Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C035603.162ON64164132990.0
KAFR0F022203.162ON7476609971e-125
KNAG0K017403.162ON7656089971e-125
NCAS0I020803.162ON7745279881e-123
ADR317C3.162ON8195709891e-123
Kpol_1032.103.162ON7916699821e-122
Suva_4.2213.162ON7656499751e-121
KLLA0C03828g3.162ON7935419761e-121
NDAI0A066203.162ON7476789641e-120
TPHA0M003003.162ON7745309581e-119
Skud_4.2233.162ON7696539471e-117
SAKL0C07348g3.162ON8613599521e-117
KLTH0F06468g3.162ON8377089481e-117
CAGL0K01617g3.162ON7745409411e-116
TDEL0D046003.162ON7953439421e-116
Ecym_52363.162ON8643599351e-114
TBLA0F008603.162ON9803999401e-114
ZYRO0B04906g3.162ON8473409251e-113
Smik_4.2073.162ON7653689181e-113
YDL028C (MPS1)3.162ON7643609111e-112
Kwal_33.141673.162ON8383298991e-109
Skud_8.1635.406ON10762782851e-25
TBLA0A035705.406ON9752782852e-25
YHR102W (KIC1)5.406ON10802782815e-25
Smik_8.1805.406ON10732782805e-25
KNAG0B043205.406ON10272772797e-25
NCAS0H019405.406ON10153092771e-24
NDAI0C017005.406ON10203052752e-24
Suva_15.2975.406ON10742782753e-24
KAFR0D049505.406ON10083042744e-24
Kpol_1031.105.406ON11272782735e-24
Kpol_1037.206.31ON7043382698e-24
TPHA0H016305.406ON10362772709e-24
NDAI0F045201.24ON4892742642e-23
KLTH0C10912g6.31ON6972782653e-23
SAKL0E01584g6.31ON6952762653e-23
CAGL0L11550g5.406ON10722762654e-23
TDEL0E021805.406ON9872772654e-23
Kwal_56.224766.31ON6972882618e-23
KLLA0E21693g5.406ON10162682611e-22
Kwal_33.131121.24ON5052812571e-22
TPHA0F024306.31ON7983422573e-22
KNAG0E008506.31ON7112822564e-22
Kpol_2002.241.24ON4872702516e-22
Ecym_30356.31ON7402762546e-22
TBLA0H016605.406ON9962752557e-22
ZYRO0C07480g6.31ON7742962539e-22
NDAI0C026806.31ON7502112511e-21
CAGL0K07458g2.446ON7042912512e-21
TPHA0J004206.31ON7073002502e-21
ACL006W6.31ON7082762502e-21
NCAS0D021006.31ON7263252502e-21
Kwal_55.215455.406ON8652772502e-21
Ecym_55055.406ON10032812502e-21
Kpol_1023.266.31ON7392762493e-21
ZYRO0A06446g5.406ON9432722493e-21
Smik_13.1596.31ON7052762483e-21
Suva_13.1636.31ON7052762474e-21
KAFR0G026906.31ON7132722465e-21
SAKL0G01848g5.406ON8852772475e-21
Skud_13.1546.31ON7052762457e-21
KLTH0F00946g1.24ON5122982438e-21
YMR001C (CDC5)6.31ON7052762459e-21
ACL104C5.406ON9472762451e-20
TDEL0G043806.31ON7222112441e-20
NDAI0A038702.496ON8953062441e-20
SAKL0C00946g1.24ON5642722411e-20
TBLA0B004906.31ON7872742422e-20
KLTH0F16676g5.406ON8782772422e-20
YOL045W (PSK2)7.86ON11012992423e-20
KAFR0K007007.86ON13812852423e-20
KLLA0F07623g7.86ON12292872413e-20
NCAS0C024708.482ON3113052313e-20
KLLA0B12716g2.446ON7163792404e-20
KAFR0H015308.482ON3063052304e-20
Kwal_26.76352.446ON6913052376e-20
KLLA0E03587g5.591ON6472982376e-20
KLTH0A06776g6.341ON15233052397e-20
KLLA0C08525g6.341ON15513342389e-20
Skud_16.2518.482ON3052522271e-19
KLLA0C06138g6.31ON7082132351e-19
TBLA0A074601.24ON5162742331e-19
ZYRO0F08074g8.482ON3043052261e-19
CAGL0J11638g6.31ON7462742342e-19
Skud_15.1127.86ON11013232352e-19
Smik_15.1227.86ON11012992342e-19
NCAS0A002801.24ON5352752313e-19
YPL031C (PHO85)8.482ON3052522233e-19
CAGL0L12474g8.482ON3022422224e-19
Suva_16.2868.482ON3053052224e-19
TPHA0P012703.60ON8853252314e-19
KLTH0E11220g8.482ON3022172224e-19
TDEL0H036407.86ON12373212325e-19
TPHA0H026307.86ON13672832325e-19
KLLA0F14190g1.271ON13382862316e-19
Ecym_26407.86ON13252912317e-19
TDEL0B015408.482ON3043052208e-19
SAKL0H06534g8.676ON8042142281e-18
AGL242C8.482ON3033002191e-18
NDAI0K013702.446ON6802872261e-18
ZYRO0F18062g1.24ON4712822242e-18
CAGL0K03399g2.446ON7032872262e-18
Kpol_1055.242.496ON9372912272e-18
KNAG0D003906.341ON16562942272e-18
TPHA0C017808.482ON3053062172e-18
CAGL0H06259g7.86ON13362802262e-18
Kwal_23.63256.341ON15423052272e-18
TDEL0A045805.591ON6942772252e-18
CAGL0M03729g3.60ON8613472252e-18
NDAI0I003406.341ON18363032263e-18
KNAG0A023108.482ON3022222163e-18
Smik_3.1736.341ON13402832253e-18
ACR142W8.676ON8372142243e-18
TPHA0E038501.24ON4822792213e-18
TDEL0C067801.24ON4682862213e-18
ABL028W2.446ON7223002243e-18
KAFR0A050906.31ON6682882233e-18
Suva_15.1247.86ON11062832243e-18
TPHA0G024802.446ON6813052234e-18
NDAI0H023402.446ON7063002234e-18
AER264C6.341ON14832862244e-18
NCAS0D046006.341ON16833082244e-18
SAKL0A04246g6.222ON4002992185e-18
KAFR0D030202.446ON6773262225e-18
CAGL0K02673g2.496ON9152782235e-18
Kwal_26.71547.86ON12133182235e-18
Skud_14.403.60ON8363282225e-18
SAKL0H11638g8.482ON3043052145e-18
SAKL0A01254g6.341ON15582802236e-18
SAKL0B09856g7.86ON12742892236e-18
NCAS0F014602.446ON6742932216e-18
SAKL0E03608g2.446ON7333022226e-18
KNAG0C060605.591ON9622912226e-18
NCAS0A053706.341ON15083002227e-18
KNAG0B017801.271ON15802892227e-18
KLTH0D04818g2.446ON6912892207e-18
Ecym_25318.482ON3012202127e-18
CAGL0L03520g1.271ON14472892228e-18
KNAG0A062902.446ON6923272208e-18
NDAI0A085607.86ON13173012218e-18
ACR281C7.86ON12592932219e-18
ZYRO0G02530g2.446ON7043562209e-18
Ecym_24996.341ON15412872211e-17
KLTH0D06006g2.496ON9542882201e-17
ZYRO0D05500g7.86ON12622842201e-17
KAFR0A017602.496ON8852742201e-17
KLTH0D11242g8.676ON7952142191e-17
Kpol_1007.178.482ON3072172111e-17
SAKL0G06952g5.611ON5993262181e-17
KAFR0G012001.24ON5072802171e-17
ZYRO0C02288g3.60ON9073232182e-17
NCAS0A043602.446ON6842872172e-17
KNAG0D048107.86ON14402762192e-17
Suva_3.1106.341ON13763042192e-17
TBLA0I013702.446ON7742872172e-17
Kpol_1033.552.446ON6872952172e-17
Kpol_1066.453.60ON8803052172e-17
Skud_3.1466.341ON13342842182e-17
YCR073C (SSK22)6.341ON13312822182e-17
Suva_16.1578.676ON8322622163e-17
KLLA0F11143g8.676ON8132172154e-17
NCAS0A050502.496ON8932742154e-17
TBLA0I002802.496ON13162702164e-17
Ecym_23978.676ON8722142154e-17
KLLA0C04191g3.177ON7972282154e-17
KAFR0D033902.496ON7983202154e-17
Suva_14.423.60ON8643282154e-17
KAFR0H024308.676ON7842162145e-17
YAL017W (PSK1)7.86ON13562772155e-17
YDR490C (PKH1)3.92ON7663032145e-17
CAGL0H01639g1.24ON5212772125e-17
KLLA0C12485g3.92ON9253262145e-17
KAFR0F018001.182ON4242362105e-17
CAGL0J03828g8.652ON4672902115e-17
NDAI0H009405.611ON6852752135e-17
TBLA0B016303.177ON12952872155e-17
Skud_1.447.86ON13562792156e-17
Smik_1.507.86ON13572792146e-17
KLTH0E15004g3.338ON4112392096e-17
KLLA0A03806g5.611ON6022812126e-17
NCAS0F015807.86ON13822252147e-17
KLTH0D02486g7.86ON12233402147e-17
YMR104C (YPK2)2.446ON6773032127e-17
CAGL0I09504g1.336ON5282842118e-17
YDR523C (SPS1)1.24ON4902852108e-17
YNR031C (SSK2)6.341ON15793092138e-17
KLLA0D11990g8.482ON3042192048e-17
NDAI0E031708.482ON3232132058e-17
KLTH0D03454g1.271ON14332862138e-17
TPHA0G029102.446ON6833472119e-17
NDAI0H024707.86ON14112842139e-17
AFR724C1.24ON4402762099e-17
KAFR0E010403.229ON5022412109e-17
Smik_8.422.496ON9392762129e-17
Suva_1.507.86ON13602822139e-17
NCAS0C049403.92ON11163022129e-17
Skud_13.2622.446ON6772992111e-16
YNL298W (CLA4)3.60ON8423072121e-16
NDAI0G054701.271ON15552892121e-16
Smik_14.343.60ON8383072111e-16
SAKL0C07722g3.177ON9122352111e-16
NDAI0E021108.676ON9032212111e-16
Smik_4.8031.24ON4902852081e-16
AEL230W5.611ON6082762091e-16
CAGL0F00913g7.86ON12062842112e-16
ZYRO0A03894g3.229ON4522282072e-16
Kwal_26.78612.496ON9552882102e-16
KLTH0G05698g5.611ON5972962092e-16
KNAG0A067502.496ON7912672102e-16
Kwal_26.77882.479ON12672892102e-16
Kwal_47.182335.611ON5982822082e-16
Kwal_27.125593.338ON4142322052e-16
Suva_11.992.446ON6842872092e-16
KLLA0F13552g2.479ON12673042102e-16
TBLA0H029501.255ON9273002092e-16
ABL034W2.479ON14252722102e-16
KAFR0A014201.271ON13982892102e-16
NDAI0A061303.60ON8193322092e-16
KNAG0L005207.86ON3682912042e-16
TDEL0A062208.676ON7942142092e-16
Ecym_35253.60ON8183052082e-16
TDEL0A075606.341ON15753042093e-16
KLTH0D05566g2.479ON11282332093e-16
Suva_2.6663.92ON7643022083e-16
Skud_8.392.496ON9232762083e-16
Skud_10.501.182ON3972992043e-16
KLLA0C17160g8.141ON8313372083e-16
Smik_4.7673.92ON7583002083e-16
Kwal_26.73551.271ON14462972093e-16
Kwal_47.183075.591ON6212882073e-16
Suva_2.7031.24ON4852182053e-16
Ecym_52513.177ON8932372083e-16
Ecym_73922.479ON14342712083e-16
YJL164C (TPK1)1.182ON3972372033e-16
TDEL0A047805.611ON6212952063e-16
NCAS0A080805.611ON6232762063e-16
Suva_2.6515.611ON6332802063e-16
Skud_4.7971.24ON4852272053e-16
ZYRO0A05544g5.611ON6313492064e-16
Smik_13.2902.446ON6762992064e-16
SAKL0E02860g2.479ON13773032084e-16
Sklu_YGOB_Anc_2.4962.496ON6192772064e-16
NCAS0A102903.229ON5092862054e-16
Ecym_10301.24ON4402742034e-16
TDEL0A027202.496ON9152702074e-16
TBLA0B082503.92ON13472852074e-16
Skud_11.1032.446ON6802872064e-16
TBLA0C058301.182ON4262502034e-16
Kpol_1040.207.86ON12973002075e-16
TPHA0G032902.496ON9732952065e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03560
         (641 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...  1275   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   388   e-125
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   388   e-125
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    385   e-123
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   385   e-123
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   382   e-122
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   380   e-121
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   380   e-121
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   375   e-120
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   373   e-119
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   369   e-117
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   371   e-117
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   369   e-117
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   367   e-116
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   367   e-116
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   364   e-114
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   366   e-114
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   360   e-113
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   358   e-113
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   355   e-112
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   350   e-109
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   114   1e-25
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   114   2e-25
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   112   5e-25
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   112   5e-25
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   112   7e-25
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   111   1e-24
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   110   2e-24
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   110   3e-24
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   110   4e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   109   5e-24
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   108   8e-24
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   108   9e-24
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...   106   2e-23
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   106   3e-23
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   106   3e-23
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   106   4e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   106   4e-23
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   105   8e-23
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   105   1e-22
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   103   1e-22
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   103   3e-22
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   103   4e-22
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....   101   6e-22
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   102   6e-22
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   102   7e-22
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   102   9e-22
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   101   1e-21
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   101   2e-21
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   100   2e-21
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   100   2e-21
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     100   2e-21
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   100   2e-21
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   100   2e-21
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   100   3e-21
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   100   3e-21
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   100   3e-21
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   100   4e-21
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    99   5e-21
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   100   5e-21
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    99   7e-21
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    98   8e-21
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    99   9e-21
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    99   1e-20
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    99   1e-20
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     99   1e-20
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    97   1e-20
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    98   2e-20
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    98   2e-20
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    98   3e-20
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    98   3e-20
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    97   3e-20
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    94   3e-20
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    97   4e-20
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    93   4e-20
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    96   6e-20
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    96   6e-20
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    97   7e-20
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    96   9e-20
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    92   1e-19
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    95   1e-19
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    94   1e-19
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    92   1e-19
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    95   2e-19
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    95   2e-19
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    95   2e-19
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        94   3e-19
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    91   3e-19
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    90   4e-19
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    90   4e-19
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    94   4e-19
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    90   4e-19
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    94   5e-19
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    94   5e-19
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    94   6e-19
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    94   7e-19
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    89   8e-19
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    92   1e-18
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    89   1e-18
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              92   1e-18
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    91   2e-18
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    92   2e-18
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    92   2e-18
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    92   2e-18
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    88   2e-18
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    92   2e-18
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    92   2e-18
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    91   2e-18
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    91   2e-18
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      92   3e-18
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    88   3e-18
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    91   3e-18
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    91   3e-18
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    90   3e-18
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    90   3e-18
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    91   3e-18
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             91   3e-18
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    91   3e-18
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    91   4e-18
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    91   4e-18
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    91   4e-18
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    91   4e-18
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    89   5e-18
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    90   5e-18
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    91   5e-18
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    91   5e-18
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    90   5e-18
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    87   5e-18
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    91   6e-18
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    91   6e-18
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    90   6e-18
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    90   6e-18
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    90   6e-18
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    90   7e-18
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    90   7e-18
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    89   7e-18
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    86   7e-18
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    90   8e-18
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    89   8e-18
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    90   8e-18
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    90   9e-18
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    89   9e-18
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    90   1e-17
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    89   1e-17
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    89   1e-17
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    89   1e-17
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    89   1e-17
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    86   1e-17
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    89   1e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    88   1e-17
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    89   2e-17
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     88   2e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    89   2e-17
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    89   2e-17
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    88   2e-17
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    88   2e-17
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    88   2e-17
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    89   2e-17
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    89   2e-17
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    88   3e-17
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    87   4e-17
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    87   4e-17
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    88   4e-17
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    87   4e-17
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    87   4e-17
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    87   4e-17
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    87   4e-17
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    87   5e-17
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    87   5e-17
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    87   5e-17
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    86   5e-17
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    87   5e-17
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    86   5e-17
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    86   5e-17
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    87   5e-17
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    87   5e-17
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    87   6e-17
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    87   6e-17
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    85   6e-17
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    86   6e-17
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    87   7e-17
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    87   7e-17
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    86   7e-17
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    86   8e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    86   8e-17
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    87   8e-17
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    83   8e-17
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    84   8e-17
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    87   8e-17
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    86   9e-17
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    87   9e-17
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    85   9e-17
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    86   9e-17
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    86   9e-17
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    87   9e-17
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    86   9e-17
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    86   1e-16
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    86   1e-16
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    86   1e-16
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    86   1e-16
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    86   1e-16
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    86   1e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    85   1e-16
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    85   1e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    86   2e-16
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    84   2e-16
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    86   2e-16
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    85   2e-16
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    86   2e-16
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    86   2e-16
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    85   2e-16
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    84   2e-16
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    85   2e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    86   2e-16
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    85   2e-16
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    86   2e-16
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    86   2e-16
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    85   2e-16
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    83   2e-16
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    85   2e-16
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    85   2e-16
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    85   3e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    85   3e-16
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    85   3e-16
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    85   3e-16
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    83   3e-16
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    85   3e-16
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    85   3e-16
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    85   3e-16
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    84   3e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   3e-16
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    85   3e-16
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    85   3e-16
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    83   3e-16
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    84   3e-16
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    84   3e-16
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    84   3e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    84   3e-16
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    84   4e-16
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    84   4e-16
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    85   4e-16
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    84   4e-16
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    84   4e-16
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    83   4e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    84   4e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    84   4e-16
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    84   4e-16
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    83   4e-16
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    84   5e-16
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    84   5e-16
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    84   5e-16
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    84   5e-16
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    84   5e-16
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    84   5e-16
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    84   5e-16
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    84   5e-16
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    84   5e-16
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    84   6e-16
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    82   6e-16
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    84   6e-16
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    83   6e-16
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    82   6e-16
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    82   7e-16
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    84   7e-16
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    82   7e-16
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    84   7e-16
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    83   8e-16
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    83   9e-16
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    83   9e-16
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    83   9e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    83   9e-16
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    83   1e-15
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    83   1e-15
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    80   1e-15
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    83   1e-15
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    82   1e-15
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    83   1e-15
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    83   1e-15
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    83   1e-15
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    82   1e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    83   1e-15
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    81   1e-15
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    83   1e-15
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    82   1e-15
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    83   1e-15
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    82   1e-15
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    81   1e-15
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    81   1e-15
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    82   2e-15
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    82   2e-15
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    80   2e-15
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    80   2e-15
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    81   2e-15
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    82   2e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    82   2e-15
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    79   2e-15
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    82   2e-15
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    82   2e-15
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    82   2e-15
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    82   2e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    82   2e-15
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    82   2e-15
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    82   2e-15
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    82   2e-15
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    80   2e-15
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    82   2e-15
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    80   2e-15
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    82   2e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    82   2e-15
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    82   3e-15
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    82   3e-15
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               81   3e-15
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    80   3e-15
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    82   3e-15
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    80   3e-15
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    81   3e-15
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    82   3e-15
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    80   3e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    81   3e-15
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    80   3e-15
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    81   3e-15
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    80   3e-15
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    81   3e-15
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    81   3e-15
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    81   3e-15
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    79   3e-15
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    81   4e-15
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    81   4e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    81   4e-15
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    79   4e-15
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    79   4e-15
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    80   5e-15
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    81   5e-15
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    80   5e-15
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    79   5e-15
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    81   5e-15
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    80   5e-15
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    80   5e-15
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    81   5e-15
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    78   5e-15
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    80   5e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    81   5e-15
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    80   6e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    79   6e-15
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    80   6e-15
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    79   6e-15
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    80   6e-15
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               79   6e-15
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    79   6e-15
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    80   6e-15
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    78   6e-15
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    80   7e-15
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    80   7e-15
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    80   7e-15
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    80   7e-15
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    80   7e-15
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    79   7e-15
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    77   7e-15
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    80   7e-15
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    80   8e-15
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     80   8e-15
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    79   8e-15
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    80   8e-15
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    80   8e-15
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    80   8e-15
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               79   8e-15
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    80   9e-15
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    80   9e-15
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    80   9e-15
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    80   9e-15
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    80   9e-15
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    80   9e-15
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    79   1e-14
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    77   1e-14
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    79   1e-14
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    77   1e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     80   1e-14
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    80   1e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    80   1e-14
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    80   1e-14
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    80   1e-14
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    78   1e-14
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    79   1e-14
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    79   1e-14
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    75   1e-14
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    80   1e-14
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    78   1e-14
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    79   1e-14
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    78   1e-14
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    78   1e-14
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    78   1e-14
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    78   1e-14
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    77   1e-14
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    77   1e-14
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    79   1e-14
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    78   1e-14
