTRQELDQKI--EDINKGGKGIELVEVKLGVMDYPAQL--QMMLSNM 608

Query: 559 INAKQ 563
            NAK+
Sbjct: 609 KNAKK 613

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  305 bits (781), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 201/601 (33%), Positives = 314/601 (52%), Gaps = 57/601 (9%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIP----GMRWAGNANELNAAYAA 58
           +I  G+Y+F+R+     K++FG+PGDFNL LL+ +Y+      G+RW G  NELNAAYAA
Sbjct: 24  QIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNAAYAA 83

Query: 59  DGYARL-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQA---KQLLL 113
           DGY+R  +G+ CLITT+GVGELSA+NGIAG++AE+V +LH+VGV  SI SQ    KQ  L
Sbjct: 84  DGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFKQRNL 143

Query: 114 HH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
           HH    L + +F+     +++ M  + IS +T  + +I TA  ++D+ I   Y   +P Y
Sbjct: 144 HHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYSKPGY 203

Query: 165 LGLPANLVDLKVPA-SLLDTPI----DLSLKANDAEAEAEVIETILDLVKSAKNPIILAD 219
           + +P + V++ V   +LL  P     D  L+ +      ++   ILD + S+K+P I+ D
Sbjct: 204 IFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPAIIGD 263

Query: 220 ACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESA 279
               R+       + I +T+  +F T  GK  I+EQ+P + G+Y G   +  +       
Sbjct: 264 VLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDRFLKC 323

Query: 280 DLILSVGALLSDFNTGSFSYSYKTK-NVVEFHSDYIKI------KNATFPGVQMKFVLQK 332
           DLI++VG  +++ N G +++SY+    ++E H  YI++      +   F G+    VL++
Sbjct: 324 DLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIHVLKR 383

Query: 333 LLTVIXXXXX------XXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVIS 386
           +L  I                              S  + Q +L   V  +L +GDV++ 
Sbjct: 384 MLIKIDIKRFDFDYDPSVTKFDPTIELKFPSADPDSNKITQNFLAQNVPDYLNDGDVLVV 443

Query: 387 ETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPK----------- 435
           ETG   F       P+    I+Q  + SIG A    LG   A ++  P+           
Sbjct: 444 ETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDY-PRCHLYGKIPETY 502

Query: 436 -KRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWE 494
             R+IL  G+G+ Q+TVQE+S+ +R+N+   + +LNNDGYTIER I G    YNDI  W 
Sbjct: 503 NPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYNDIMAWN 562

Query: 495 HLNLLPTFGAKDYENH-RVSTTGE-----WDKLTSNKEFNQNTRIRMIEIMLPVMDAPSN 548
              +    G  D++N   V+TT +      +K    K   +  +I  IE++L V+D P  
Sbjct: 563 WTKIFEALG--DFDNKATVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVLDYPEQ 620

Query: 549 L 549
           L
Sbjct: 621 L 621

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 206/617 (33%), Positives = 317/617 (51%), Gaps = 83/617 (13%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY---------EIPGMRWAGNANELNA 54
           IT G Y+F+RL  +  K++FG+PGDFNL LL+ +Y         E   +RW G  NELN+
Sbjct: 23  ITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTSIRWVGGCNELNS 82

Query: 55  AYAADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI----SSQAK 109
           AY+ADGY+R    +SCLITTFGVGELSA+NG++GS+AE++ VLH+VGVPS     S   K
Sbjct: 83  AYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGVPSTKITESPVQK 142

Query: 110 QLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQ 160
              LHH + + D          V+H M  + IS +T +++DI  A   +D+ I   Y   
Sbjct: 143 NWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADMVDQVILDIYKYS 202

Query: 161 RPVYLGLPANLVDLKVPA-SLLDTP---IDLSLKANDAEAE------AEVIETILDLVKS 210
           RP YL +P+N  D+ V   +L+D P   +D +L  N  ++        ++   IL ++  
Sbjct: 203 RPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMKDLTRRILKILYK 262

Query: 211 AKNPIILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSP 270
           ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE +  + G+Y G  S+ 
Sbjct: 263 SETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNENYVGLYNGKQSNA 322

Query: 271 AIKQSVESADLILSVGALLSDFNTGSFSYSY-KTKNVVEFHSDYIKI--------KNATF 321
            + +  E++DL+L  G   ++ NTG +S+SY     +++ +  Y+++            +
Sbjct: 323 KVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVVEYENGHHSELIY 382

Query: 322 PGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQE- 380
             V    +L++LL  I                        +T +KQE + N  GK  Q  
Sbjct: 383 RDVNFLHILKQLLKDIDLSKLNFKYQPL------------ATRVKQETIENSDGKITQAS 430

Query: 381 -----------GDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAA 429
                      GD+++++TG   F I    F +    I+Q  + SIG A  C LG   A 
Sbjct: 431 LGQAFPSTFNPGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGVAM 490

Query: 430 EEID----------PKK---RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTI 476
           ++            PK    R+IL  G+G+ Q+TVQE+STM+R  +   +++ NNDGYTI
Sbjct: 491 QDYPLEHVYDKSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGYTI 550

Query: 477 ERLIHGEKADYNDIQNWEHLNLLPTFGAKDYE-NHRVSTTGEWD---KLTSNKEFNQNTR 532
           ER I G    YNDI  W    LL +FG  + +  + V+   + D   KL   KE + N  
Sbjct: 551 ERAIMGPTRSYNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNNKC 610

Query: 533 IRMIEIMLPVMDAPSNL 549
           I  +E+ML  +D P  L
Sbjct: 611 IEFMEVMLGKVDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  296 bits (759), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 199/603 (33%), Positives = 307/603 (50%), Gaps = 60/603 (9%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPG---MRWAGNANELNAAYAAD 59
           +I LG+YL  RL  I  K+ FG+PGDFNL LL+ +Y   G   + W G  NELNA+YAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL---LH 114
           GY+R    + CLITT+GVGELSA+NGI GSYAE++ +LH+VGV P+  S+ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 115 H--------TLGNGDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H         + + +F ++++M  + IS  +  +TDI T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 166 GLPANLVDLKVPA-SLLDTP-IDLSLKANDAEAEA--EVIETILDLVKSAKNPIILADAC 221
            +P++  +  V + +L++ P I+LS   N    E    +   I+DL+ ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 222 ASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADL 281
             R          I +T+F +F T MGK  IDE    + G Y+G      +   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 282 ILSVGALLSDFNTGSFSYSY-KTKNVVEFHSDYIKIKNAT---------FPGVQMKFVLQ 331
            L  G  +++ N+G++S+ + K   ++E + +Y+KI             +P V M  +L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 332 KLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQE--------WLWNQVGKFLQEGDV 383
            L+  +                          PL+QE         L  ++  FL  GDV
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVL---PLQQEDEEKITQVHLQRELPNFLNPGDV 432

Query: 384 VISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPK-------- 435
           ++ ETG+  F +    FP+N   ISQ  + SIG A    LG   A ++  PK        
Sbjct: 433 LVCETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDY-PKFHLNDHSL 491

Query: 436 -----KRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDI 490
                 R+IL  G+G+ Q+TVQE++TM+R  +   +F+ NN+GYT+ER I G    YNDI
Sbjct: 492 ARNYTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDI 551

Query: 491 QNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSN----KEFNQNTRIRMIEIMLPVMDAP 546
             W    LL   G  + E +R  T  +  +L+      KE   N  I++IE+ L   D P
Sbjct: 552 MPWNWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIP 611

Query: 547 SNL 549
             L
Sbjct: 612 RQL 614

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  295 bits (756), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 196/600 (32%), Positives = 297/600 (49%), Gaps = 56/600 (9%)

Query: 3   EITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEI----PGMRWAGNANELNAAYAA 58
           +I LGKYLF+R+     K+IFG+PGDFNL LL+ +YE      G+RW G  NELNAAYAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 59  DGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTL 117
           DG++R    + CLITT+GVGELSALNG+AG++AE+V +LH+VGV   S++ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 118 GNGDFTVFHR---------MSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLP 168
            N   + F R         +   +  +   + +I  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 169 ANLV-DLKVPASLLDTP-IDL--SLKANDAEAEAEVIETILDLVKSAKNPIILADACASR 224
            + V +L    +LL TP IDL  SL   D     EV + I D +  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 225 HDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILS 284
           +D        I +T+  +F T  GK  IDE +P + G+Y G      +       DL+L+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 285 VGALLSDFNTGSFSYSYK-TKNVVEFHSDYIKIKNAT------FPGVQMKFVLQKLLTVI 337
            G  +++ N G +++ YK    +VE H  Y++  +        F G+   FVL++L+  I
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 338 XXXXXXXXXXXXXXXXXXXXXX--------XXSTPLKQEWLWNQVGKFLQEGDVVISETG 389
                                           ++ + Q  L   +  +L  GD+V+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 390 TSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAA-------------FAAEEIDPKK 436
           +  F +     P     +SQ  + SIG A    +G               F A + + K 
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHL 496
           R+IL  G+G+ Q+TVQE+++M+R+ +   + + NN+GYT+ER I G    YNDI  W+  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 497 NLLPTFGAKDYENHRVSTTG-------EWDKLTSNKEFNQNTRIRMIEIMLPVMDAPSNL 549
            L   FG  D+E     +T                 E N++  I M+E+ L VMD P  L
Sbjct: 567 KLFAAFG--DFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDI-IEMVEVKLGVMDYPHQL 623

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  295 bits (755), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 192/613 (31%), Positives = 306/613 (49%), Gaps = 72/613 (11%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIY----EIPGMRWAGNANELNAAYAAD 59
           + LG+YL+ +L QI  KTIFG+PGDFNLSLL+ +Y    +  G++W G  NELNAAYAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 60  GYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLG 118
           GY+R    + C++TT+GVGELSALNGIAG++AE++ +LHVVGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 119 NGDFT--------VFHRM-SANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPA 169
              ++        V+  M +  +    A +TD+  A  +I+  I+  +    P Y+ +P 
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 170 NLVDLKVPASLLDTPIDLSLKANDAEAEAEVIET--------------ILDLVKSAKNPI 215
           +  D  +P S     ++  L   D     E++E               IL L+ S+K P 
Sbjct: 206 DFQDALIPIS-----VNEHLSREDIMPIEEIVEIPLLPSLEMVSVCDYILSLLYSSKTPC 260

Query: 216 ILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQS 275
           I+ D    R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS   I + 
Sbjct: 261 IIGDILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKK 320

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTKNV-VEFHSDYIKIKN------ATFPGVQMKF 328
           ++  DLI+  G + ++ NTG +S++YK  +V ++ H DY++I          + G++ + 
Sbjct: 321 IQMCDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFR- 379

Query: 329 VLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQE--------WLWNQVGKFLQE 380
                + ++                          PL+QE        +L   + +++  
Sbjct: 380 ---TFVDMVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINP 436

Query: 381 GDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEE--------- 431
           GDVV+ ETG+  F +  T   ++   I+Q  + SIG A   +LG   A  +         
Sbjct: 437 GDVVVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKK 496

Query: 432 -----IDP--KKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEK 484
                + P  K R+IL  G+G+ Q+TVQEI+ ++++ +   + +LNN GYTIER I G  
Sbjct: 497 SSHSNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGAD 556

Query: 485 ADYNDIQNWEHLNLLPTFGAKDYENHR----VSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
            ++NDI  W    LL   G    E        STT  ++KL   K++        +E++L
Sbjct: 557 KEFNDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVIL 616

Query: 541 PVMDAPSNLVAQA 553
             ++ P+ L+  A
Sbjct: 617 NKLNIPTTLIKMA 629

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  290 bits (743), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 192/606 (31%), Positives = 303/606 (50%), Gaps = 58/606 (9%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIP-------GMRWAGNANELNA 54
           ++I  G Y+F+RL  + VK+IFG+PGD+N+ LL+ +Y+          + W G  NELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 55  AYAADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-----VPSISSQA 108
           AYAADGY+R    + C+ITT+GVGEL A++G+AG++AE V VLH+VG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 109 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVT 159
           +   LHH L           D+ V+  M  + ++ +   + D+ TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 160 QRPVYLGLPANLVD-LKVPASLLDTP---IDLSLKANDAEAEAEVIETILDLVKSAKNPI 215
            +P YL +P + VD L    +L++ P   +   ++ +  +    V E IL L+  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 216 ILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQS 275
           ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S+P + + 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 276 VESADLILSVGALLSDFNTGSFSYSYKTK-NVVEFHSDYIKI------KNATFPGVQMKF 328
           + + DL+L  G   ++ N G++++ +K+   +VE H  YI+       K   + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 329 VLQKL--------LTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQE 380
           +L  L        L+                          ++ + Q  L   +  +L  
Sbjct: 420 ILDLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPNYLNP 479

Query: 381 GDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI------DP 434
           GDV+IS+TGT  F I     P+    I+Q  + SIG A    LG   A  +       D 
Sbjct: 480 GDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVWDV 539

Query: 435 KK-------RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADY 487
           +K       +VILF G+G+ Q+TVQE+STM+R  +   +F+ NN+GYTIER+I G    Y
Sbjct: 540 EKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTRPY 599

Query: 488 NDIQNWEHLNLLPTFGAKDYENHRVS---TTGEWDKLTSNKEFNQNTR-IRMIEIMLPVM 543
           NDIQ W+   LL  FG  D ++ R +   T  + +   S  ++  + R I  +E+ L  M
Sbjct: 600 NDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLATM 659

Query: 544 DAPSNL 549
           D PS L
Sbjct: 660 DVPSQL 665

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  287 bits (735), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 185/574 (32%), Positives = 299/574 (52%), Gaps = 35/574 (6%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEI--PGMRWAGNANELNAAYAA 58
           MS + LG YLF RL+Q+  KT+FG+PGDFNL+LL+ +Y      ++W GNANELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 59  DGYARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLL---HH 115
           DGY+R+    C ITT+GVGELSALN ++G++AE+  VLH+VG  S+ ++     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 116 ------TLGNGDFTVFHRMSANISETTAMVTD--IATAPAEIDRCIRTTYVTQRPVYLGL 167
                 T    D  V+ +++   S  T  ++D  +     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 168 PANLVDLKVPASL---LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASR 224
           P+NL D ++P  L   L+      L+  D  A +E++   L  + S++NP  + D    R
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRV-DPHATSEMVSLTLKRIYSSRNPGFIVDQFM-R 237

Query: 225 HDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILS 284
            D++ +    ++   F  + T   +G  DE  P F GV+   LS+    + ++  D IL 
Sbjct: 238 FDLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFILH 296

Query: 285 VGALLSDFNTGSF----SYSYKTKNVVEFHSDYIKI--KNATFPGVQMKFVLQKLLTVIX 338
           +G   ++ N  S+    S     K+V+    DY ++        G+      ++LL  + 
Sbjct: 297 LG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQRMN 353

Query: 339 XXXXXXXXXXXXXXXXX--XXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGIN 396
                                    S  + Q  L   V   L+E DV+I+E  +  F + 
Sbjct: 354 SKTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMCSFMFEMP 413

Query: 397 QTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEIST 456
              +      + Q  +GSIG+A   TLGA+ A ++     RVILF G+GS Q+T+QE+++
Sbjct: 414 NIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQMTLQELAS 473

Query: 457 MVRWNLKPYLFVLNNDGYTIERLIHGEKADYND-IQNWEHLNLLPTFGAKDYE---NHRV 512
            +R+ + P +F+LNN GY++ER+I G    YND I +W+  N+L  FG ++ +   +++V
Sbjct: 474 YIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGDRSTSYKV 533

Query: 513 STTGEWDKLTSNKEFNQNTRIRMIEIMLPVMDAP 546
              GE   + + +    + +I+M+EI+L  MD P
Sbjct: 534 EKLGELKNVLTKRLDYSDGKIKMVEIILDRMDVP 567

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  281 bits (718), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 188/596 (31%), Positives = 301/596 (50%), Gaps = 52/596 (8%)

Query: 2   SEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYE-----IPG-MRWAGNANELNAA 55
           + I  GKY+F RL     K++FG+PGD+NL+LL+++Y+      P  ++W G  NELNAA
Sbjct: 36  NRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELNAA 95

Query: 56  YAADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLH 114
           YAADGY+R    + CLITT+GVGELSA+NGIAG++ E+V +LH+VGV S          H
Sbjct: 96  YAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRNFH 155

Query: 115 HTLGNGD--------FTVFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYL 165
           H + N +        + +   M  N IS +T  + +IATA  + D  +R  +   +P +L
Sbjct: 156 HLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPGFL 215

Query: 166 GLPANLVDLKVP-ASLLDTP-IDLSLKANDAEAEAEVIETIL----DLVKSAKNPIILAD 219
            +P    +L V  A+L   P I L      +    + I+ +     DL+  +K P I+ D
Sbjct: 216 FIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAIIGD 275

Query: 220 ACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESA 279
               R        +LI  T   +F T MGK  I+E +  + G++ G      +   +   
Sbjct: 276 ILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIRQC 335

Query: 280 DLILSVGALLSDFNTGSFS---YSYKTKNVVEFHSDYIKIKNAT------FPGVQMKFVL 330
           DLIL  G   ++ N+G ++   Y  K   ++EFHS+YIKIK+ +      +  +    VL
Sbjct: 336 DLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIHVL 395

Query: 331 QKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTP--LKQEWLWNQVGKFLQEGDVVISET 388
           ++L  ++                         +   + Q+++ + + K L  GD+++ +T
Sbjct: 396 KRLNKILDTSKLLFDYPYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILLCDT 455

Query: 389 GTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEE------------IDPKK 436
           GT  F +     P     ISQ  + SIG A   +LG     ++            I  + 
Sbjct: 456 GTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIKTQP 515

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQNWEHL 496
           ++IL  G+G+ Q+T+QEIST++R+ +   +F+ NNDGYTIER I G   DYNDIQ W   
Sbjct: 516 KLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPWNWT 575

Query: 497 NLLPTF--GAKDY-ENHRVSTTGEWDKLTS---NKEFNQNTRIRMIEIMLPVMDAP 546
            L+ +F    K + + ++V+   E+  L +      FN+++ +  IE+ L  +D P
Sbjct: 576 MLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVP 630

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  275 bits (703), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 190/605 (31%), Positives = 304/605 (50%), Gaps = 64/605 (10%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYE----IPGMRWAGNANELNAAY 56
           +  I  G Y+FERL     K+IFG+PGDFNL LL+ +Y+      G++W G  NELN AY
Sbjct: 29  VKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGAY 88

Query: 57  AADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGV-PSISSQAKQLL-- 112
           AADGY+R    + C+ITT+GVGELSALNG+AG++AE V VLH++GV PS   + +Q    
Sbjct: 89  AADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRSH 148

Query: 113 -LHHTLGNGDF-------TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVY 164
            +HH +   D          F  +   +  ++A + DI TA   +D+ I       +P Y
Sbjct: 149 NVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPGY 208

Query: 165 LGLPANLVDLKVP-ASLLDTPI---DLSLKANDAEAEAEVI-ETILDLVKSAKNPIILAD 219
           + +P +  D  V   +L+  PI   D  +++   E   ++  + +L  +  +  P + +D
Sbjct: 209 VFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFSD 268

Query: 220 ACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESA 279
               R +++ E R+ I+     ++ T MGK ++DE++P++ G+Y G  +   ++ +V+S+
Sbjct: 269 LLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDSS 328

Query: 280 DLILSVGALLSDFNTGSFSYSYK--------TKNVVEFHSDYIKIKNAT------FPGVQ 325
           DLIL  G   ++ N G +S+ +         + N+++F    IK KNA+      F  V 
Sbjct: 329 DLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSV- 385

Query: 326 MKFVLQKLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVI 385
           +K+V   L                            +  + Q+ L   +  +  +GDV+I
Sbjct: 386 LKYVNDNL-----DKSKLSFSYPPVPKSNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLI 440

Query: 386 SETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEE----------IDPK 435
            ETG+  FG+    F      I+Q  + SIG A    LG      +          + PK
Sbjct: 441 VETGSFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPK 500

Query: 436 K---RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDIQN 492
               R+IL  G+G+ Q+T+QE ++ +R+ +   + V NN+GYT+ER I+G    YNDI  
Sbjct: 501 DYIPRLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAP 560

Query: 493 WEHLNLLPTFGAKDYENH-----RVSTTGEWDKLTSN-KEFNQNTRIRMIEIMLPVMDAP 546
           ++   LL  FG  D+EN       V    E  +L +  K   +   I++ E+MLPVMD P
Sbjct: 561 FKWTALLNVFG--DFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIP 618

Query: 547 SNLVA 551
             L A
Sbjct: 619 QELNA 623

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  246 bits (628), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/562 (28%), Positives = 264/562 (46%), Gaps = 13/562 (2%)

Query: 5   TLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARL 64
           T+G YL  RL Q  +K  F +PGD+NL LLDK+ E P +      NELN ++AA+GYAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVD-LKVPASLLDT 183
            + M+  I+     +     AP+ ID  IR     ++P Y+ +P N+   +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 184 PIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSF 243
            ++      D  ++A  +   +D + S   P +LA       D +    +L +  +    
Sbjct: 183 LVNSVPTPKDVLSQA--VNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYKT 303
           V P  K    E HP+F GVY G +S+      +E +DL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 304 KNVVEFHSDYIKIKNATFPGVQMKFVLQKLL-TVIXXXXXXXXXXXXXXXXXXXXXXXXS 362
            + +E  +D ++    +F  + +   L  L   V                          
Sbjct: 301 SHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYNRLRQSPPLIKAADPK 360