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    77   1e-14
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    76   2e-14
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     79   2e-14
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    76   2e-14
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    79   2e-14
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    79   2e-14
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    78   2e-14
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    79   2e-14
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    79   2e-14
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    79   2e-14
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    77   2e-14
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    79   2e-14
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    78   2e-14
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    77   2e-14
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    79   2e-14
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    79   2e-14
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    78   2e-14
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    79   2e-14
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    79   2e-14
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               78   2e-14
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    79   2e-14
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    77   2e-14
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    77   2e-14
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    76   3e-14
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     77   3e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    79   3e-14
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    78   3e-14
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    78   3e-14
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    77   3e-14
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              78   3e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    77   3e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    78   3e-14
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    78   3e-14
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    78   3e-14
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    78   3e-14
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    78   3e-14
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    78   3e-14
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    77   4e-14
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    78   4e-14
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               77   4e-14
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    76   4e-14
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    78   4e-14
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    77   4e-14
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    76   4e-14
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    76   4e-14
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    76   4e-14
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    78   4e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    76   4e-14
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    77   4e-14
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    78   4e-14
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    77   5e-14
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    77   5e-14
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    78   5e-14
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    77   5e-14
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    77   5e-14
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    76   5e-14
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    76   5e-14
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    77   5e-14
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    77   5e-14
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    77   5e-14
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    77   6e-14
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    76   6e-14
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    77   6e-14
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    76   7e-14
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    76   7e-14
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    77   7e-14
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    74   7e-14
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    76   7e-14
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    77   7e-14
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    77   7e-14
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               77   7e-14
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    76   7e-14
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    76   7e-14
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    77   8e-14
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              74   8e-14
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    76   8e-14
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    75   8e-14
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    77   8e-14
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    76   8e-14
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    77   8e-14
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    75   9e-14
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    77   9e-14
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    77   9e-14
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     77   9e-14
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    76   9e-14
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    77   9e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    77   9e-14
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    77   9e-14
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    77   9e-14
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    75   9e-14
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    77   1e-13
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    76   1e-13
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    76   1e-13
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    76   1e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    77   1e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    76   1e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       77   1e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    76   1e-13
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    76   1e-13
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    76   1e-13
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    76   1e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    77   1e-13
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    76   1e-13
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    76   1e-13
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    74   1e-13
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    75   1e-13
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    76   1e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    76   1e-13
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    76   1e-13
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    75   1e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    76   1e-13
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    75   1e-13
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    76   1e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    76   1e-13
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               76   1e-13
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    75   1e-13
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    76   1e-13
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    74   1e-13
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    76   1e-13
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    75   1e-13
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    76   2e-13
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    76   2e-13
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    74   2e-13
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             76   2e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    76   2e-13
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    74   2e-13
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    74   2e-13
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    75   2e-13
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    75   2e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    76   2e-13
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    76   2e-13
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     74   2e-13
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    73   2e-13
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    75   2e-13
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    76   2e-13
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    74   2e-13
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    74   2e-13
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               74   2e-13
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    74   2e-13
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    75   2e-13
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    75   2e-13
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    74   2e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    76   2e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    75   2e-13
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    75   2e-13
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    75   2e-13
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    75   2e-13
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    74   2e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    75   2e-13
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    75   2e-13
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    75   3e-13
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    75   3e-13
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    75   3e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    75   3e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    75   3e-13
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    75   3e-13
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    75   3e-13
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    74   3e-13
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     75   3e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    75   3e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    75   3e-13
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    75   3e-13
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    74   3e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    75   3e-13
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    75   3e-13
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    74   3e-13
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    73   3e-13
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    74   3e-13
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    75   3e-13
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    75   3e-13
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    74   3e-13
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    75   3e-13
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    72   3e-13
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    75   3e-13
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    73   3e-13
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    75   4e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    75   4e-13
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    75   4e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    75   4e-13
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    73   4e-13
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    74   4e-13
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    74   4e-13
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    74   4e-13
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    75   4e-13
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    74   4e-13
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    73   4e-13
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    75   4e-13
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    75   4e-13
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    74   4e-13
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    75   4e-13
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    75   4e-13
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    74   4e-13
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    75   4e-13
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    74   4e-13
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    74   4e-13
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    74   5e-13
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    73   5e-13
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    74   5e-13
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    74   5e-13
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    74   5e-13
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    74   5e-13
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    73   5e-13
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    74   5e-13
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    74   5e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    74   6e-13
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    73   6e-13
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    74   6e-13
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    74   6e-13
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    74   6e-13
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    73   6e-13
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    72   6e-13
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    74   6e-13
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    73   6e-13
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    74   6e-13
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    74   6e-13
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    73   6e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    74   6e-13
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    74   6e-13
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    73   7e-13
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    74   7e-13
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    73   7e-13
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    74   7e-13
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    74   7e-13
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    73   7e-13
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    73   7e-13
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    74   7e-13
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    72   7e-13
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    73   8e-13
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    72   8e-13
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    74   8e-13
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    74   8e-13
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    74   8e-13
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    74   8e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    73   8e-13
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    74   8e-13
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    74   8e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    73   8e-13
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    72   8e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     72   9e-13
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    72   9e-13
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    73   9e-13
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    74   9e-13
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    72   9e-13
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    73   9e-13
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    74   9e-13
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    73   9e-13
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    73   9e-13
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    74   9e-13
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    73   1e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    74   1e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    74   1e-12
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    72   1e-12
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    72   1e-12
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    73   1e-12
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    73   1e-12
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    73   1e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     73   1e-12
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    73   1e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    72   1e-12
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    72   1e-12
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    73   1e-12
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    74   1e-12
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    73   1e-12
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    72   1e-12
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    72   1e-12
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     72   1e-12
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    72   1e-12
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    72   1e-12
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    73   1e-12
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    73   1e-12
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     72   1e-12
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    73   2e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   2e-12
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    72   2e-12
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    72   2e-12
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    71   2e-12
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    72   2e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    72   2e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    73   2e-12
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    73   2e-12
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    72   2e-12
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    73   2e-12
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    71   2e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    73   2e-12
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    72   2e-12
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    72   2e-12
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    71   2e-12
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    72   2e-12
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    73   2e-12
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    72   2e-12
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    73   2e-12
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    72   2e-12
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    72   2e-12
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    72   2e-12
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    71   2e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    72   2e-12
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    72   2e-12
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    72   2e-12
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    71   2e-12
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    72   2e-12
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               72   2e-12
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    72   2e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    72   2e-12
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    72   2e-12
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    71   2e-12
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    71   2e-12
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    72   3e-12
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    72   3e-12
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    71   3e-12
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    71   3e-12
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    71   3e-12
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    71   3e-12
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    71   3e-12
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    71   3e-12
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    72   3e-12
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    72   3e-12
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    72   3e-12
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    70   3e-12
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    71   4e-12
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    71   4e-12
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    71   4e-12
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    70   4e-12
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    71   4e-12
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    70   4e-12
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    71   4e-12
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    71   4e-12
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    71   4e-12
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    70   4e-12
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    70   4e-12
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    70   4e-12
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    71   4e-12
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    71   4e-12
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    70   4e-12
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    71   4e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    71   4e-12
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    71   5e-12
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    71   5e-12
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    70   5e-12
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    70   5e-12
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    70   5e-12
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    70   5e-12
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    70   5e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    71   5e-12
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    71   5e-12
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    71   6e-12
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    70   6e-12
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    70   6e-12
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    70   6e-12
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    70   6e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   6e-12
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    70   7e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    71   7e-12
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    70   7e-12
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    70   7e-12
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    71   7e-12
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    70   7e-12
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    71   7e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    70   7e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   7e-12
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    70   7e-12
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    70   8e-12
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    70   8e-12
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    70   8e-12
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    70   8e-12
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    70   8e-12
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    70   8e-12
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    70   8e-12
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    70   8e-12
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       69   8e-12
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    70   8e-12
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    69   8e-12
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    70   9e-12
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    70   9e-12
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    70   1e-11
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    69   1e-11
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    70   1e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    69   1e-11
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    70   1e-11
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    70   1e-11
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    67   1e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    69   1e-11
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    69   1e-11
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    70   1e-11
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    67   1e-11
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    69   1e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    69   1e-11
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    69   1e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    70   1e-11
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    69   1e-11
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    69   1e-11
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    69   1e-11
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    69   1e-11
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    70   1e-11
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    69   1e-11
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    69   1e-11
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    70   1e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    70   1e-11
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    69   1e-11
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    69   1e-11
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    69   1e-11
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    69   2e-11
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    69   2e-11
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    69   2e-11
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    69   2e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    70   2e-11
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    69   2e-11
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    68   2e-11
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    69   2e-11
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              69   2e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   2e-11
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    69   2e-11
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    69   2e-11
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    69   2e-11
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    69   2e-11
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    69   2e-11
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    69   2e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    69   2e-11
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    69   2e-11
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    69   2e-11
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    68   2e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    69   2e-11
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    69   2e-11
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    68   2e-11
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    69   2e-11
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    69   2e-11
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    69   2e-11
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    68   2e-11
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    68   2e-11
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    68   2e-11
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    68   2e-11
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    69   2e-11
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    69   2e-11
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    69   2e-11
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    69   2e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   3e-11
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    68   3e-11
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    68   3e-11
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              69   3e-11
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    68   3e-11
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    68   3e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    68   3e-11
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    69   3e-11
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    68   3e-11
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    68   3e-11
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    68   3e-11
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    69   3e-11
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    67   3e-11
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    69   3e-11
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    68   3e-11
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    68   3e-11
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    68   3e-11
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    69   3e-11
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    68   3e-11
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    67   3e-11
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    69   4e-11
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    68   4e-11
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    67   4e-11
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    67   4e-11
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    68   4e-11
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    67   4e-11
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    68   4e-11
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    68   4e-11
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    68   4e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    68   4e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               68   4e-11
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    68   4e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    68   4e-11
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    68   4e-11
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    68   4e-11
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    68   4e-11
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    67   4e-11
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              68   4e-11
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    67   4e-11
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    68   5e-11
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    67   5e-11
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    67   5e-11
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    67   5e-11
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    67   5e-11
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    68   5e-11
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    67   5e-11
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   5e-11
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    68   5e-11
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    68   5e-11
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    68   5e-11
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    68   5e-11
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    67   5e-11
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    67   5e-11
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    67   5e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     67   5e-11
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    67   6e-11
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    68   6e-11
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     67   6e-11
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    66   6e-11
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     67   6e-11
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    67   6e-11
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    67   6e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    66   6e-11
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    67   7e-11
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    67   7e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    67   7e-11
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    67   7e-11
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    67   7e-11
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    67   7e-11
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    67   7e-11
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    67   7e-11
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    66   7e-11
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    67   8e-11
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    67   8e-11
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    67   8e-11
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    67   8e-11
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    67   8e-11
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              67   8e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    67   9e-11
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    67   9e-11
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    66   9e-11
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    67   9e-11
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    67   9e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    67   9e-11
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    66   9e-11
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    67   9e-11
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    67   9e-11
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    67   9e-11