Query: 363 TPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCT 422
             + ++ +  Q+ + +     + +ETG S F   Q   P       ++ WG IG++   +
Sbjct: 361 AAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVPAS 420

Query: 423 LGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHG 482
           LG A  A    P +R+I   G+GS Q+T QE+S MVR      +F++NN GYTIE  IH 
Sbjct: 421 LGYAVGA----PDRRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEIH- 475

Query: 483 EKADYNDIQNWEHLNLLPTFGAKD--YENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540
               YN+I+NW +  L+  F A +   +  +  T GE        + N +    +IEI +
Sbjct: 476 -DGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANVSGPT-LIEIQI 533

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
              D  + L+      A  NA+
Sbjct: 534 NRDDCTNELITWGHFVALANAR 555

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  241 bits (614), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 172/546 (31%), Positives = 271/546 (49%), Gaps = 57/546 (10%)

Query: 58  ADGYARLKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVP-SISSQAKQLL--- 112
           ADG++R    + CLITT+GVGELSALNGIAG+++E+V VLH+VGV  S+ S+++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 113 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMVTDIATAPAEIDRCIRTTYVTQRPV 163
           LHH    L + +F      V+  M  + ++ +   + DI TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 164 YLGLPANLVDLKV-PASLLDTPIDLSLKANDAEAEA----EVIETILDLVKSAKNPIILA 218
           Y+ +P +  D+ V P++L   P +++L+   + A +    E++  +L  +  +K P I+ 
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRP-EITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIG 181

Query: 219 DACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVES 278
           D    R    +    LI +T   +F T MGK  IDE +  + G+Y G  S   + +    
Sbjct: 182 DVLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQ 241

Query: 279 ADLILSVGALLSDFNTGSFSYSYKTK-NVVEFHSDYIKIKNAT------FPGVQMKFVLQ 331
           +DL+L  G  + + N G ++ +YK    V+EFHS+YI+  +A+      F GV    VL+
Sbjct: 242 SDLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLE 301

Query: 332 KLLTVIXXXXXXXXXXXXXXXXXXXXXXXXSTP-----LKQEWLWNQVGKFLQEGDVVIS 386
           +L+  I                        + P     + Q +L   V  +L  GDV++ 
Sbjct: 302 RLIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVC 361

Query: 387 ETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEI-------------- 432
           ETG+  F I     P+    I+Q  + SIG A     G   A ++               
Sbjct: 362 ETGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVE 421

Query: 433 ---DPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADYND 489
              D + R+IL  G+G+ Q+T+QE+++MVR+ +   + +LNN+GYTIER I G    YND
Sbjct: 422 IPDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYND 481

Query: 490 IQNWEHLNLLPTFGAKDYENHR-VSTTGEWD-----KLTSNKEFNQNTRIRMIEIMLPVM 543
           + +W+   LL  FG  D++  R VS   E       KL   K   +   I ++EI L  M
Sbjct: 482 VMSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTM 539

Query: 544 DAPSNL 549
           D P  L
Sbjct: 540 DFPKQL 545

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  238 bits (608), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/564 (27%), Positives = 265/564 (46%), Gaps = 17/564 (3%)

Query: 5   TLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARL 64
           T+G YL  RL+++ ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDAEAE--AEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
           I+  L  + +E +     ++    L+ S   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLL-TVIXXXXXXXXXXXXXXXXXXXXXXXX 361
             + +E  SD +K  +  +  +++   L  L   V                         
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           S  + ++ +  Q+   +     + +ETG S F   Q   P       ++ WG IG++   
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 TLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIH 481
             G +  A    P + ++   G+GS Q+TVQE++ M+R      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 GEKADYNDIQNWEHLNLLPTFGAKD--YENHRVSTTGEWDKLTSNKEFNQNTR-IRMIEI 538
                YN+I+NW +  L+  F A D   +  +V T  E  +    K+   NTR   +IEI
Sbjct: 477 --DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAI--KKAKSNTRGPTLIEI 532

Query: 539 MLPVMDAPSNLVAQAKLTASINAK 562
            +   D  + L++     A  NA+
Sbjct: 533 QINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  238 bits (607), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 153/562 (27%), Positives = 261/562 (46%), Gaps = 13/562 (2%)

Query: 5   TLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARL 64
           T+G YL  RL+++ ++  F +PGD+NL+LLDK+   P +     +NELN ++AA+GYAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 65  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTV 124
           KG++ ++ TF VG  SA NGI  +Y E++ V+ + G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTP 184
              M+  I+     +     AP+ ID  IR     ++P Y+ +P N   +   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTN---MSTQSCALPGP 180

Query: 185 IDLSLKANDAEAE--AEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
           I+  L  + +E +     ++    L+ S   P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYSYK 302
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 303 TKNVVEFHSDYIKIKNATFPGVQMKFVLQKLL-TVIXXXXXXXXXXXXXXXXXXXXXXXX 361
             + +E  SD +K  +  +  +++   L  L   V                         
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVPPAIKAAEP 360

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           S  + ++ +  Q+   +     + +ETG S F   Q   P       ++ WG IG++   
Sbjct: 361 SAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWSVPA 420

Query: 422 TLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIH 481
             G +  A    P + ++   G+GS Q+TVQE++ M+R      +F++NN GYTIE  IH
Sbjct: 421 CFGYSVGA----PDREIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEVEIH 476

Query: 482 GEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTR-IRMIEIML 540
                YN+I+NW +  L+  F A D            +   + K+   NTR   +IEI +
Sbjct: 477 --DGPYNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELAEAIKKAKSNTRGPTLIEIQI 534

Query: 541 PVMDAPSNLVAQAKLTASINAK 562
              D  + L++     A  NA+
Sbjct: 535 NRDDCTNELISWGHYVALANAR 556

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 87.0 bits (214), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 58/92 (63%), Gaps = 6/92 (6%)

Query: 386 SETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEG 445
           +ETG S    NQ     + + ISQVLW  I FA G TL    +AE+IDP  R ILF+G+ 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 446 SLQLTVQEISTMVRWNLKPYLFVLNNDGYTIE 477
            L LTVQE+ T +RW LKPYLFV NND   +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 131/297 (44%), Gaps = 24/297 (8%)

Query: 7   GKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKG 66
           G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 196

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVD--LKVPAS 179
               +S + ++   MV  +   P  I+       V+ R  PV + LP ++    LK P  
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIA-VSGRPGPVLVDLPKDVTSAILKTPIP 255

Query: 180 LLDT-PIDLSLKANDAEAEAEV---IETILDLVKSAKNPII-LADACASRHDVKAETRKL 234
           +  T P D   K   A A+      I+ + DL+  AK P++ +      R D     R+L
Sbjct: 256 VNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKLLRQL 315

Query: 235 IDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSD 291
            D  Q P   T  G G+ D++ P+   + +G   S     SV++ADLI+++GA   D
Sbjct: 316 ADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFDD 371

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G  L AA  A+   P   VI   G+ S  +T+ E+S+ V+      + VLNN+
Sbjct: 518 GYGLPAAIGAQVAKPDALVIDIDGDASFNMTLMELSSAVQAGAPVKILVLNNE 570

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 136/311 (43%), Gaps = 32/311 (10%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRH-DV 227
           L  PI             L+ +A D E   + I    DL+  AK P++   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQD-EFVMQSINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGA 287
               ++L D  Q P   T  G GS D++ P+   + +G         +V++ADLI++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGA 375

Query: 288 LLSDFNTGSFS 298
              D  TG+ S
Sbjct: 376 RFDDRVTGNIS 386

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     L AA  A+   P+  VI   G+ S  +T+ E+S+ V+      + +LNN+
Sbjct: 523 GTMGYG----LPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNE 578

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 136/300 (45%), Gaps = 18/300 (6%)

Query: 7   GKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKG 66
           G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GYAR  G
Sbjct: 95  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHEQGAGHMAEGYARASG 154

Query: 67  MS-CLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
            +  ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 155 KTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 208

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LKVPASLL 181
              +S + ++   MV  +A  P  I+         +  PV + LP ++    L+ P  + 
Sbjct: 209 ---ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLPKDVTAAILRNPIPIK 265

Query: 182 DT-PIDLSLKANDAEA-EAEVIETILDLVKSAKNPII-LADACASRHDVKAETRKLIDIT 238
            T PI   LK+   EA   E I    DL+  AK P++ + +   +  D     ++L D  
Sbjct: 266 STLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVGNGIMNNPDGPRLLKELSDRA 325

Query: 239 QFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFS 298
           Q P   T  G G+ D++ P+   + +G         ++++ADL++++GA   D  TG+ +
Sbjct: 326 QIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLVIALGARFDDRVTGNIA 384

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 45/104 (43%), Gaps = 7/104 (6%)

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTI--- 476
           G  L AA  A+   P   VI   G+ S  +T+ E+S+ V+  +   + +LNN+   +   
Sbjct: 524 GYGLPAAIGAQVARPDAIVIDIDGDASFNMTLTELSSAVQAGVPIKILLLNNEEQGMVTQ 583

Query: 477 -ERLIHGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWD 519
            + L +  +  +    N + + L    G K     RV   GE D
Sbjct: 584 WQSLFYEHRYSHTHQLNPDFMKLADAMGLKGI---RVKNQGELD 624

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 143/310 (46%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+     ++    +E  A + A+GYAR
Sbjct: 82  LTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYAR 141

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 142 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVG--- 198

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV ++A  P  I+   +  T     PV + LP +     V A++
Sbjct: 199 ------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLPKD-----VTAAI 247

Query: 181 LDTPIDL-------SLKANDAEAEAE-VIETI---LDLVKSAKNPII-LADACASRHDVK 228
           L TPI +       +L+   A  + + VIE I    DL+  AKNP++ +     +  D  
Sbjct: 248 LRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKKSADLINIAKNPVLYVGGGILNNVDGP 307

Query: 229 AETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
              ++L +  Q P   T  G G+ D++ P+   + +G         +V+++DLI++VGA 
Sbjct: 308 RLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNSDLIIAVGAR 366

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 367 FDDRVTGNIT 376

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 13/119 (10%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     +GA  A     P   VI   G+ S  +++QE+S+ V+ N    + VLNN+
Sbjct: 513 GTMGYGLPSAIGAQVA----KPDALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNNE 568

Query: 473 GYTI----ERLIHGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEF 527
              +    + L +  +  +    N + + L    G K     RV    E +K  + KEF
Sbjct: 569 EQGMVTQWQSLFYEHRYSHTHQLNPDFVKLAEAMGMKGM---RVKDQAELEK--TLKEF 622

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 110/507 (21%), Positives = 207/507 (40%), Gaps = 58/507 (11%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY+    ++    +E  A + A+GYAR
Sbjct: 87  LTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKHEQGAGHMAEGYAR 146

Query: 64  LKGMSCLI-TTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G   ++  T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 147 ASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANL--------- 171
                 +S + ++   M+ ++A  P  I+      T     PV + LP ++         
Sbjct: 204 ------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDLPKDVTAAILRDAI 257

Query: 172 -VDLKVPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPII-LADACASRHDVKA 229
            V   +P++ L     L+ KA D E   + I    DL+  AKNP++ +        D   
Sbjct: 258 PVGSSLPSNALS---QLTNKAQD-EFVLDNINKAADLINLAKNPVLYVGGGILGNEDGPK 313

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
             ++L +  Q P   + +G G+ D++ P+   + +G         ++++ADLI+++G   
Sbjct: 314 LLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAIGTRF 372

Query: 290 SDFNTGSFS-------------------YSYKTKNVVEFHSDYIKIK-NATFPGVQMKFV 329
            D  TG+ +                   +    KN+ +     I ++ +AT     ++ +
Sbjct: 373 DDRVTGNIAKFAPEARRAALENRGGIIHFEISPKNINKVVEAQIAVEGDAT---ANLQSI 429

Query: 330 LQKLLTVIXXXX-XXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQE-GDVVISE 387
           L K+  V                          ++ LK + + +++ K     G  VI  
Sbjct: 430 LPKIFPVKERTEWFAKIKEWKTKYPYSYMKETPNSKLKPQTVISKLSKIANATGKEVIVT 489

Query: 388 TGTSAFGI-NQTHFPNNTYGISQVLWGSIGFAT-GCTLGAAFAAEEIDPKKRVILFTGEG 445
           TG     +    H+   T+   +    S G  T G  L AA  A+   P   VI   G+ 
Sbjct: 490 TGVGQHQMWAAQHW---TWKHPRTFITSGGLGTMGYGLPAAIGAQVAKPDALVIDIDGDA 546

Query: 446 SLQLTVQEISTMVRWNLKPYLFVLNND 472
           S  +T+ E+S+ V+      + +LNN+
Sbjct: 547 SFNMTLTELSSAVQAGAPVKILLLNNE 573

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 137/309 (44%), Gaps = 21/309 (6%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M  +T G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+G
Sbjct: 111 MIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFVLPRHEQGAGHMAEG 170

Query: 61  YARLKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLG 118
           YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G
Sbjct: 171 YARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVIG 230

Query: 119 NGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVD--LK 175
                    +S + ++   MV  +   P  I+         +  PV + LP ++    LK
Sbjct: 231 ---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPVLIDLPKDVTAAVLK 281

Query: 176 VPASLLDTPIDLSLKAN-----DAEAEAEVIETILDLVKSAKNPIILADA-CASRHDVKA 229
            P  +L+  +  +  +N       +  +E I+    L+  AK P+I A A   S  +   
Sbjct: 282 NPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMAKKPVIYAGAGILSNLNGPT 341

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
             ++L + +Q P   T    G+ D+Q P+   + +G   S     ++++ADLI+++G   
Sbjct: 342 LLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSAVANLAIQNADLIIALGGRF 400

Query: 290 SDFNTGSFS 298
            D  TG+ S
Sbjct: 401 DDRVTGNIS 409

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     +GA  A     P+  VI   G+ S  +T+ E+S+ V+ N    + +LNN+
Sbjct: 546 GTMGYGLPAAIGAQVAF----PEALVIDIDGDASFNMTLTELSSAVQANTPIKIMLLNNE 601

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 134/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI--DLSLKAN---------DAEAEAEVIETILDLVKSAKNPIILADACASRH-DVK 228
           L  PI    +L +N           E   + I    DL+  AK P++   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 229 AETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
              ++L    Q P   T  G GS D++ P+   + +G         ++++ADLI++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 289 LSDFNTGSFS 298
             D  TG+ S
Sbjct: 377 FDDRVTGNIS 386

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     L AA  A+   P+  VI   G+ S  +T+ E+S+ V+      + VLNN+
Sbjct: 523 GTMGYG----LPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILVLNNE 578

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 138/310 (44%), Gaps = 32/310 (10%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I+E    ++    +E  A + A+GYAR
Sbjct: 84  MTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHEQGAGHMAEGYAR 143

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           LG   
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVLG--- 200

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP +     V A++
Sbjct: 201 ------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLPKD-----VTAAI 249

Query: 181 LDTPIDL-------SLK-----ANDAEAEAEVIETILDLVKSAKNPII-LADACASRHDV 227
           L  PI +       +LK      +DA  + E IE    L+  AK P++ +     +  + 
Sbjct: 250 LRNPIPVESTLPTSTLKNLVGDMHDAFTK-ERIEKAAKLINIAKKPVLYVGGGILNNPEG 308

Query: 228 KAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGA 287
               + L D  Q P   T  G G+ D++ P+   + +G   S     S+++ADLI+++G 
Sbjct: 309 PKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLSIQNADLIIAIGT 367

Query: 288 LLSDFNTGSF 297
              D  TG+ 
Sbjct: 368 RFDDRVTGNL 377

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 138/311 (44%), Gaps = 31/311 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D IY     ++    +E  A + A+GYAR
Sbjct: 97  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYAR 156

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 157 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG--- 213

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASL 180
                 +S + ++   MV ++A  P  I+         +  PV + LP +     V A++
Sbjct: 214 ------ISRSCTKWNVMVKNVAELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAAV 262

Query: 181 LDT--PIDLSLKANDAEAE----------AEVIETILDLVKSAKNPII-LADACASRHDV 227
           L    P + +L + +  A           A  I    DL+  AK P++ + +   +  D 
Sbjct: 263 LREAIPTESTLPSLNGGATTGATVFDEFLAPAINKAADLINLAKKPVLYVGNGILNNEDG 322

Query: 228 KAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGA 287
               ++L D  Q P   T  G G+ D++ P+   + +G         ++++ADLI++VGA
Sbjct: 323 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGA 381

Query: 288 LLSDFNTGSFS 298
              D  TG+ +
Sbjct: 382 RFDDRVTGNIT 392

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 8/103 (7%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++GF     L AA  A+   P   VI   G+ S  +T+ E+S+ V+      + +LNN+
Sbjct: 529 GTMGFG----LPAAIGAQVAKPDAMVIDIDGDASFNMTLTELSSAVQAGTPVKILLLNNE 584

Query: 473 GYTI----ERLIHGEKADYNDIQNWEHLNLLPTFGAKDYENHR 511
              +    + L +  +  +   +N +   L    G K  +  R
Sbjct: 585 EQGMVTQWQSLFYENRYSHTHQRNPDFQKLCEAMGVKPLKASR 627

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 133/306 (43%), Gaps = 22/306 (7%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +S+ A        +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPMVVFTGQVSTTA--------IGTDAF 193

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVD--LKVP 177
                  +S + ++   MV  I   P  I+      T     PV + LP ++    L+ P
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKDVTAAVLRNP 253

Query: 178 ASLLDT-PIDLSLKANDAEAEAEVIETIL---DLVKSAKNPIILADACASRHDVKAE-TR 232
                T P D  L+      +   + +I    DL+  AK P++        H+   +  +
Sbjct: 254 IPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENGPKFLK 313

Query: 233 KLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDF 292
           +L +  Q P   T  G G+ D++ P+   + +G   S A   +V++ADLI+++GA   D 
Sbjct: 314 ELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGARFDDR 372

Query: 293 NTGSFS 298
            T + S
Sbjct: 373 VTCNIS 378

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++GF     L AA  A+   P   V+   G+ S  +T+ E+S+ V+      + +LNN+
Sbjct: 515 GTMGFG----LPAAIGAQVAKPDAIVVDIDGDASFNMTLMELSSAVQARAPVKILLLNNE 570

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 131/302 (43%), Gaps = 34/302 (11%)

Query: 7   GKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKG 66
           G+   E + +  V T+FG PG   L++ D IY      +    +E  A + A+GYAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVF 125
               ++ T G G  + +  +A + A+ V ++   G  + SS          +G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATSS----------IGTDAFQEA 195

Query: 126 H--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPASLL 181
               +S + ++   MV ++   P  I+       V+ R  PV + LP +     V +++L
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIA-VSGRPGPVLVDLPKD-----VTSAIL 249

Query: 182 DTPIDLS-----------LKANDAEAEAEVIETILDLVKSAKNPII-LADACASRHDVKA 229
            TPI +             K+   E     ++   DL+  AK P+I +      +     
Sbjct: 250 RTPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPK 309

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
             R+L +  Q P   T  G G+ D++ P+   + +G   S     SV++ADLI+++GA  
Sbjct: 310 LLRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARF 368

Query: 290 SD 291
            D
Sbjct: 369 DD 370

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     +GA  A     P   VI   G+ S  +T+ E+S+ V+      + VLNN+
Sbjct: 514 GTMGYGLPSAIGAQIA----RPDALVIDIDGDASFNMTLMELSSAVQAGAPVKIVVLNNE 569

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 134/309 (43%), Gaps = 34/309 (11%)

Query: 7   GKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKG 66
           G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 92  GQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHEQGAGHMAEGYARASG 151

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ + ++   G VP+ +           +G      
Sbjct: 152 KPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVVG------ 205

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPASLLDT 183
              +S + ++   MV  +A  P  I+         +  PV + LP +     V A++L  
Sbjct: 206 ---ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLPKD-----VTAAILRE 257

Query: 184 PIDL-------------SLKANDAEAEAEVIETILDLVKSAKNPII-LADACASRHDVKA 229
           PI +             S+   D  A++  I    DL+  AK P++ + +   +  D   
Sbjct: 258 PIPIKSTLPSGTLTQIKSIAQEDFLADS--INRAADLINLAKKPVLYVGNGIFNNEDGPR 315

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
             ++L +  Q P   T  G G+ D++ P+   + +G         ++++ADLI++VGA  
Sbjct: 316 LLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQNADLIIAVGARF 374

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 375 DDRVTGNIA 383

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 72/310 (23%), Positives = 134/310 (43%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY     ++    +E  A + A+GY+R
Sbjct: 76  LTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQGAGHMAEGYSR 135

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ + ++   G VP+ +           +G   
Sbjct: 136 ASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAFQEADVIG--- 192

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A++
Sbjct: 193 ------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 241

Query: 181 LDTPIDLS-----------LKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKA 229
           L  PI ++           +K    E   E +     L+  AK P++        H+   
Sbjct: 242 LRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVGGGILNHEEGP 301

Query: 230 E-TRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
              R+L +  Q P   + +G G+ D++ P+   +      +PA   ++++ADLI++VGA 
Sbjct: 302 RLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDMLGMHGHAPA-NLAIQNADLIIAVGAR 360

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 361 FDDRVTGNIA 370

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 131/303 (43%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 64  LKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  I   P  I+      T     PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 259