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    67   1e-10
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    67   1e-10
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              66   1e-10
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    67   1e-10
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    67   1e-10
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     66   1e-10
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    66   1e-10
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    66   1e-10
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    66   1e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    67   1e-10
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    66   1e-10
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    66   1e-10
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    66   2e-10
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    66   2e-10
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    65   2e-10
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    66   2e-10
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    66   2e-10
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    65   2e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    66   2e-10
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    65   2e-10
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    65   2e-10
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    65   2e-10
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    66   2e-10
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    66   2e-10
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    65   2e-10
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    65   2e-10
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               66   2e-10
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    66   2e-10
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    66   2e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   2e-10
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    66   2e-10
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    65   2e-10
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    66   2e-10
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    64   2e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    65   2e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    65   2e-10
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    64   3e-10
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    65   3e-10
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    65   3e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    65   3e-10
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    65   3e-10
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    65   3e-10
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    65   3e-10
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    65   3e-10
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    65   3e-10
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    65   3e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    65   3e-10
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    65   3e-10
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    65   3e-10
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    65   3e-10
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    64   3e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    65   3e-10
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    64   3e-10
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    65   3e-10
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    65   3e-10
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    65   4e-10
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    65   4e-10
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    65   4e-10
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    64   4e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    65   4e-10
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    65   4e-10
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    64   4e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    64   4e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     64   4e-10
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    65   4e-10
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    65   4e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    64   4e-10
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    65   5e-10
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    65   5e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    65   5e-10
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    65   5e-10
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    65   5e-10
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    64   5e-10
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    64   5e-10
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    64   5e-10
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    64   5e-10
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               64   6e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    64   6e-10
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    63   6e-10
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    64   6e-10
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    64   6e-10
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    64   6e-10
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    64   6e-10
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    64   6e-10
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    63   6e-10
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    63   7e-10
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    64   7e-10
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    64   7e-10
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    64   7e-10
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    64   7e-10
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    63   7e-10
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    64   7e-10
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               63   8e-10
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    64   8e-10
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    64   8e-10
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    63   8e-10
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    63   8e-10
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    63   9e-10
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    64   1e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   1e-09
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    62   1e-09
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    64   1e-09
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    64   1e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    63   1e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    64   1e-09
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    63   1e-09
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    62   1e-09
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    64   1e-09
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    64   1e-09
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    63   1e-09
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    63   1e-09
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    63   1e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    63   1e-09
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    63   1e-09
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    63   1e-09
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    63   1e-09
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    63   1e-09
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    62   1e-09
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    63   1e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    62   2e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    63   2e-09
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    62   2e-09
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    63   2e-09
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    62   2e-09
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    62   2e-09
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    63   2e-09
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    63   2e-09
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    63   2e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    62   2e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    62   2e-09
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    62   2e-09
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    63   2e-09
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    62   2e-09
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    62   2e-09
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    62   2e-09
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    62   2e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    62   2e-09
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    62   2e-09
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     62   2e-09
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    62   2e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    62   2e-09
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    61   2e-09
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    61   2e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    62   2e-09
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    62   2e-09
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    62   2e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    62   3e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    62   3e-09
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    62   3e-09
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    62   3e-09
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    62   3e-09
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    60   3e-09
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    61   3e-09
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    62   3e-09
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    61   3e-09
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    62   3e-09
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    62   3e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    62   3e-09
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    62   3e-09
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    62   3e-09
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    62   3e-09
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    62   3e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    62   3e-09
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    62   3e-09
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    62   3e-09
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    62   3e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    62   4e-09
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    62   4e-09
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    62   4e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    62   4e-09
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    61   4e-09
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    62   4e-09
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    62   4e-09
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    61   4e-09
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    61   4e-09
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    62   4e-09
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    62   4e-09
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    61   4e-09
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    61   5e-09
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    60   5e-09
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    61   5e-09
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    60   5e-09
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    62   5e-09
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    61   5e-09
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    60   5e-09
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    61   5e-09
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    61   5e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    61   5e-09
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    60   5e-09
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    61   6e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    61   6e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    61   6e-09
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    61   6e-09
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    61   6e-09
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    60   6e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    60   6e-09
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     61   6e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    61   6e-09
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    60   6e-09
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    61   7e-09
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    61   7e-09
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    61   7e-09
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    61   7e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    61   7e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    61   7e-09
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    61   7e-09
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    60   8e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    60   8e-09
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    60   8e-09
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    60   8e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    61   8e-09
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    61   9e-09
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    59   9e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    60   9e-09
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    60   1e-08
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    60   1e-08
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    59   1e-08
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    59   1e-08
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    60   1e-08
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    60   1e-08
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    59   1e-08
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    59   1e-08
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    59   1e-08
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    60   1e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   1e-08
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    60   1e-08
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    60   1e-08
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    60   1e-08
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    60   1e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    60   1e-08
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    60   1e-08
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    60   1e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    60   1e-08
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    60   1e-08
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    60   1e-08
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     60   1e-08
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    60   1e-08
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    59   1e-08
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    60   1e-08
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    60   1e-08
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    59   1e-08
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    60   1e-08
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    60   1e-08
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    59   1e-08
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    60   1e-08
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    60   1e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    60   1e-08
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    60   2e-08
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    60   2e-08
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    60   2e-08
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    60   2e-08
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    60   2e-08
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    59   2e-08
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    59   2e-08
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    60   2e-08
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    60   2e-08
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    59   2e-08
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    59   2e-08
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               59   2e-08
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    60   2e-08
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    59   2e-08
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    59   2e-08
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    60   2e-08
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    59   2e-08
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    59   2e-08
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    58   2e-08
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    59   2e-08
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    59   2e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    59   2e-08
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    59   2e-08
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    59   2e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    58   2e-08
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    59   2e-08
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    59   2e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    59   2e-08
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    59   2e-08
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    59   2e-08
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    59   2e-08
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    59   2e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    59   2e-08
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    59   2e-08
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    59   3e-08
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    58   3e-08
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    59   3e-08
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    59   3e-08
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    59   3e-08
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    58   3e-08
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    58   3e-08
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    58   3e-08
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    59   3e-08
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    58   3e-08
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    59   3e-08
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    59   3e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   3e-08
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     59   3e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    59   3e-08
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    58   3e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    59   3e-08
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    59   3e-08
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    58   3e-08
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    59   3e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    59   3e-08
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    58   3e-08
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    58   4e-08
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    59   4e-08
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    58   4e-08
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    59   4e-08
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    58   4e-08
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      59   4e-08
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    58   4e-08
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    59   4e-08
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    59   4e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    59   4e-08
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    58   4e-08
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    59   4e-08
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    58   4e-08
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    58   4e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       59   4e-08
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    58   4e-08
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    58   4e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              58   5e-08
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    59   5e-08
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    58   5e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    58   5e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    57   5e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    58   5e-08
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    58   5e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    58   5e-08
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    58   5e-08
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    58   5e-08
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    58   5e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    58   5e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    58   5e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    58   5e-08
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    58   5e-08
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    57   5e-08
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    58   6e-08
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    58   6e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    58   6e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    57   6e-08
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    58   6e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    58   6e-08
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    58   6e-08
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    57   6e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    58   7e-08
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    57   7e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    57   7e-08
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    58   7e-08
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    57   7e-08
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    58   7e-08
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    58   7e-08
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    57   7e-08
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    57   8e-08
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    57   8e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    57   8e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    57   8e-08
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    56   8e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    57   8e-08
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    57   9e-08
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    57   9e-08
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    57   9e-08
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    57   9e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    57   9e-08
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    57   1e-07
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    57   1e-07
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    57   1e-07
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    57   1e-07
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    57   1e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    57   1e-07
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    57   1e-07
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    57   1e-07
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    56   1e-07
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    57   1e-07
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    57   1e-07
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    57   1e-07
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    57   1e-07
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    57   1e-07
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    56   1e-07
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    57   1e-07
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 56   1e-07
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    57   1e-07
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    57   1e-07
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    57   1e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    57   1e-07
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    57   1e-07
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    57   2e-07
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    57   2e-07
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    56   2e-07
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    55   2e-07
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    56   2e-07
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              57   2e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    56   2e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    56   2e-07
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    56   2e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    56   2e-07
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    56   2e-07
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    55   2e-07
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    56   2e-07
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    55   2e-07
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    56   3e-07
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    56   3e-07
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    56   3e-07
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    56   3e-07
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    56   3e-07
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      56   3e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    55   3e-07
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    56   3e-07
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    55   3e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    55   3e-07
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    55   3e-07
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    55   3e-07
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    55   3e-07
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    55   3e-07
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    55   3e-07
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    55   3e-07
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    55   3e-07
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    55   3e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    55   3e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    55   3e-07
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    55   3e-07
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    55   4e-07
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    55   4e-07
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    55   4e-07
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    54   4e-07
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    55   4e-07
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    54   4e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    55   4e-07
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    54   4e-07
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    55   4e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    54   4e-07
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    55   4e-07
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    55   4e-07
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    54   4e-07
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    55   4e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    55   4e-07
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    54   5e-07
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    55   5e-07
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    55   5e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    55   5e-07
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    54   5e-07
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    55   5e-07
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    54   5e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    55   5e-07
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    55   5e-07
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    54   6e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   6e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    54   6e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    54   6e-07
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    54   6e-07
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               54   7e-07
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    54   7e-07
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    54   7e-07
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    54   7e-07
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    54   7e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    54   8e-07
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    54   8e-07
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    54   8e-07
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    54   8e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    54   8e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    54   9e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    54   9e-07
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    54   9e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    54   9e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    54   9e-07
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    53   9e-07
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    53   9e-07
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    54   1e-06
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    54   1e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    54   1e-06
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    54   1e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   1e-06
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    54   1e-06
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    54   1e-06
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    54   1e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   1e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    53   1e-06
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    54   1e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    54   1e-06
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    54   1e-06
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    53   1e-06
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    53   1e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    53   1e-06
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    53   1e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    54   1e-06
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    53   1e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    54   1e-06
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    54   1e-06
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    53   1e-06
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    53   1e-06
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    53   1e-06
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    53   1e-06
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    53   1e-06
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    54   1e-06
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    53   1e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    53   1e-06
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    54   2e-06
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    53   2e-06
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    53   2e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    53   2e-06
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    53   2e-06
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    52   2e-06
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    53   2e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    52   2e-06
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    53   2e-06
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    52   2e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    53   2e-06
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    53   2e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    53   2e-06
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    53   2e-06
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    52   2e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    53   2e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    53   2e-06
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    53   2e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     53   2e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    53   2e-06
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    52   2e-06
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    52   2e-06
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    53   2e-06
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    53   2e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    53   2e-06
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    52   3e-06
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      52   3e-06
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    52   3e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    52   3e-06
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    53   3e-06