Query: 181 LDTPIDLS----------LKANDAEAEAEV-IETILDLVKSAKNPII-LADACASRHDVK 228
           L TPI +           L  N     +EV I+   +L+  AK PI+ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 229 AETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
              ++L D  Q P   T    G+ D++ P+   +      +PA   ++++ADLI++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDMLGMHGHAPA-NLAMQNADLIIAVGAR 378

Query: 289 LSD 291
             D
Sbjct: 379 FDD 381

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 125/290 (43%), Gaps = 33/290 (11%)

Query: 8   KYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM 67
           +Y  + L Q  V T+FG+ G   + L D +    G+++    NE +A+YAA  Y  L G 
Sbjct: 7   EYFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGK 65

Query: 68  -SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH 126
              L+   G G + AL GI  S +    ++ + G    SS+         L  G F    
Sbjct: 66  PGVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAG----SSE--------DLHKGGFQELD 113

Query: 127 RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTPID 186
           ++S  +S+       + T P  I+     TY   R    G P  +  +  P SL+   I+
Sbjct: 114 QVSL-LSDHLKFTGKLTTDPDVIEL---VTYNAMRLTTTGTPG-VTYIDFPGSLISESIE 168

Query: 187 LS------LKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240
            S      +       + E ++ ++ L+ S +N  IL        +   E RKLI+    
Sbjct: 169 RSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNL 228

Query: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
           P   TPM KG + + HP          +S A  ++++ A+++L +GA L+
Sbjct: 229 PFLSTPMAKGVVPDSHP--------LNASSARSKALKEAEIVLVLGARLN 270

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 2/97 (2%)

Query: 377 FLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKK 436
           F+ +   +I   G +     +  FP + Y   ++  G+     G  LG A AA+   P K
Sbjct: 373 FIDDSRTIIVSEGANTMDQARISFPTD-YPKHRLDAGT-NATMGIGLGYAIAAKIARPDK 430

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
            ++L  G+ +   +  EI T VR  L   + V+NN G
Sbjct: 431 SIVLLQGDSAFGFSAMEIETAVRNRLGLVIIVMNNSG 467

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 131/304 (43%), Gaps = 32/304 (10%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRH-DV 227
           L  PI             L+ +  D E   + I    DL+  AK P++   A    H D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQD-EFVLQNINKAADLINLAKKPVLYVGAGILNHADG 316

Query: 228 KAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGA 287
               ++L D  Q P   T  G G+ D++ P+   + +G         +V++ADL+++VGA
Sbjct: 317 PRLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGA 375

Query: 288 LLSD 291
              D
Sbjct: 376 RFDD 379

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 404 TYGISQVLWGSIGFAT-GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNL 462
           T+   +    S G  T G  L AA  A+   P   VI   G+ S  +T+ E+S+ V+   
Sbjct: 509 TWKTPRTFITSGGLGTMGYGLPAAIGAQVAKPDSLVIDIDGDASFNMTLTELSSAVQAGT 568

Query: 463 KPYLFVLNND 472
              + VLNN+
Sbjct: 569 PVKILVLNNE 578

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 126/529 (23%), Positives = 205/529 (38%), Gaps = 102/529 (19%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 96  MTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQGAGHMAEGYAR 155

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +A + A+  GV  VV    +++ A        +G   F
Sbjct: 156 ASGKPGVVLVTSGPGATNVVTPMADALAD--GVPLVVFTGQVATSA--------IGTDAF 205

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPAS 179
                  +S + ++   MV  I   P  I+      T     PV + LP +     V A+
Sbjct: 206 QEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 260

Query: 180 LLDTPIDL-SLKANDA----------EAEAEVIETILDLVKSAKNPIILADACASRHDVK 228
           +L  PI + S+  +D           E   E I    DL+  AK P++   A     ++ 
Sbjct: 261 VLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYVGAGILGSEMG 320

Query: 229 AE-TRKLIDITQFPSFVTPMGKGSID-EQHPRFGGVYVGTLSSPAIKQSVESADLILSVG 286
            +  ++L D  Q P   T  G G+ + E H       VG   + A   ++++ADLI+++G
Sbjct: 321 PQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAIQNADLIIALG 378

Query: 287 ALLSD---FNTGSFSYSY------KTKNVVEFHSDYIKIKNATFPGVQMK----FVLQKL 333
           A   D    N   F+         K   +V F      I       V ++      L+KL
Sbjct: 379 ARFDDRVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVEGDVTRNLEKL 438

Query: 334 LTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQE------------- 380
           L ++                        S P + EW   QV K+ QE             
Sbjct: 439 LPLV-----------------------ESVPERPEW-SAQVAKWKQEYPYAYQKETPGSK 474

Query: 381 ----------GDVVISETGTSAF---GINQTHF---PNNTYGISQVLWGSIGFAT-GCTL 423
                      D+V+ ++G  A    G+ Q       + T+   +    S G  T G  L
Sbjct: 475 IKPQTVISKLSDLVL-KSGRPAIVTTGVGQHQMWAAQHWTWKSPRSFITSGGLGTMGYGL 533

Query: 424 GAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
            AA  A+   P   VI   G+ S  +T+ E+S+ V+      + +LNN+
Sbjct: 534 PAAIGAQVARPDAIVIDIDGDASFNMTLMELSSAVQARTPVKVLLLNNE 582

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 120/284 (42%), Gaps = 25/284 (8%)

Query: 9   YLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM- 67
           Y    L    V T+FG+ G   + L D + E  G+++    NE +A+YAA  Y  L G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 68  SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF-TVFH 126
             L+   G G + AL GI  S +    +L + G    SS+A+       L        + 
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQHRGGFQELDQVSLLKPYV 120

Query: 127 RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTPID 186
           + S  ++ +     D+ T     D      Y T    YL +P NL+   V    L  P  
Sbjct: 121 KFSGQLNSSN---IDVLT----YDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL--PPV 171

Query: 187 LSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSFVTP 246
            ++    +  +   ++ + DL++     +++     + H    E R+ +D  Q P   TP
Sbjct: 172 KNIYVPKSSPDPSAVQEVTDLIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLPFLPTP 230

Query: 247 MGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
           MGKG + + HP           S A  ++++ A ++L +GA L+
Sbjct: 231 MGKGVVPDSHP--------LNVSSARSRALQEAKVVLVLGARLN 266

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 8/104 (7%)

Query: 380 EGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVI 439
           E  +++SE G +     +  FP + Y + ++  G+     G  +G A AA+  +P K V+
Sbjct: 371 ESTIIVSE-GANTMDKARVSFPTD-YPLQRLDAGT-NATMGVGMGYALAAKVSNPDKTVL 427

Query: 440 LFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGE 483
           +  G+ +   +  +I T  R  L   + V+NN G     + HG+
Sbjct: 428 VIQGDSAFGFSAMDIETATRSGLALIVIVMNNGG-----IYHGQ 466

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 134/312 (42%), Gaps = 34/312 (10%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + DV T+FG PG   L + D I+E     +    +E  A + A+GYAR
Sbjct: 104 LTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFILPRHEQGAGHMAEGYAR 163

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
             G    ++ T G G  + +  +  + A+ V ++   G  + S+          +G   F
Sbjct: 164 ATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATSA----------IGTDAF 213

Query: 123 TVFH--RMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR-PVYLGLPANLVDLKVPAS 179
                  +S + ++   MV ++   P  I+         +  PV + LP +     V A+
Sbjct: 214 QEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGPVLVDLPKD-----VTAA 268

Query: 180 LLDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADA-CASRHD 226
           +L  PI             L+ +A D E  +  ++   DLV  AK PI+   A   +  D
Sbjct: 269 VLRNPIPTKSTLPSDSLAQLTKRAQD-EFTSNNVKRAADLVNVAKKPILYVGAGIFNNPD 327

Query: 227 VKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVG 286
                ++L +  Q P   T  G G+ D++  +   + +G         ++++ADLIL+VG
Sbjct: 328 GPRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCATANLAIQNADLILAVG 386

Query: 287 ALLSDFNTGSFS 298
           A   D  T + S
Sbjct: 387 ARFDDRVTCNIS 398

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 132/305 (43%), Gaps = 34/305 (11%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++     +    +E  A + A+GYAR
Sbjct: 87  LTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVLPRHEQGAGHMAEGYAR 146

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 147 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVVG--- 203

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPAS 179
                 +S + ++   MV  I   P  I+       V+ R  PV + LP +     V A+
Sbjct: 204 ------ISRSCTKWNVMVRSIEELPLRINEAFEIA-VSGRPGPVLVDLPKD-----VTAA 251

Query: 180 LLDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDV 227
           +L  PI             L+ +A D      ++ T  DL+  AK P++   A    +  
Sbjct: 252 ILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRTA-DLLNKAKTPVLYVGAGILNNPA 310

Query: 228 KAE-TRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVG 286
             +  ++L +  Q P   T    G+ D+Q P+   + +G         ++++ADLIL+VG
Sbjct: 311 GPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCATANMAIQNADLILAVG 369

Query: 287 ALLSD 291
           +   D
Sbjct: 370 SRFDD 374

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 135/309 (43%), Gaps = 28/309 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V TIFG PG   L + D I++    ++    NE  A + A+GYAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY---VTQR--PVYLGLPANLV---- 172
                 +S + ++   MV  +   P    RCI   +   ++ R  PV + LP ++     
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKDVTAAIL 260

Query: 173 --DLKVPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADA-CASRHDVKA 229
              + V ++L  + +    K    E   E IE    L+  AK P++   A   +  D   
Sbjct: 261 RNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNNVDGPR 320

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
             ++L D  Q P   T  G G+ D++ P+   + +G         +V++ADL++++G   
Sbjct: 321 IIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIALGTRF 379

Query: 290 SDFNTGSFS 298
            D  TG+ +
Sbjct: 380 DDRVTGNIT 388

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 131/304 (43%), Gaps = 32/304 (10%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E +++ +V T+FG PG   L + D I+      +    +E  A + A+GYAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 181 LDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADA-CASRHDV 227
           L  PI             L+  A D E   + I    DL+  AK P++   A   +  D 
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQD-EFVMQSISKAADLINLAKKPVLYVGAGILNNADG 316

Query: 228 KAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGA 287
               ++L +  Q P   T  G GS D++ P+   + +G         +V++ADL+++VGA
Sbjct: 317 PRLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGA 375

Query: 288 LLSD 291
              D
Sbjct: 376 RFDD 379

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNND 472
           G++G+     +GA  A     P+  VI   G+ S  +T+ E+S+ V+      + +LNN+
Sbjct: 523 GTMGYGLPSAIGAQVA----KPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNE 578

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 129/297 (43%), Gaps = 35/297 (11%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T  +Y    L Q ++ T+FG+ G   + L DK+ E  G+R+    NE  A+YAA GY  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           L G  + L+   G G + AL GI  S +    ++ + G  S +S+  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 123 TVFHRMSA--NISETTAMVTDIATAPAEIDRCIRTTYVTQRPV---YLGLPANLVD--LK 175
               ++S      + T  +  I    A  +      +  Q P+   Y+  P NL++   K
Sbjct: 119 QDLDQVSLLNKYVKYTVKLNSINIPTALFN---AYNFAIQSPMGVTYIDFPGNLIEGNYK 175