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    52   3e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    52   3e-06
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    52   3e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   3e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    52   3e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    52   3e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    52   3e-06
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    52   3e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    52   3e-06
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    52   3e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    52   3e-06
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    52   3e-06
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    52   4e-06
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    51   4e-06
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    52   4e-06
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    51   4e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    51   4e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    52   4e-06
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    52   4e-06
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    52   4e-06
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    52   4e-06
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    52   4e-06
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    51   4e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    52   4e-06
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    52   4e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    52   4e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    52   5e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    52   5e-06
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    52   5e-06
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    52   5e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   5e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    52   5e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    52   5e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    52   5e-06
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    51   5e-06
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    51   5e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    52   5e-06
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    50   5e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   5e-06
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    52   6e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    51   6e-06
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    51   6e-06
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    52   6e-06
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    51   6e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    52   6e-06
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    51   6e-06
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    51   7e-06
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    51   7e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    51   7e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    50   7e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    51   7e-06
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    51   8e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    51   8e-06
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    51   8e-06
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    50   8e-06
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    51   8e-06
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    51   8e-06
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    50   8e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    51   8e-06
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    51   9e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   9e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    51   9e-06
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     50   9e-06
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    50   9e-06
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    51   9e-06
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    51   1e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    50   1e-05
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    50   1e-05
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    50   1e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   1e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    50   1e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    50   1e-05
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    50   1e-05
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    50   1e-05
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    50   1e-05
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    50   1e-05
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    50   1e-05
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    50   1e-05
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    50   1e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   1e-05
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    50   1e-05
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    50   1e-05
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    50   1e-05
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    50   1e-05
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    50   1e-05
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    50   1e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    50   1e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    50   1e-05
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    50   1e-05
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    50   2e-05
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    49   2e-05
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    49   2e-05
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    50   2e-05
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    50   2e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   2e-05
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    49   2e-05
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    50   2e-05
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    50   2e-05
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    50   2e-05
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    49   2e-05
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    50   2e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    50   2e-05
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    50   2e-05
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    50   2e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    49   2e-05
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    49   2e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    49   2e-05
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    49   2e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    49   3e-05
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    49   3e-05
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    49   3e-05
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    49   3e-05
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    49   3e-05
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    49   3e-05
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    49   3e-05
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    49   3e-05
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    49   3e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    49   3e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    49   3e-05
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    49   3e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    49   3e-05
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    49   3e-05
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    49   3e-05
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    49   3e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    49   3e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    49   3e-05
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    49   3e-05
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    49   3e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    49   3e-05
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     49   4e-05
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    49   4e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    49   4e-05
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    49   4e-05
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     49   4e-05
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              49   4e-05
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    49   4e-05
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    49   5e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    48   5e-05
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    48   5e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    48   5e-05
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    48   5e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    49   5e-05
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    48   5e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   5e-05
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    48   5e-05
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    48   5e-05
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    48   5e-05
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    48   5e-05
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    48   5e-05
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      48   5e-05
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    48   6e-05
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    48   6e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   6e-05
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    48   6e-05
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    48   6e-05
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    48   6e-05
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    48   6e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    48   6e-05
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    48   7e-05
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    48   7e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    48   7e-05
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    47   7e-05
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    48   8e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    48   8e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    48   8e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    47   8e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    47   8e-05
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    47   8e-05
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    47   9e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    48   9e-05
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    48   9e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    47   9e-05
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    47   9e-05
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    47   9e-05
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    47   1e-04
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    48   1e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    47   1e-04
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    47   1e-04
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    47   1e-04
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    47   1e-04
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    47   1e-04
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    47   1e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    47   1e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    47   1e-04
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    47   1e-04
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    47   1e-04
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     47   1e-04
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    47   1e-04
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    47   1e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    47   1e-04
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    47   1e-04
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    47   1e-04
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    47   1e-04
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    47   1e-04
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    47   1e-04
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    47   1e-04
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    47   1e-04
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    47   1e-04
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    47   1e-04
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    47   1e-04
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    47   1e-04
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    47   1e-04
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    47   1e-04
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    47   1e-04
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    46   2e-04
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    47   2e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    47   2e-04
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    47   2e-04
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    47   2e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    47   2e-04
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    47   2e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    47   2e-04
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    47   2e-04
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    46   2e-04
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    47   2e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    46   2e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   2e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   2e-04
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    46   2e-04
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    47   2e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    46   2e-04
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    46   2e-04
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    46   2e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    46   2e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    46   2e-04
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    46   2e-04
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    46   2e-04
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    47   2e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   2e-04
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    46   2e-04
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    46   2e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       46   2e-04
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    46   2e-04
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    45   2e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   2e-04
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    46   2e-04
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    46   3e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   3e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    46   3e-04
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    46   3e-04
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    46   3e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   3e-04
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    46   3e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    46   3e-04
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    46   3e-04
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    46   3e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    45   3e-04
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    46   3e-04
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    46   3e-04
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    46   3e-04
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    46   3e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    46   3e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    46   3e-04
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    45   3e-04
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    45   3e-04
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    46   3e-04
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    46   4e-04
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    45   4e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    45   4e-04
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    45   4e-04
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    45   4e-04
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    45   4e-04
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    45   4e-04
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    45   4e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    45   4e-04
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    45   4e-04
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    45   4e-04
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    45   4e-04
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    45   4e-04
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    45   4e-04
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    45   4e-04
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    45   5e-04
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    45   5e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    45   5e-04
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    45   5e-04
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    45   5e-04
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    45   5e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    45   5e-04
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    45   5e-04
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    45   5e-04
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     45   6e-04
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    45   6e-04
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     45   6e-04
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    44   6e-04
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    45   6e-04
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    45   6e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    45   6e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    45   6e-04
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    45   7e-04
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    45   7e-04
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    45   7e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    45   7e-04
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    45   7e-04
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    45   7e-04
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    44   7e-04
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    44   7e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    45   7e-04
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    44   7e-04
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    44   7e-04
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    44   7e-04
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    45   7e-04
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    44   7e-04
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    44   8e-04
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    45   8e-04
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    44   8e-04
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    44   8e-04
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    45   8e-04
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    44   8e-04
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     44   9e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    45   9e-04
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    44   0.001
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    44   0.001
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    44   0.001
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    44   0.001
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    44   0.001
KLTH0E06952g Chr5 complement(639783..641045) [1263 bp, 420 aa] {...    44   0.001
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    44   0.001
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    44   0.001
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    44   0.001
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    44   0.001
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    44   0.001
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    44   0.001
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    43   0.001
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    44   0.001
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    42   0.001
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    44   0.001
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    44   0.001
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    44   0.001
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    44   0.001
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    44   0.001
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     44   0.001
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    44   0.001
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    44   0.001
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               44   0.001
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               44   0.001
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     44   0.001
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     44   0.001
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    44   0.001
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    43   0.002
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    43   0.002
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    43   0.002
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    44   0.002
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     44   0.002
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    43   0.002
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    43   0.002
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    43   0.002
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    44   0.002
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    43   0.002
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    43   0.002
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    44   0.002
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    43   0.002
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    43   0.002
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    43   0.002
Kwal_47.17314 s47 complement(347091..348356) [1266 bp, 421 aa] {...    43   0.002
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    43   0.002
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    43   0.002
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    43   0.002
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    43   0.002
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    43   0.002
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    43   0.002
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    43   0.002
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    43   0.002
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    43   0.002
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    43   0.002
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    43   0.002
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    43   0.002
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    43   0.002
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    42   0.002
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      43   0.003
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    43   0.003
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    43   0.003
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    43   0.003
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             42   0.003
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    42   0.003
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    43   0.003
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    42   0.003
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    42   0.003
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    42   0.004
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    42   0.004
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    42   0.004
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    42   0.004
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    42   0.004
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    42   0.004
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    42   0.004
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    42   0.004
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    42   0.005
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    42   0.005
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    42   0.005
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    42   0.005
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    42   0.005
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    42   0.006
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    42   0.006
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    42   0.006
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    42   0.007
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    41   0.007
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    41   0.007
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    41   0.008
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     41   0.008
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    41   0.008
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    41   0.008
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    41   0.009
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    41   0.009
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    41   0.009
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    41   0.009
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    41   0.009
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    41   0.010
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    41   0.010
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    41   0.010
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    41   0.010
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    40   0.012
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    41   0.012
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    40   0.013
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    40   0.015
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    40   0.015
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    40   0.016
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    40   0.016
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    40   0.017
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    40   0.017
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    40   0.017
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    40   0.017
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    40   0.018
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    40   0.018
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.019
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    40   0.020
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    40   0.020
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    40   0.020
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    40   0.021
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.023
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    40   0.023
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               40   0.023
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    39   0.024
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    40   0.026
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    40   0.027
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    39   0.027
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.029
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.032
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    39   0.034
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    39   0.035
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    39   0.037
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    39   0.039
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    39   0.039
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    39   0.041
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    39   0.043
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    39   0.044
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    39   0.045
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    39   0.045
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    38   0.050
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    39   0.050
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    39   0.050
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    39   0.050
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    39   0.053
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    39   0.060
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    38   0.064
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    38   0.065
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    38   0.073
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.083
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    38   0.084
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    38   0.085
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    37   0.093
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    38   0.095
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.096
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    38   0.11 
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    37   0.11 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    37   0.11 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    38   0.11 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    38   0.11 
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    38   0.12 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    37   0.13 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    37   0.13 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    37   0.13 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    37   0.14 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    37   0.14 
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    37   0.14 
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    37   0.14 
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    37   0.15 
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    37   0.17 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.17 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    37   0.17 
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    37   0.18 
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    37   0.19 
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    37   0.20 
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    37   0.20 
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    37   0.23 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.24 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.25 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    36   0.28 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    36   0.28 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    36   0.29 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    36   0.32 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    36   0.33 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    36   0.34 
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    36   0.35 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    36   0.38 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   0.46 
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    35   0.50 
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    35   0.50 
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    35   0.50 
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    35   0.56 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    35   0.70 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    35   0.73 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.78 
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    35   0.90 
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               35   0.91 
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    35   0.94 
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    34   1.1  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    35   1.1  
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    34   1.2  
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    34   1.2  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    33   1.7  
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    33   2.1  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    33   2.1  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    33   2.5  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    33   2.5  
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    33   2.6  
TPHA0D03070 Chr4 (638114..639496) [1383 bp, 460 aa] {ON} Anc_3.4...    33   2.7  
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    33   3.0  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   3.1  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    33   3.4  
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    33   3.7  
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    33   3.8  
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    32   4.2  
TPHA0L01290 Chr12 (271693..274362) [2670 bp, 889 aa] {ON} Anc_8....    32   4.3  
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    32   5.5  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    32   6.7  
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    32   6.8  
Suva_7.149 Chr7 (280566..282071) [1506 bp, 501 aa] {ON} YGL119W ...    32   7.4  
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    32   7.7  

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/641 (96%), Positives = 619/641 (96%)

Query: 1   MKSNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIME 60
           MKSNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIME
Sbjct: 1   MKSNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIME 60

Query: 61  MQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLENINEPKR 120
           MQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLENINEPKR
Sbjct: 61  MQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLENINEPKR 120

Query: 121 ESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAH 180
           ESI               NPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAH
Sbjct: 121 ESILGEETGLKETELGELNPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAH 180

Query: 181 EMNSSSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVR 240
           EMNSSSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVR
Sbjct: 181 EMNSSSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVR 240

Query: 241 NEQKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQ 300
           NEQKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQ
Sbjct: 241 NEQKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQ 300

Query: 301 SVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENL 360
           SVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENL
Sbjct: 301 SVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENL 360

Query: 361 KTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINF 420
           KTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINF
Sbjct: 361 KTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINF 420

Query: 421 VRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQ 480
           VRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQ
Sbjct: 421 VRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQ 480

Query: 481 MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL 540
           MGTPNYMAPETLISQNYS       WKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL
Sbjct: 481 MGTPNYMAPETLISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL 540

Query: 541 LAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISK 600
           LAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISK
Sbjct: 541 LAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISK 600

Query: 601 PFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           PFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL
Sbjct: 601 PFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  388 bits (997), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 229/660 (34%), Positives = 383/660 (58%), Gaps = 56/660 (8%)

Query: 22  SSIFTQSNNCQIPSDTTIPIYTKECDIYA----KHER-YNDIMEMQREMKDQITFKTEQK 76
           +SIF  + N +  S TTI   + + ++      K+E  YN I ++Q+ +KD++T +    
Sbjct: 94  TSIFATTINNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINKIQQSIKDELTSR-HTG 152

Query: 77  RLYRWRTRSKSHVLGPARRSTQA-----LNKTTAKSHLSD--------LENINEPKRESI 123
           R+ R+   ++ + LGPA+R++       L   T  S+ S         +E  N+ K    
Sbjct: 153 RIKRFLNTNRMNKLGPAKRASTMEVDIPLPANTNDSYNSSSDVFSGQAIEEANDIKE--- 209

Query: 124 XXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDETR------------S 171
                          NPFQ+L+K NLPT EL  ++K+Y  R+ +E R             
Sbjct: 210 -VQNYDYSNINFGDLNPFQFLRKYNLPTTELPNISKIYFERQKEENRLSILKKHTNNNTG 268

Query: 172 KKTQAIDAHEMNSSSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRL-------KKGTSG 224
            KT   D  + + S +   + +  +  T  +      ++ S + +R        K   + 
Sbjct: 269 AKTNGNDIKDFSISKNLTSEDKTDLKNTVNTGLVSRTLLNSTLSSRKTNSSLSPKSKDNN 328

Query: 225 KLQSGRIHQPYHLSVRNEQKALSQCQQ---EMPTANEQAKLISKKLVSE--RVDYLIRDY 279
           +  S  + +P HL+  N++   ++ ++   ++ T  ++ +L   K   E  + D +I + 
Sbjct: 329 EFNSLDVEEPKHLTSNNDEIRPNKRREPLVDLSTNRKEPELKRFKTFEENKKRDEIINEK 388

Query: 280 NSKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQ 339
            + +Q+   +++ ++E   P+    Q N+++     + + E   +ELLG+GGSSKVYKV+
Sbjct: 389 ENVVQDVP-KSMKRVEIMEPKMSHRQRNVIN-----VNETEYEKIELLGRGGSSKVYKVK 442

Query: 340 DRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMEC 399
             + K +ALK+++ +E D++     + EI+LL +L  E RVVKL +Y+++  ++ ++MEC
Sbjct: 443 GPSNKVFALKRVVFDEFDDSSINGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMEC 502