Query: 176 VPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNP--IILADACASRHDVKAETRK 233
           V A     P+ +  +   +     V E    +++++ N   +IL       H    +  K
Sbjct: 176 VQAQPATNPVSIPRRVRCSPDPNTVNEVAKLIIENSSNNVLVILGKGAVEFHK---DINK 232

Query: 234 LIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
            I+    P   TPM KG + + H     + V +  S A+K     A+++L +GA L+
Sbjct: 233 FINTFNLPFLPTPMAKGILPDSH----NLNVSSARSKALKD----ANIVLVLGARLN 281

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 370 LWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAA 429
           ++  + K + E   V+   G ++  I +  FP++     Q L        G  LG   AA
Sbjct: 382 VYGALRKLMDESKTVLVTEGANSMDIARISFPSSVP--KQRLDAGTNATMGIGLGYGIAA 439

Query: 430 --EEIDPKKR---VILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
              E+   KR   VIL  G+ +   +  EI T VR+ L   + V+NN G
Sbjct: 440 CLNELRNGKRGKDVILIQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 140/310 (45%), Gaps = 30/310 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + +  V TIFG PG   L + D IY     ++    +E  A + A+GYA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 181 LDTPIDL--SLKANDAE------AEAEVIETILD---LVKSAKNPIILADACASRHDVKA 229
           L +PI +  +L +N  E       +   ++TI +   L+  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 230 ET-RKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
           +  ++L +  Q P   T  G G+ D+  P+   + +G   S A   ++++AD+I+++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 289 LSDFNTGSFS 298
             D  TG+ +
Sbjct: 379 FDDRVTGNVA 388

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 413 GSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNN 471
           G++GF     L AA  A+   P   VI   G+ SL +T+ E+ST V+      + +LNN
Sbjct: 525 GTMGFG----LPAAIGAQVARPNALVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/307 (23%), Positives = 132/307 (42%), Gaps = 30/307 (9%)

Query: 7   GKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKG 66
           G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR  G
Sbjct: 76  GEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAEGYARASG 135

Query: 67  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGDFTV 124
               ++ T G G  + +  +A + A+ V ++   G VP  +           +G      
Sbjct: 136 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVVG------ 189

Query: 125 FHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASLLDT 183
              +S + ++   MV  +   P  I+      T     PV + LP +     V A++L +
Sbjct: 190 ---ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAAILRS 241

Query: 184 PIDLS--------LKANDAEAEAEVIETILD---LVKSAKNPIILADACASRHDVKAE-T 231
           PI L+         +     A+ + + ++ D   L+  A+ P++   A         E  
Sbjct: 242 PIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQKPVLYVGAGILNSTRGPEFL 301

Query: 232 RKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSD 291
           R+L +  Q P   T    G+ D++  +   + +G   S A   +V++ADLI+++GA   D
Sbjct: 302 RELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIALGARFDD 360

Query: 292 FNTGSFS 298
             TG+ +
Sbjct: 361 RVTGNIA 367

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 135/314 (42%), Gaps = 38/314 (12%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D I++     +    NE  A + A+GYAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQR--PVYLGLPANLVDLKVPAS 179
                 +S + ++   MV  +   P  I+       +++R  PV + LP +     V A+
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIA-MSRRPGPVLVDLPKD-----VTAA 259

Query: 180 LLDTPI------------DLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDV 227
           +L  PI             L+  A+D E   E I+   DL+  AK P++   A    +  
Sbjct: 260 ILRNPIPVKTTLPSGALSQLTKLAHD-EFILENIKKAADLINIAKKPVLYVGAGILNN-- 316

Query: 228 KAETRKLIDITQ---FPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILS 284
               R L D++Q    P   T  G G+ D++ P      +G         +V+++DLI++
Sbjct: 317 MEGPRILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIA 375

Query: 285 VGALLSDFNTGSFS 298
           VG    D  TG+ S
Sbjct: 376 VGTRFDDRVTGNIS 389

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 99/487 (20%), Positives = 196/487 (40%), Gaps = 63/487 (12%)

Query: 14  LNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM-SCLIT 72
           L Q  V+ +FG+ G   + + +   E  G+R+ G  NE + +YAA  Y  L G    L+ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFHRMSANI 132
             G G + AL G+  S+     +L + G    SS+ +            F    ++S  +
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYY--------EGFQELDQLSV-M 116

Query: 133 SETTAMVTDIATAPAE--IDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTPIDLSLK 190
           S        I T      +   ++T+ +     Y+ +P  L++ K  +S  + P  + + 
Sbjct: 117 SRWCKFYGRINTGNLSHLVYTAMKTSMLQNAVTYIDIPGGLIEEKAKSS-DELPKKMEIA 175

Query: 191 ANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSFVTPMGKG 250
                 + + ++ +  +++S K  +++    ++ +   AE R  ++  Q P   TPM KG
Sbjct: 176 HIRCGPDIQRVKEVATIMQSGKKILVVVGRGSANY--PAEVRAFLEKYQLPFLPTPMAKG 233

Query: 251 SIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS-------------------- 290
            + + H     + V    S A+K    SA+++L +GA L+                    
Sbjct: 234 IVPDTHE----LNVNGARSLALK----SAEVVLILGARLNWILHFGLEPKWSDDACFIQV 285

Query: 291 DFNTGSFSYSYKTKNVVEFHSD---YIKIKNATFPGV-QMKFVLQKLLTVIXXXXXXXXX 346
           D +  +   +         HSD   +I+  +   P   +   V +K+L+ I         
Sbjct: 286 DRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKILSKI--------- 336

Query: 347 XXXXXXXXXXXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYG 406
                           + L+   ++ ++ +F+ +   ++   G +   I +  FP  +Y 
Sbjct: 337 HSNGKAMKEKEIIPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMDIARVSFP-TSYQ 395

Query: 407 ISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYL 466
             ++  G+     G  +G A AA+  +P K V+   G+ +   +  E+ T+ R  L   +
Sbjct: 396 KHRLDAGT-SATMGVGIGYAMAAKVANPSKFVVALEGDSAFGFSAMELETIARNKLGIVV 454

Query: 467 FVLNNDG 473
            V+NN G
Sbjct: 455 VVMNNGG 461

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 129/303 (42%), Gaps = 30/303 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T G+   E + + +V T+FG PG   L + D IY      +    +E  A + A+GYAR
Sbjct: 91  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 150

Query: 64  LKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHVVG-VPSISSQAKQLLLHHTLGNGD 121
             G    ++ T G G  + +  +A + A+ V ++   G VP+ +           +G   
Sbjct: 151 ASGKCGVVLVTSGPGATNVITPMADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 207

Query: 122 FTVFHRMSANISETTAMVTDIATAPAEIDRCIR-TTYVTQRPVYLGLPANLVDLKVPASL 180
                 +S + ++   MV  +   P  I+      T     PV + LP +     V AS+
Sbjct: 208 ------ISRSCTKWNVMVKRVEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 256

Query: 181 LDTPIDL-------SLKANDAEAEAEV----IETILDLVKSAKNPII-LADACASRHDVK 228
           L  PI +       +LK     A  +     I+   +L+  AK PI+ +     +  +  
Sbjct: 257 LRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRAAELINIAKKPILYVGGGILNNPEGP 316

Query: 229 AETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGAL 288
              ++L D  Q P   T    G+ D+  P+   +      +PA   ++++ADLI++VGA 
Sbjct: 317 RLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDMLGMHGYAPA-NLAIQNADLIIAVGAR 375

Query: 289 LSD 291
             D
Sbjct: 376 FDD 378

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 111/514 (21%), Positives = 207/514 (40%), Gaps = 64/514 (12%)

Query: 8   KYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANE--LNAAYAADGYARLK 65
           +Y  E L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY   K
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 66  GMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDF 122
               L+   G G + +L GI  S +    +L + G  S     K   Q L   +L     
Sbjct: 66  -PGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----L 120

Query: 123 TVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA--- 178
           + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P    
Sbjct: 121 SPFLKFTGKLAPDNIRMITQKA-----LNHCIQGTAGV---AYIDVPADFIEYEKPLEGN 172

Query: 179 SLLDTPIDLSLKANDAEAEAEVIETILDLV-KSAKNPIILA---DACASRHDVKAETRKL 234
             +   + + L  N    +   I+ ++ L+ K+ +N I++     A  + H+V    R+L
Sbjct: 173 CHIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEV----RRL 228

Query: 235 IDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNT 294
           I+    P   TPM KG + +  P           S A  Q++++AD++L +GA L+    
Sbjct: 229 INKFNIPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLNWILH 280

Query: 295 GSFSYSYKTKNV-VEFHSDYIKI-KNATFPGVQMK------FVLQKLLTVIXXXXXXXXX 346
              S  + ++++ ++F S+   +  N   PG  +         +  L+  +         
Sbjct: 281 FGASPKWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKY 340

Query: 347 XXXXXXXXXXXXXXXSTPLKQE----------WLWNQVGKFLQEGDVVISETGTSAFGIN 396
                          +  LK+E           ++  +   + +    +   G +   I 
Sbjct: 341 SGISQAIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIA 400

Query: 397 QTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEIST 456
           +  FP N     + L        G  LG A A +   P+  V+L  G+ +   +  EI T
Sbjct: 401 RVSFPTNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIET 458

Query: 457 MVRWNLKPYLFVLNNDGYTIERLIHGEKADYNDI 490
            VR  L   + V+NN G     + HGEK   +D+
Sbjct: 459 AVRCQLALVIVVMNNSG-----IYHGEKDTGSDL 487

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 115/513 (22%), Positives = 199/513 (38%), Gaps = 56/513 (10%)

Query: 5   TLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANE--LNAAYAADGYA 62
           T  ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMVA-NGIKFIPCRNEQAASYAASAYGYI 62

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    L+   G G + AL GI  S +    +L + G  S S   K   Q L   +L  
Sbjct: 63  SDKP-GVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL-- 119

Query: 120 GDFTVFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA 178
              + F + +  ++ +   M+T  A     ++ CI+ T       Y+ +PA+ ++ + P 
Sbjct: 120 --LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGTAGVS---YIDVPADFIEYEKPL 169

Query: 179 SLLD---TPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLI 235
              D     + + L  N    +   I+ ++ L+   KN  IL            E R+L+
Sbjct: 170 EGNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLV 229

Query: 236 DITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P           S A  Q+++ AD++L +GA L+     
Sbjct: 230 NTFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKIADIVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNV-VEFHSDYIKI-KNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXX 353
             S  + ++++ ++F S+   +  N   PG  +       L+V                 
Sbjct: 282 GTSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYS 341