Query: 400 GNFDLSHVLHERVNR--PFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTL 457
           G+ DLS +L++++N   PFDI F+R  ++EMI+C+K VHD+ IVHSDLKPANF+ VKG L
Sbjct: 503 GDVDLSQILNQKINLNLPFDIEFIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVL 562

Query: 458 KLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXX-XWKIGKPSDIWS 516
           K+IDFGIA+ + D+T+N+YR TQ GTPNYMAPETLI+ NY+        WK+GKPSD+WS
Sbjct: 563 KIIDFGIADAVPDHTVNIYRETQTGTPNYMAPETLIAMNYTNNGAKDLKWKVGKPSDVWS 622

Query: 517 YGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNR 576
            GCI+YQM YG  PY+ F G  R+ AIMN +++I YP ++   + +P+++V L+K CL R
Sbjct: 623 CGCIIYQMIYGKAPYAGFQGQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELMKNCLRR 682

Query: 577 DPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKL 636
           DP  R T D+I   +F NP++ S+ F+  LI NAI +G + + +++D+I  L+N+V+++L
Sbjct: 683 DPGKRWTVDDILSSTFLNPIVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTNDVLTRL 742

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  388 bits (997), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 224/608 (36%), Positives = 354/608 (58%), Gaps = 51/608 (8%)

Query: 57  DIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDL---- 112
           +I ++++ ++D+ T K  ++R  R+    + + LGPA+R++  +  +   S + DL    
Sbjct: 178 NIEKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPAKRTS--MTSSLITSEMDDLLIQR 235

Query: 113 ---ENINEPKRESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDET 169
                + +  RE                 NPFQY+ K N+P +EL +++K+Y  ++ +E 
Sbjct: 236 DAKGEVEQQDRE--MTPQVDYSNIVFGDLNPFQYVNKYNIPMEELPQISKVYIEKRKEEN 293

Query: 170 RSKKTQAIDAHEMNSSSDQLEKRQ---------RKVTTTTRSIYDKNRIIPSNVKNRLKK 220
           R     A+  H  +S +      Q          K     + + D   ++   +++  + 
Sbjct: 294 RR---VALRKHSSSSLNVVSNSSQYWANKGNYDDKSEENEKPVAD---LLGPAIRHSDQT 347

Query: 221 GTSGKLQSGRIHQPYHLSVRNEQKALSQCQQEMPTANEQA----KLISKKLVSERVDY-- 274
           GTSG L       P    V+  +   +  +QE+P  N +     KLI K+ V   ++   
Sbjct: 348 GTSGPL-------PPRTPVQLNESNHNVMKQELPAHNNENYNVNKLIRKREVLANLNVNQ 400

Query: 275 ----LIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLGKG 330
               L +  N+  Q  K   I ++E   P+  PS+ N        I +EE   +ELLG G
Sbjct: 401 KEPELKKPKNNLEQLDKPAIIKRVEIQEPK--PSKKNTSIV----INNEEYEKIELLGSG 454

Query: 331 GSSKVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDD 390
           GSSKVYKV+D + K +ALK++ ++  +E+     + EI LL++L  +ERVV+L  Y ++ 
Sbjct: 455 GSSKVYKVRDSSKKVFALKRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALES 514

Query: 391 RMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANF 450
            ++ ++MECG++DLS +L ER+N+P D  FVR  ++E+  C+K VHD  IVHSDLKPANF
Sbjct: 515 SVLYLIMECGDYDLSVMLRERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANF 574

Query: 451 IFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS-XXXXXXXWKIG 509
           IFVKGTLK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++ NY+        WK+G
Sbjct: 575 IFVKGTLKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTNGESNVSRWKVG 634

Query: 510 KPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVAL 569
           KPSD+WS GCI+YQM YG PPY+SF G+DR+ AI+ P+++I+YP+    G  VP S++ L
Sbjct: 635 KPSDVWSLGCIIYQMVYGKPPYASFQGNDRIRAIIKPSVKIEYPSVKE-GVTVPNSIIEL 693

Query: 570 IKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLS 629
           IK CLNRDP  R   D + + +F +P+++S+ F+  L+ NA+ YGI+  +++   I  L+
Sbjct: 694 IKVCLNRDPNKRVDVDGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALA 753

Query: 630 NEVVSKLS 637
           N+V+ KLS
Sbjct: 754 NDVIEKLS 761

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  385 bits (988), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 197/527 (37%), Positives = 320/527 (60%), Gaps = 29/527 (5%)

Query: 140 PFQYLKKNNLPTKELSRLTKLYCNRKLDETR----------SKKTQAID-----AHEMNS 184
           PF+YLKK++LPT EL  ++++Y  ++  E R          SK++ ++      A   NS
Sbjct: 252 PFEYLKKHDLPTSELPYISRIYFEKQKLENRQTVLRKRRFSSKESLSLGTTSSLAPYSNS 311

Query: 185 SSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVRNEQK 244
            ++   +  R ++   R I D +    S +  ++ K      +SG    P  L     Q 
Sbjct: 312 KNNTTNQVSRDLSLPRRKISDTS----SKISKQILKSNINLSESGSHGFPPDLQSIQRQH 367

Query: 245 ALSQCQQEMPTANEQAKLISKKLVSE-RVDYLIRDYNSKIQNKKHQT--------IPKIE 295
             ++     P  +     +S K + + R  +   D    +Q+   +T         P+ +
Sbjct: 368 ESAEKLSRAPLIDLNVNNVSPKRMDKLRETHKFSDSRLNVQDFSKKTDVVVYEKQAPRKK 427

Query: 296 APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEE 355
             + +   S + L  +    + D E   +ELLG+GGSS+VYKV++   K +ALK++  +E
Sbjct: 428 VEIVEPKRSHSKLAKRNTITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVFALKRVSFDE 487

Query: 356 LDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRP 415
            D++     + EIELL++L+ E RVVKL +Y++D  ++ ++MECG+ DLS +L +R + P
Sbjct: 488 FDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMP 547

Query: 416 FDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNV 475
            D++FVR  ++E++ CIK VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN I D+T+N+
Sbjct: 548 LDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAIPDHTVNI 607

Query: 476 YRNTQMGTPNYMAPETLISQNYSXXX-XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
           YR  Q+GTPNYMAPE L++ NY+        WK+GKPSDIWS GCI+YQM YG PPY+ F
Sbjct: 608 YRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGF 667

Query: 535 LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
            G +RLLAIMNP++++ +  ++   + +P+SL+ L+K CL RDP+ R + D++    FFN
Sbjct: 668 QGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVDQVLESPFFN 727

Query: 595 PMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           P++++  F++ LI NA+ YG++ + ++ ++I+ L+N+V+ +L+   +
Sbjct: 728 PIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  385 bits (989), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/570 (38%), Positives = 321/570 (56%), Gaps = 71/570 (12%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAHEMNSSSDQ---LEKRQRK 195
           NP+QYLKK+NLPT EL  ++++Y   +  E R     A+  + +N S  Q   L      
Sbjct: 254 NPYQYLKKHNLPTSELPNISRIYFEMQKRENRRA---AVRKNVLNGSGGQVAQLPTNNSA 310

Query: 196 VTTTTRSIYDKNRIIP-SNVKNRLKKGTSGKLQSGRIHQPYH----LSVRNEQKALSQ-- 248
           + +T  ++ + N I   S+  N+L    +      R  QP       SV +  K LS   
Sbjct: 311 IASTAVALKEANGIASISSGSNKLTPPQAANSMIKRDRQPRRKHSDASVSSFSKLLSSPI 370

Query: 249 ---------CQQEMPT----------------------------ANEQAKLISKKL-VSE 270
                     Q+  P                             AN    +I+KK  V E
Sbjct: 371 SAGAPNYADSQKHTPVQKNSTPYEPLLINQNTKKREALNSLDVNANRHPSIITKKQKVDE 430

Query: 271 RVDYLIRDYNSKIQNKKHQTIPKIEAPV-------PQSVPSQANLMS-----KQWSRITD 318
             DYL +   +    KK + +  +  PV       P S    AN+       +Q   +  
Sbjct: 431 LHDYL-KKAPAAASVKKVEIVEPVRDPVITTIPLKPPSAEVPANVHQLPQRKRQVITVNG 489

Query: 319 EELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREE 378
            E   VELLG+GGSSKVYKV++ + + YALK++  +E D+      + EIELLK+L  + 
Sbjct: 490 SEYEKVELLGRGGSSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQT 549

Query: 379 RVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           RVVKLI+++++  ++ V+MECG+ DLS VL +R + P DI FVR  ++EM++C+K VHD+
Sbjct: 550 RVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDA 609

Query: 439 DIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
            IVHSDLKPANF+FVKG LK+IDFGIAN + D+T+N+YR+TQ+GTPNYMAPE L++ NY+
Sbjct: 610 GIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYT 669

Query: 499 XXXXX-------XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
                         WK+GKPSDIWS GCI+YQM YG PPY SF G +RLLAIMNP ++I 
Sbjct: 670 QDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIV 729

Query: 552 YPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAI 611
           YP ++P G  VP++ +  IK CL R+P+ R T DE+    F  P+ ++  F+  LI NA+
Sbjct: 730 YPEKTPTGDFVPRTALDTIKACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAV 789

Query: 612 NYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
            YG + + +++++++ L+++V  +LS   L
Sbjct: 790 KYGSDQRYVSKEKVENLADDVWHRLSDFRL 819

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  382 bits (982), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 239/669 (35%), Positives = 369/669 (55%), Gaps = 107/669 (15%)

Query: 61  MQREMKDQITFKT-EQKRLYRWRTRSKSHVLGPARRST----------------QALNKT 103
           +   +KD++  K  E+++  R+  R+K  VLGPA R+                 + +NK 
Sbjct: 142 LHESIKDELNTKNLERRKTRRFFNRTKMGVLGPAMRTNLENEKLGKNSKHETIEEKINKY 201

Query: 104 TAKSHL----------------SDLENINEPKRESIXXXXXXXXXXXXXXXNPFQYLKKN 147
              +HL                   ++IN+  + +I               NP QY+KKN
Sbjct: 202 DQPAHLISSSSTVASSSYTSYHDTHQSINQTSQTTINYDLIDFGEL-----NPVQYIKKN 256

Query: 148 NLPTKELSRLTKLYCNRKLDETRS---KK--------------------TQAIDAHE--- 181
           NLPT EL  ++KLY  R+  E+R    KK                     Q  DA     
Sbjct: 257 NLPTTELPTISKLYFERQRAESRKIALKKHSSSKELLFSSSSSALKNSFNQISDAQNESK 316

Query: 182 --MNSSSDQLEKRQRKVTT--TTRSIYDKN--RIIPSNVKNRLK--KGTSGKLQSGRIHQ 233
              N++ D     + K++    +RS + +N   I+  +  N L+  K  SG         
Sbjct: 317 CISNNTGDTDALSEPKISDKENSRSTWSRNGYAILKDDYINNLEYYKNPSG--------- 367

Query: 234 PYHLSVRNEQKALSQCQ---------QEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQ 284
            Y  S+  +++ALS            QE+   N++ K+ +K + SE      R  NS ++
Sbjct: 368 -YSSSLNKKREALSSINVNTNHNHSYQELGD-NKRNKISTKGIESEIEHVAAR--NSMLE 423

Query: 285 NKKHQTI----------PKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSK 334
            +K + +           K+E   P+S  S   + SK    +   E   +ELLG+GGSSK
Sbjct: 424 QQKVEQLNSANIHKHGKKKVEIIEPKSA-SANRIASKSVVSVNGVEYEKIELLGRGGSSK 482

Query: 335 VYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMV 393
           VYKV++    K +ALK+++ +E DE+     + EIELLK+L  E+RVV LI+++++  ++
Sbjct: 483 VYKVKNVHNNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVL 542

Query: 394 QVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV 453
            ++MECG+ DLS +L++R+N P DI F+R  ++EM++C+K VHD+ IVHSDLKPANF+FV
Sbjct: 543 LLIMECGDHDLSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFV 602

Query: 454 KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX-XXXXXXWKIGKPS 512
           KG LK+IDFGIAN + D+T+N+YR TQ+GTPNYMAPE L++ N          WK+GKPS
Sbjct: 603 KGILKIIDFGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSDQQNKWKVGKPS 662

Query: 513 DIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKT 572
           DIWS GCILYQM YG PPY SF G +RLLAIMNPN++I +  ++   +++P+S +  +K 
Sbjct: 663 DIWSCGCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKA 722

Query: 573 CLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEV 632
           CL R+P  R   D++   SFFNP++++   +  LI NA+NYG + + +T ++I  L+++V
Sbjct: 723 CLIRNPDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDV 782

Query: 633 VSKLSTLNL 641
           +++L+   L
Sbjct: 783 LNRLADFRL 791

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  380 bits (975), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 228/649 (35%), Positives = 360/649 (55%), Gaps = 83/649 (12%)

Query: 55  YNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALN------------- 101
           +  I  +++ MK+ IT K  ++R  R+   +++  LGPA+R++   N             
Sbjct: 130 FEKIRSLRQNMKEDITSKYTERRSKRFLISNRTTKLGPAKRASTLTNVFDDDVPNSSNQL 189

Query: 102 ----KTTAKSHLSDLEN--INEPKRESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELS 155
               + T +S L D       E K+ S                NP QY+KK+NLPT +L 
Sbjct: 190 ISNLRETTESPLDDPSETEFKETKKNS------DYESINFGDLNPIQYIKKHNLPTSDLP 243

Query: 156 RLTKLYCNRKLDETRSKKTQAIDAHEMNSSSDQLEKRQRKVTT---TTRSIYDKNRIIPS 212
            ++++Y +++ +E R     A+  H    SS +L  + R  +T    + S+ +K+  I S
Sbjct: 244 MISQIYFDKQREENRQ---AALRKH----SSRELLSKNRSSSTPLSNSYSLVNKDHSITS 296

Query: 213 N-------------------------VKNRLKKGTSGKLQSGRIHQPYHLSVRNE----- 242
           N                         +K  +       L+S  I++ Y  S RN+     
Sbjct: 297 NSNSQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYSNLKSP-INKIYRESSRNKDSDSE 355

Query: 243 -QKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKK---HQTIPKIEAPV 298
            ++AL         A+   +  +K+L     D +I D N  ++N+    H+  PK   PV
Sbjct: 356 KREALRNISINTSHADSGLQQDNKRLKRSLDDAIIHD-NENMKNQDVFYHRPAPK--PPV 412

Query: 299 PQSV----PSQANLMSKQWSRIT--DEELSIVELLGKGGSSKVYKVQDRTGKYYALKQIL 352
            + V    P ++  +S   + IT  D +   +ELLG+GGSS+VYKV+    K YALK++ 
Sbjct: 413 TKKVEIVEPIKSASLSNSRNIITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYALKRVS 472

Query: 353 LEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERV 412
            +  D++     + EIELL++L  ++RV++L++Y++ D ++ ++MECG+ DLS +L++R 
Sbjct: 473 FDAFDDSSVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS 532

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNT 472
           N   D NF+R  +KEM++CIK VHD+ IVHSDLKPANF+ VKG LK+IDFGIAN + ++T
Sbjct: 533 NMSLDFNFIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHT 592

Query: 473 LNVYRNTQMGTPNYMAPETLISQNYSXX----XXXXXWKIGKPSDIWSYGCILYQMTYGH 528
           +N+YR TQ+GTPNYMAPE L++ NY+           WK+G+PSD+WS GCI+YQM YG 
Sbjct: 593 VNIYRETQIGTPNYMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGK 652

Query: 529 PPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQ 588
           PPY SF G +RLLAIMNP+++I +P+ +   +++P+S + L+K CL R+P  R T D++ 
Sbjct: 653 PPYGSFQGQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVL 712

Query: 589 HCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLS 637
             +F  P +IS   +E LI NA+ YG E   I+ D +  +   V+ K +
Sbjct: 713 SSTFLQPFMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFA 761

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  380 bits (976), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/541 (39%), Positives = 320/541 (59%), Gaps = 45/541 (8%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAHEMNSSSDQLEKRQRKVTT 198
           NP+QYLKK NLP+ EL  ++K+Y  R+ +E R    +   +  +   + + E  Q + T 
Sbjct: 260 NPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTL---ALKREFTQYRRTQ 316

Query: 199 TTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGR-IHQPYHLSVRNEQKALSQCQQEMPTAN 257
           T R    K+       K  L+   S  LQ  + + Q     + N+++AL       P+++
Sbjct: 317 TARQPRRKHNF--GTDKTSLQDPLSSPLQKNQLVFQEVDRELANKREALKPLDVNNPSSS 374

Query: 258 EQAKLISKKLVSERV--DYLIRDYNSKIQNKKHQTIP--KIEAPVP-----QSVPSQA-- 306
           ++AK    K  ++ V  DY    ++ +     H + P  K+E   P     + +P ++  
Sbjct: 375 QEAK--RPKYENDHVPEDYRPPFFSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEG 432

Query: 307 -----------NLMSKQWSRITDEELSI--------------VELLGKGGSSKVYKVQDR 341
                      N ++   S  T +  S               VELLGKGGS KVYKV+  
Sbjct: 433 CDVSSKLNKGDNYLNYNGSFDTKKRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSS 492

Query: 342 TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGN 401
             K YALK++  +E DE+     + EIELLK+L  ++RVVKLI+Y +   ++ +LMECG 
Sbjct: 493 DHKVYALKRVSFDEFDESSIDGFKGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGE 552

Query: 402 FDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLID 461
            DLS VL +R   PFD  FVR   +EMI+C+K VHD+DIVHSDLKPANF+FVKG LK+ID
Sbjct: 553 HDLSQVLTQRSKIPFDTEFVRYHFQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIID 612

Query: 462 FGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX-XXXXXWKIGKPSDIWSYGCI 520
           FGIAN + D+T+N+YR+ Q+GTPNYMAPETL++ N++        WK+GKPSD+WS GCI
Sbjct: 613 FGIANAVPDHTVNIYRDNQIGTPNYMAPETLVAMNFTRNDGEQAKWKVGKPSDVWSCGCI 672

Query: 521 LYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQL 580
           LYQM YG PPY +F G++RL AIMNP+++I YP +   G  +P++++  I++CL R+P  
Sbjct: 673 LYQMVYGKPPYGTFQGNNRLYAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPIS 732

Query: 581 RATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLN 640
           R T D++   +  NP+ ++K F+  LI NA+NYG + +++  +R++ LS +V +KL+   
Sbjct: 733 RVTIDQLLSGALINPVTVTKFFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFK 792

Query: 641 L 641
           L
Sbjct: 793 L 793

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  375 bits (964), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/678 (34%), Positives = 364/678 (53%), Gaps = 81/678 (11%)

Query: 19  STCSSIFTQSNNCQIPSDTTIPIYTKECDIYAK-HERYNDI-ME--------MQREMKDQ 68
           S+ S+IF  +N  + PS TT        D  A+  E YN++ ME        +Q+ MK++
Sbjct: 96  SSISTIFAHTNLPRQPSITTTNNNVPGDDDNARLAESYNELEMESNLQRIKVLQQSMKEE 155

Query: 69  ITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTT-------------AKSHLSDLENI 115
           +T +  ++R  R+ T S+   LGPA+R++ A+++                + H   L  +
Sbjct: 156 LTSRYVERRNRRFLT-SRLTRLGPAKRASSAVSEKDILRSIDNNTQHLLPEYHTPPLSVL 214

Query: 116 NEPK----RESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDE--- 168
           ++ +     ES                 PF+YLKK  LPT EL  ++K Y  ++ +E   
Sbjct: 215 DQKEISTVPESAARGNIDYSSIDFGRLKPFEYLKKKKLPTSELPSISKAYFQKQKEESLQ 274

Query: 169 -TRSKKTQAIDAH--------EMNSSSDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLK 219
            T  K+ + ++          E  SS + + K   ++    R  + +    PS   N   
Sbjct: 275 NTLKKRHRTLNEDPKIGTFNDEGGSSGNIVSKGTPRIPNLPRRKFSQASARPSAPHNLPP 334

Query: 220 KGTSGKLQSGRIHQPYHLSVRN------EQKALSQCQQEMPTA-----NEQAKLISKKLV 268
               G +Q         L + N      + K     Q   P       NE  K +S K  
Sbjct: 335 TDKYGPIQYSSRDVLTSLDINNQSPSKADHKFGYDIQIGKPYTVKTPLNESYKRLSPKKK 394

Query: 269 SERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLG 328
            E ++  I     K   K   T+  I+                            +ELLG
Sbjct: 395 VEIIEPFIYAQKKKTGKKLSITVNGID-------------------------YEKIELLG 429

Query: 329 KGGSSKVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKI 388
           +GGSSKVYKV++   K +ALK++  +E D++     + EIELL++L +E RVV+L +Y++
Sbjct: 430 RGGSSKVYKVKNDQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQM 489

Query: 389 DDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPA 448
              ++ ++MECG+ DLS VL++R+  P D++F+R   +E+++C+KAVHD+ IVHSDLKPA
Sbjct: 490 SSGVLYLIMECGDNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPA 549

Query: 449 NFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXX-----X 503
           NF+F+KG LKLIDFGIAN I D+T+NVYR +Q+GTPNYMAPETLI+ N+S          
Sbjct: 550 NFVFIKGLLKLIDFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNKEM 609

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVP 563
             WK+GKPSD+WS GCI+YQM YG PPY+ F G +RLLAIMNP +++ +   +   +K+P
Sbjct: 610 SKWKVGKPSDVWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIP 669

Query: 564 QSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQD 623
            SL+ L+K CL RDP  R + D++    FFNP+I++  F++ LI NA+ YG + + +T  
Sbjct: 670 TSLIDLMKACLLRDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDA 729

Query: 624 RIKLLSNEVVSKLSTLNL 641
           +I+ LSN+V+ +L+   +
Sbjct: 730 KIEELSNDVLERLNDFKM 747

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  373 bits (958), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/530 (38%), Positives = 319/530 (60%), Gaps = 34/530 (6%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETR-------SKKTQAIDAHEMNSSSDQLEK 191
           NPFQ LKK NLP+ EL+ ++KLY  ++ +E R       S   +       ++S      
Sbjct: 252 NPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMKKRSVSKEGFMTSISSNSVSSKIS 311

Query: 192 RQRKVTTTTRSIY-------DKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVR-NEQ 243
           RQ    TTT + +       D N I+ +    R  +     L      +    S+  N+ 
Sbjct: 312 RQSSFHTTTNNRHSSMVSKQDTNAILMNTTSTRSDEKVMKPLNEYEPDRKVLASIDINKN 371