Query: 354 XXXXXXXXSTPLKQEWL------------WNQV----GKFLQEGDVVISETGTSAFGINQ 397
                      L Q  L            +NQV       + +   ++   G +   I +
Sbjct: 342 GVKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 THFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTM 457
             FP  T    + L        G  LG A A +   P+  V+L  G+ +   +  EI T 
Sbjct: 402 ISFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 VRWNLKPYLFVLNNDGYTIERLIHGEKADYNDI 490
           VR  L   + V+NN G     + HGEK    D+
Sbjct: 460 VRCQLALVIVVMNNSG-----IYHGEKDIEGDL 487

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 112/513 (21%), Positives = 198/513 (38%), Gaps = 62/513 (12%)

Query: 8   KYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM 67
           ++  + L +  + T+FG+ G   + L D +    G+++    NE  A+YAA GY  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMVA-NGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 68  -SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGNGDFT 123
              L+   G G + +L GI  S      +L + G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 124 VFHRMSANIS-ETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLD 182
            F + +  ++ +   MVT  A     ++ CI+ T       Y+ +PA+ ++ + P    D
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGTAGVS---YIDVPADFIESEKPLEGND 173

Query: 183 -----TPIDLSLK--ANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLI 235
                 P+ L+ K    D     E+++ IL    +    +I   A  + H    E R+LI
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSH----EIRRLI 229

Query: 236 DITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTG 295
           +    P   TPM KG + +  P           S A  Q++++AD++L +GA L+     
Sbjct: 230 NKFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADVVLVLGARLNWILHF 281

Query: 296 SFSYSYKTKNV-VEFHSDYIKI-KNATFPGVQMKFVLQKLLTVIXXXXXXXXXXXXXXXX 353
             S  +  +++ ++F S+   +  N   PG  +       L+V                 
Sbjct: 282 GTSPKWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKYS 341

Query: 354 XXXXXXXXSTPLKQEWL----------------WNQVGKFLQEGDVVISETGTSAFGINQ 397
                      L Q  L                +  +   + +   ++   G +   I +
Sbjct: 342 GVNQAMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIAR 401

Query: 398 THFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTM 457
             FP +     + L        G  LG A A++    +  V+L  G+ +   +  EI T 
Sbjct: 402 VSFPTDVP--RRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIETA 459

Query: 458 VRWNLKPYLFVLNNDGYTIERLIHGEKADYNDI 490
           VR  L   + V+NN G     + HGE    +D+
Sbjct: 460 VRCQLALIIVVMNNSG-----IYHGENNTGSDL 487

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 93/478 (19%), Positives = 184/478 (38%), Gaps = 46/478 (9%)

Query: 14  LNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM-SCLIT 72
           L Q  ++ +FG+ G   + L +K+ E  G+R+    NE + +YAA  Y  L      L+ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 73  TFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDFTVFH-RMSAN 131
             G G + AL GI  ++     +L + G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 132 ISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTPIDLSLKA 191
           +     MV             ++T  +     YL +P  L+++     L   P+D+  + 
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVDI--QH 177

Query: 192 NDAEAEAEVIETILDLVKSAKNP-IILADACASRHDVKAETRKLIDITQFPSFVTPMGKG 250
             +  ++  ++    L++  +N  +++   CA    V    R  ++  + P    PM KG
Sbjct: 178 VRSGPDSSRVQGAAKLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKG 234

Query: 251 SIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS-DFNTGSFSYSYKTKNVVEF 309
            + + H     + V    S A+K+    A+++L +GA L+   + GS          ++ 
Sbjct: 235 IVPDSHE----LNVNGCRSLALKR----AEIVLVLGARLNWILHYGSAPKWNADATFIQV 286

Query: 310 HSDYIKIKNATFPGVQ------MKFVLQKLLTVIXXX--------XXXXXXXXXXXXXXX 355
             D   + +    GV       ++  +  +  V+                          
Sbjct: 287 DRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVLDKIRENGVKLQR 346

Query: 356 XXXXXXSTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSI 415
                  +PL    +++ + K + + + ++S  G +    ++  F   T    + L    
Sbjct: 347 KAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWF--GTDYPKRRLDAGT 404

Query: 416 GFATGCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
           G   G  +G A +A+  +P K V+   G+ +   +  E+ T VR  +   + V+NN G
Sbjct: 405 GATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVMNNGG 462

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 126/294 (42%), Gaps = 27/294 (9%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           M+  +   ++ + L    + T+FG+ G   + + D I     +R+ G  NE  A+YAA  
Sbjct: 1   MTTESFPAHISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASA 60

Query: 61  YARLKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGN 119
           Y  L G    L+   G G + AL G+  S +    +L + G    SS+         L  
Sbjct: 61  YGYLTGKPGVLLVVGGPGLIHALAGVYNSISNKWPLLVLAG----SSE--------DLNR 108

Query: 120 GDFTVFHRMSANISETTAMVTDIATAPAE--IDRCIRTTYVTQRPV-YLGLPANLVDLKV 176
           G F    ++ A +S      + +  +     +   +R + V    V YL +P +L++  V
Sbjct: 109 GGFQALDQI-AVLSRYVKFSSRLNNSNVNEMLYNALRQSMVGTPGVSYLDIPGDLIEQSV 167

Query: 177 PASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLID 236
                +   +++    + +   + ++ + DL+       +L        D   E RK I+
Sbjct: 168 EKEKYNCVRNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIE 225

Query: 237 ITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
             Q P   TPM KG + + HP    + V +  S A++    SAD++L +GA L+
Sbjct: 226 RFQLPFLPTPMAKGVVPDSHP----LNVSSARSLALR----SADIVLVLGARLN 271

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 13/121 (10%)

Query: 371 WNQVGKFLQEGDV-----VISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGA 425
           +NQV   ++E  V     ++SE G +   I +  FP +   +   L        G  +G 
Sbjct: 361 YNQVYAAMREHMVDRNTFIVSE-GANTMDIARVSFPTDYPKLR--LDAGTNATMGVGIGY 417

Query: 426 AFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKA 485
           A AA+   P+K V+   G+ +   +  E+ T  R+ L     V+NN G     + HGE +
Sbjct: 418 AIAAKLAHPEKSVVCIQGDSAFGFSGLELETASRYQLGIVFVVMNNSG-----IYHGEDS 472

Query: 486 D 486
           +
Sbjct: 473 E 473

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 105/262 (40%), Gaps = 25/262 (9%)

Query: 4   ITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYAR 63
           +T+ + +   L   +V  +FG+ G   ++L ++ +   G+R+    NE +A+YAA  Y  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 64  LKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNGDF 122
           L G    L+   G G + +L G+  S      ++ + G         +            
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHGHDQYRGAFQELDQISLL 121

Query: 123 TVFHRMSANISETTAMVTDIATAPAEIDRCIRTTY-----VTQRPVYLGLPANLVDLKVP 177
             + + S  ++E              +D  + + Y      T+   Y+ +P NL++ +  
Sbjct: 122 KPYVKFSGKLTE------------GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIETQAV 169

Query: 178 ASL---LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKL 234
            +    L  P+   +K +    +   ++ +  L+   ++  +L           A  R+ 
Sbjct: 170 CAGTPGLLPPVPQPIKCS---PDPHTVKRVASLILENRDKKVLVVVGKGSQGAFAAVRRF 226

Query: 235 IDITQFPSFVTPMGKGSIDEQH 256
           ID   FP   TPMGKG + ++H
Sbjct: 227 IDEFNFPFLPTPMGKGVVPDEH 248

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 3/110 (2%)

Query: 365 LKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLG 424
           L    ++  +   L++   V+   G +     +  FP +T   S++  G+     G  LG
Sbjct: 373 LNYNRVYGIIRPLLEQDRTVLVTEGANTMDKARVSFPAST-PFSRLDAGT-NATMGVGLG 430

Query: 425 AAFAAEEIDPKKR-VILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
            A AA+      R V+L  G+ +   +  E+ T+VR+ +   + ++NN G
Sbjct: 431 YAMAAKLSSGAARDVVLIQGDSAFGFSGMELETLVRFQVGVVVMIMNNSG 480

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 135/306 (44%), Gaps = 42/306 (13%)

Query: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60
           MS I++  Y+   L + D+ T+FG+ G   +  L + +   G+++    NE +A+YAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 61  YARLKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-----QLLLH 114
           Y  L      L+T  G G + AL GI  S   +  ++ + G   I SQ K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 115 HTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPV-YLGLPANLVD 173
             L N        +S   +E   ++         +   +R + ++ + V +L +P +L+ 
Sbjct: 118 IALLNSYMKFTGELS---TENIDLL---------VYESMRNSMLSPKGVSFLEIPGDLIH 165

Query: 174 LKVPASLLDT-----PI---DLSLKANDAEAEAEVIETILD-LVKSAKNPIILADACASR 224
             V  ++ D+     PI    L+   ND +   E  + + D + K  +N +++    A  
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPND-DILLETAKFLYDAMRKRDQNMLVIVGKGAI- 223

Query: 225 HDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILS 284
               +  R  I+    P   TPM KG I++ +     + V +  S A+K     AD+IL 
Sbjct: 224 -GASSALRHFINCFNLPFLPTPMAKGIIEDSNE----LNVSSGRSMALKD----ADVILV 274

Query: 285 VGALLS 290
            GA L+
Sbjct: 275 FGAKLN 280

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 54/111 (48%), Gaps = 8/111 (7%)

Query: 377 FLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKK 436
           F  E  ++++E G +   + +  FP + +   ++  G++    G  LG A + +   P K
Sbjct: 393 FKDEETILVTE-GANTMDVARISFPTD-FPQHRIDCGTLA-TMGIGLGYAISTKLSKPNK 449

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEKADY 487
            V+L  G+ +   +  E+ T VR+NL   + ++NN G     + HG   D+
Sbjct: 450 SVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG-----IYHGTTKDH 495

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 131/298 (43%), Gaps = 36/298 (12%)

Query: 5   TLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANE--LNAAYAADGYA 62
           T+ ++  + L +  + T+FG+ G   + L D +    G+++    NE   + A +A GY 
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMVA-NGVKFIPCRNEQAASYAASAYGYV 62

Query: 63  RLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK---QLLLHHTLGN 119
             K    L+   G G + +L GI  S +    +L + G  S +   K   Q L   +L  
Sbjct: 63  NDKP-GVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL-- 119

Query: 120 GDFTVFHRMSANI-SETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA 178
              + F + +  + S+   MVT  A     ++ CI+ T       Y+  PA+L++ +  +
Sbjct: 120 --LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIENEKKS 169

Query: 179 ----SLLDTPIDLSLKANDAEAEAEVIETILDLV--KSAKNPIILADACASRHDVKAETR 232
                 L   + + L  N    +   IE I+ L+     KN +I+    A ++    E R
Sbjct: 170 LAGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQNRDKNILIVIGKGAVKN--SHEIR 227

Query: 233 KLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
           +L+     P   TPM KG + +  P           S A  Q++++AD++L +GA L+
Sbjct: 228 RLVSSFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLN 277

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 7/108 (6%)

Query: 377 FLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKK 436
            +++   ++   G +   I +  FP  T      L        G  LG A A++   P+ 
Sbjct: 382 LIEDYRTILVTEGANTMDIARVSFP--TDAPRHRLDAGTNATMGIGLGYALASKASRPEL 439

Query: 437 RVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIHGEK 484
            V+L  G+ +   +  EI T VR  L   + V+NN G     + HG K
Sbjct: 440 DVVLIQGDSAFGFSAMEIETAVRCQLALVIVVMNNSG-----IYHGVK 482

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 127/288 (44%), Gaps = 29/288 (10%)

Query: 8   KYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADGYARLKGM 67
           +YL E L+   +  +FG+ G   + L D +     +++ G  NE  A+YAA  Y  L G 
Sbjct: 6   EYLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGR 65

Query: 68  -SCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAK-QLLLHHTLGNGDFTVF 125
              L+   G G + AL G+  S +    ++ + G    S++   Q L    L     + +
Sbjct: 66  PGVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNRGGFQELDQIAL----LSKY 121

Query: 126 HRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPA--SLLDT 183
            + S+ +S +     D +   A     + T  V+    YL +PAN++D +V    S    
Sbjct: 122 VKYSSRLSNSN---VDQSFYDALRQAVLGTPGVS----YLDIPANVIDQEVEKNESFSRR 174

Query: 184 PI-DLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQFPS 242
            I  +S +  DA      ++ +  L+ + ++  IL        +   + R  +D  Q P 
Sbjct: 175 HIAKISYQPTDA-----ALQRVAKLLNANRDKNILCVIGKGATENAQQIRPFVDEFQLPF 229

Query: 243 FVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
             TPM KG + + H     + V +  S A+K    SAD++L +GA L+
Sbjct: 230 LSTPMAKGVVPDSH----ALNVSSARSLALK----SADIVLVLGARLN 269

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 52/122 (42%), Gaps = 7/122 (5%)

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           S  L    ++  + K + + D +I   G +   + +  FP +   +   +        G 
Sbjct: 354 SPALTYNKVYATIRKQIVDKDTIIVSEGANTMDVARISFPTDYPKLR--MDAGTNATMGV 411

Query: 422 TLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIH 481
            LG A AA+   P+K VI   G+ +   +  E+ T  R+ L   + V+NN G     + H
Sbjct: 412 GLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMELETASRYKLGITVVVMNNSG-----IYH 466

Query: 482 GE 483
           GE
Sbjct: 467 GE 468

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 21/133 (15%)

Query: 164 YLGLPANLV------DLKVPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIIL 217
           Y+ +P NL+      + ++   ++ +P+  S        +  V+  +  L+ + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCS-------PDPLVVSEVARLIANNEHKEIL 205

Query: 218 ADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVE 277
                   +   E R+ +D  Q P   TPM KG + + HP    + V +  S A+++   
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP----LNVSSARSLALRK--- 258

Query: 278 SADLILSVGALLS 290
            AD++L +GA L+
Sbjct: 259 -ADVVLLLGARLN 270

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 371 WNQV----GKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAA 426
           +NQV     +++ + + ++   G +   + +  FP + Y   ++  G+     G  LG A
Sbjct: 361 YNQVYALMRQYITDDETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYA 418

Query: 427 FAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
            AA+  D  K VI   G+ +   +  E+ T VR +L   + V+NN G
Sbjct: 419 LAAKASDTTKTVICIQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG 465

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 2/125 (1%)

Query: 362 STPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGC 421
           ++ L    ++  + K L + + +I   G +   I +  F  + Y   ++  G++    G 
Sbjct: 373 TSQLNYNEVYGSLRKILNDRETIIVMEGANTMDIARISFKTD-YPQHRLDCGNLA-TMGV 430

Query: 422 TLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLIH 481
            LG A +A+   P K V+L  G+ +   +  EI T VR  L   + V+NN G      I 
Sbjct: 431 GLGYAISAKLSRPDKTVVLIQGDSAFGFSGMEIETAVRNKLGLIIIVMNNSGIYKGVPIE 490

Query: 482 GEKAD 486
             K+D
Sbjct: 491 ERKSD 495

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
           G  LG A AA+   P+  ++   G+ +   +  EI T VR+ L     ++NN G
Sbjct: 422 GVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG 475

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 14/93 (15%)

Query: 201 IETILDLVKSAKNP---IILADACASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHP 257
           I  +  L+K  ++    ++L   C +        R  I+   FP   TPM KG + + H 
Sbjct: 193 IAEVTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTPMAKGILPDSH- 248

Query: 258 RFGGVYVGTLSSPAIKQSVESADLILSVGALLS 290
           R          S A  Q+++SADL+L  GA L+
Sbjct: 249 RLN-------VSAARSQALKSADLVLVFGARLN 274

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 34.3 bits (77), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 75/344 (21%), Positives = 127/344 (36%), Gaps = 54/344 (15%)

Query: 164 YLGLPANLV--DLKVPASLLDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADAC 221
           Y+  P +L+  +++VP    +  I  ++K++   A+  V + +  L++   +  +L    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIKSS---ADPLVTKEVAQLLRRNSDQNVLVIIG 219

Query: 222 ASRHDVKAETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADL 281
               +        I   QFP   TPMGKG I +  P    + V +  S A+ +S    D+
Sbjct: 220 KGAVNYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP----LNVSSARSSALSKS----DI 271

Query: 282 ILSVGALLSDFNTGSFSYSYKTKNVVEF---HSDYIKIKNATFPGVQMKFVLQKLLTVIX 338
           +L  GA L+      F    K K+ V+F    +D   I N       M+ +   LL  I 
Sbjct: 272 VLVFGARLNWLL--HFGKPPKWKSTVKFILCDNDPHAIGNNN-----MQSINYSLLGDIG 324

Query: 339 XXXXXXXXXXXXXXXXXXXXXXXSTPLKQEWLWNQ---------------------VGKF 377
                                  +  L+ E L NQ                     V + 
Sbjct: 325 LIINELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGALLNYHVVYRT 384

Query: 378 LQE----GDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAA---- 429
           L+E     +  +   G +   I +  FP  +    Q L        G  LG   AA    
Sbjct: 385 LREMLDLKNTFLVTEGANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIAARLSQ 442

Query: 430 EEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
           + +  K  +++  G+ +   +  EI T VR+ L   + V+NN G
Sbjct: 443 DYMKSKPDILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSG 486

>TBLA0C01560 Chr3 (362966..364714) [1749 bp, 582 aa] {ON} Anc_1.450
           YEL020C
          Length = 582

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 57/274 (20%), Positives = 106/274 (38%), Gaps = 45/274 (16%)

Query: 230 ETRKLIDITQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALL 289
           +  + ++  Q P   TPM KG + + HP    + V    S A+K S    D+I+ +GA L
Sbjct: 230 KINEFVNKFQLPFLPTPMAKGIVPDSHP----LNVSVARSFALKNS----DIIIVIGARL 281

Query: 290 S-DFNTGSFSYSYKTKNVVEFHSDYIKIKNATFP-----------------GVQMKFVLQ 331
           +   + GSF    KTK   +    +I+I N +                   G+ +  + Q
Sbjct: 282 NWILHFGSFG---KTK--FKPGCQFIQIDNDSEVLGWNNNQGNENCLLSDIGLALDSISQ 336

Query: 332 KL-LTVIXXXXXXXXXXXXXXXXXXXXXXXXSTPLKQ-----------EWLWNQVGKFLQ 379
           KL L                              LKQ           E ++ ++ + + 
Sbjct: 337 KLPLGFKFSKEKQEDNKLSNEIQKIIENNTNKLRLKQRYDHNNGAPSYEQVYYKLNQVIN 396

Query: 380 EGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATGCTLGAAFAAEEIDPKKRVI 439
           +   ++   G +   I +  F  + Y + ++  G+     G  +G A A++   P K  +
Sbjct: 397 DKQTILVTEGANTMDIARICFQTD-YPLHRLDCGT-NATMGIGIGYAIASKLAVPDKLTV 454

Query: 440 LFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
           L  G+ +   +  E+ T+ R+ L   + ++NN G
Sbjct: 455 LIQGDSAFGFSGMELETISRFKLGIVVIIMNNSG 488

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%)

Query: 420 GCTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDG 473
           G  LG   A+   +P    IL  G+ +   +  EI T+ R+ L   + ++NN G
Sbjct: 426 GVGLGYLMASRLANPNLDNILIQGDSAFGFSGMEIETLCRFKLGSVIIIMNNSG 479

>Smik_10.129 Chr10 complement(203537..208846) [5310 bp, 1769 aa]
           {ON} YJL109C (REAL)
          Length = 1769

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 5/97 (5%)

Query: 187 LSLKANDAEAEAEVIETILDLVKSAKNPIILA--DACASRHDVK-AETRKLIDITQFPSF 243
           L+ K+ D +  A  I  +       K PIILA  +   S  D K A+   LI I +   F
Sbjct: 246 LASKSKDCQIAAHTILVVFATALPLKKPIILAAMETILSNLDTKEAKHSALITICKL--F 303

Query: 244 VTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESAD 280
            T  GKG++D+  P+   ++     + ++   ++  D
Sbjct: 304 QTLRGKGNVDQLPPKIFKIFDSRFDTSSVLAFLDKED 340

>TDEL0C02790 Chr3 (487977..496337) [8361 bp, 2786 aa] {ON} Anc_7.418
            YBL088C
          Length = 2786

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 16/149 (10%)

Query: 146  PAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASLLDTPIDLSLKANDAEAEAEVIETIL 205
            P  ID   ++ Y+T + +    P          ++ D+ + +    ND E  +E +ETI 
Sbjct: 1873 PQRIDSKEKSLYLTLKKISYDAP------HPSKTIQDSLVQVVECKNDFETPSEWVETIA 1926

Query: 206  DLVKSAKNPIILADACASRHDVKAETRKLIDITQFPSFVTPMG--KGSIDEQHPRFGGVY 263
            ++    +    L+D  ++  ++ A  RK ID  +   +V      K +I  ++     + 
Sbjct: 1927 EMALLKE----LSDCMSNPENLVATLRKTIDFDRRALYVHDFSDYKSNIQSRYMLSKLLL 1982

Query: 264  VGTLSSPAIKQSVESADLILSVGALLSDF 292
              +   P    S+ SADL +  GALL+++
Sbjct: 1983 NRSDEFP----SISSADLTICTGALLANY 2007

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,117,690
Number of extensions: 2322293
Number of successful extensions: 6383
Number of sequences better than 10.0: 139
Number of HSP's gapped: 6242
Number of HSP's successfully gapped: 192
Length of query: 564
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 449
Effective length of database: 40,294,809
Effective search space: 18092369241
Effective search space used: 18092369241
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)