Query: 244 KALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKH---------QTIPKI 294
             ++  +++ P  ++ +   SK  +SE      R+  S    K H         + + K+
Sbjct: 372 INVNAIEKKRPVEHQYSYEKSKIHISES-----RESQSSTVEKPHTFQDNKEGQKIVKKV 426

Query: 295 E-APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQIL 352
           E    P S+ ++ +  SK    + D E   +ELLG+GGSSKVYKV++    + YALK+++
Sbjct: 427 EIVEPPTSMTNRKS--SKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALKRVV 484

Query: 353 LEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERV 412
            +E D+      + EIELLK+L  E+RVVKLI+Y++D+ ++ ++MECG+ DLS +L++R 
Sbjct: 485 FDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQILNQRA 544

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNT 472
           N P D++F+R  S+EM++C+K VHD+ IVHSDLKPANF+ VKG LK+IDFGIAN + D+T
Sbjct: 545 NMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPDHT 604

Query: 473 LNVYRNTQMGTPNYMAPETLISQN-YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
           +N+YR+TQ+GTPNYMAPE L++ N  S       W++GKPSDIWS GCI+YQM YG PPY
Sbjct: 605 VNIYRDTQIGTPNYMAPEALVALNEVSNVEKKNRWRVGKPSDIWSCGCIMYQMFYGRPPY 664

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCS 591
            +F   +RLLAIMNP ++I +  ++   ++VP+S +  +K CL R P+ R T DEI   S
Sbjct: 665 GAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTADEILDAS 724

Query: 592 FFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           F NP++++   +  LI NA+ YG +   +++D+I  L+++V+++L+   L
Sbjct: 725 FLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score =  369 bits (947), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/653 (33%), Positives = 355/653 (54%), Gaps = 88/653 (13%)

Query: 55  YNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQ---------------- 98
           +  I  +++ MK+ IT K  ++R  R+   +++  LGPA+R+T                 
Sbjct: 131 FERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFDDDVADSSNQL 190

Query: 99  -ALNKTTAKSHLSDLENIN-------EPKRESIXXXXXXXXXXXXXXXNPFQYLKKNNLP 150
            ++++ T +S L+D            + K ESI               NP QY+KK+NL 
Sbjct: 191 ISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDL----------NPIQYIKKHNLS 240

Query: 151 TKELSRLTKLYCNRKLDETRSKKTQAIDAHEMN-------------------------SS 185
           T +L  ++++Y +R+ +E +    +   + E+                          +S
Sbjct: 241 TSDLPIISQIYFDRQREENKQAALRKHSSRELLSRNRSSSTSLSSGNSLANKDASITFNS 300

Query: 186 SDQLEKRQRKVTTTTRSIYDKNRIIPSNVKNRLKKGTSGKLQSGRIHQPYHLSVRNEQKA 245
           S Q  ++    + +++S  +  +    NV       ++    +G +H+ Y    RN+   
Sbjct: 301 SSQPRRKVSTGSFSSKSSVEIRKTFKENVN-----ASNINSPNGPVHKIYKEISRNKD-- 353

Query: 246 LSQCQQEMP------TANEQAKLISK--KLVSERVDYLIRDYNSKIQNKKHQTI---PKI 294
              C++          AN    ++ +  K +   +D  I + N  +  K  +     P  
Sbjct: 354 -PDCEKREVLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAP 412

Query: 295 EAPVPQSV----PSQANLMSKQWSRIT--DEELSIVELLGKGGSSKVYKVQDRTGKYYAL 348
           + PV + V    P++    S   + IT  D +   +ELLG+GGSS+VYKV+    K YAL
Sbjct: 413 KPPVTKKVEIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYAL 472

Query: 349 KQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVL 408
           K++  +  D++     + EIELL++L  E+RV++L++Y++ D ++ ++MECG+ DLS +L
Sbjct: 473 KRVSFDAFDDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 532

Query: 409 HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKI 468
           ++R N   D NFVR  +KEM++CIK VHD+ IVHSDLKPANF+ VKG LK+IDFGIAN +
Sbjct: 533 NQRGNMSLDFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 592

Query: 469 ADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX----XXXXWKIGKPSDIWSYGCILYQM 524
            ++T+N+YR TQ+GTPNYMAPE L++ NY+           WK+G+PSD+WS GCI+YQM
Sbjct: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQM 652

Query: 525 TYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATT 584
            YG PPY SF G +RLLAIMNP+++I +P  +   +K+P+S + L+K CL R+P  R T 
Sbjct: 653 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTV 712

Query: 585 DEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLS 637
           D++ + +F  P +IS+  +E LI NA+ YG E   I+ D +  +   V+ K +
Sbjct: 713 DKVLNSTFLQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFA 765

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  371 bits (952), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 171/359 (47%), Positives = 247/359 (68%), Gaps = 7/359 (1%)

Query: 289 QTIPKIEAPVPQSVPSQANLMS----KQWSRITDEELSIVELLGKGGSSKVYKVQDRTGK 344
           +T+P ++ P   S+   A+L S    K   ++   E   +ELLG+GGSSKVYKV+    K
Sbjct: 504 ETVP-LKPPATGSLKPPASLDSHARRKPTIQVNGTEYEKMELLGRGGSSKVYKVRTPNNK 562

Query: 345 YYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDL 404
            YALK++  +E DE+     + EIELLK+L  + RVV+L++Y++   ++ V+MECG+ DL
Sbjct: 563 VYALKRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMECGDHDL 622

Query: 405 SHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGI 464
           S +L  R + P DI FVR  ++EM+ C+K VHD+DIVHSDLKPANF+FVKG LK+IDFGI
Sbjct: 623 SSILAHRASLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGILKIIDFGI 682

Query: 465 ANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX--XXXXWKIGKPSDIWSYGCILY 522
           AN + D+T+N+YR TQ+GTPNYMAPE L++ NY+         WK+GKPSDIWS GCILY
Sbjct: 683 ANAVPDHTVNIYRETQIGTPNYMAPEALVAMNYAQGQPHQQNRWKVGKPSDIWSCGCILY 742

Query: 523 QMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA 582
           QM YG PPY  F G +RLLAIMNP ++I YP ++P G  VP++ +  +K CL R+P  R 
Sbjct: 743 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRC 802

Query: 583 TTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           T DE+ + +F  P+ ++  F+  LI NA+ YG E + ++ ++++ L+++V ++L+   L
Sbjct: 803 TVDEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 77/188 (40%), Gaps = 36/188 (19%)

Query: 16  SADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIMEMQREMKDQITFKTEQ 75
           S D + S++FT S +   PS TT+       D     +  + +  +Q  +K++++ +  +
Sbjct: 123 SEDPSQSTLFTTSRHQ--PSMTTVHPEPHGLDSSKSEQSSHRLRALQHSLKEELSSRHAK 180

Query: 76  KRLYRWRTRSKSHVLGPARR--STQALNKT----------------TAKSHLSDLENINE 117
           +R  R+   S+  +LGPA+R  ST  L  T                +  S  S     NE
Sbjct: 181 RRNRRF-VSSRLGLLGPAKRASSTAGLAYTDSGNDDASISQQEANVSGSSSTSGFVGNNE 239

Query: 118 PKRESIXXXXXXXXXXXXXXX---------------NPFQYLKKNNLPTKELSRLTKLYC 162
                +                              NP+QYLKK+NLPT EL  ++K+Y 
Sbjct: 240 GYNVFLESHTGAGERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYF 299

Query: 163 NRKLDETR 170
            R+ +E R
Sbjct: 300 ERQKEENR 307

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  369 bits (948), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 236/708 (33%), Positives = 367/708 (51%), Gaps = 104/708 (14%)

Query: 30  NCQIPSDTTIPIYTKECDIYAKHERYNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHV 89
           N + PS+   P      D+Y +  R + +  MQ+ ++D+++ ++ ++R  R+   S+ ++
Sbjct: 138 NPETPSEQGKP-----EDMYLEKSR-SRVKSMQQTLRDELSLRSSKRRNRRF-VSSRFNL 190

Query: 90  LGPARRSTQALNKTTAKSHLSDLENINE-------------------------------P 118
           LGPA+R++     T   S L+D  N+++                               P
Sbjct: 191 LGPAKRASSNTG-TPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVFYESQNSSSP 249

Query: 119 KRESIXXXXXXX---XXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDETRS---- 171
           +++S                   NP+QYLKK+N+PT EL  +++LY  R+  E R     
Sbjct: 250 QKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALR 309

Query: 172 KKTQAIDAHEMNSSSDQLE------------------KRQ--RKVTTTTRSIYDKNRIIP 211
           K   A DA +   +S  L                   KRQ  RK++    +   K    P
Sbjct: 310 KNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDSKAWSSP 369

Query: 212 SNVKNRLKKGTSGKLQSGRIHQPYHLSVRNEQKALSQCQQEMPTANEQAKLISKKLVSER 271
            +    LK   S    S R  + Y    R E+      ++    +N        +L ++R
Sbjct: 370 VSSSKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININSNYHQLQNKR 429

Query: 272 VDYLIRD-----------YNSKIQNK-------KHQTIPKI------EAPVP----QSVP 303
             Y   +           +   +Q +       KH++ P +      E   P    +S+P
Sbjct: 430 TKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLKTTESIP 489

Query: 304 SQANLMSK-QWSR------ITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQILLEE 355
            +    S   ++R      +   E   +ELLG+GGSSKVYKV++    K YALK++  +E
Sbjct: 490 LKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALKRVSFDE 549

Query: 356 LDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRP 415
            D++     + EIELLK+L  + RVVKLI++++D  ++  +MECG+ DLSH L  R    
Sbjct: 550 FDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLALRSGMG 609

Query: 416 FDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNV 475
            D+ FVR  S+EM++C+K VHDS IVHSDLKPANF+FVKG LK+IDFGIAN + ++T+N+
Sbjct: 610 LDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNI 669

Query: 476 YRNTQMGTPNYMAPETLISQNYSXX--XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
           YR TQ+GTPNYMAPE L++ NY+         WK+GKPSDIWS GCI+YQM YG PPY  
Sbjct: 670 YRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGG 729

Query: 534 FLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           F G +RLLAIMNP ++I YP ++  G  VP++ +  +K CL R+P+ R + DE+ +  F 
Sbjct: 730 FQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVDEVLNGPFV 789

Query: 594 NPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
            P+ ++  F+  LI N++ YG   + I+ ++I+ L+ +V  +L+   L
Sbjct: 790 KPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  367 bits (941), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/540 (36%), Positives = 317/540 (58%), Gaps = 49/540 (9%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETRSKKTQAIDAHEMNSSSDQLEKRQRKVTT 198
           NP QY+K +NLPT ELS+++K Y  ++ +E R K  + ++   M  S +   K       
Sbjct: 246 NPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKALKNVN---MKQSLNYDLKHYSNSFP 302

Query: 199 TTRSIYDKNRIIPSNVKNRLKKGTSGK-------------------LQSGRIHQPYHLSV 239
           +  S  + N I  + +++   +G S                     ++S  I     L  
Sbjct: 303 SIESGKENNLIHNTEIEDFNGRGHSTNNHSSSYLSNSHSHPVSTQFVESANIE----LEK 358

Query: 240 RNEQKALSQCQQEMPTANE--QAKLISKKLVSERVDY-----LIRD--YNSKIQNKKHQT 290
              +K+LS       T  E  Q   ++  +    +DY      ++D  ++  +  KK++ 
Sbjct: 359 PTLKKSLSNADSYRHTQREALQNIDVNSNVRDGAIDYKRQKIALKDSEFDGILDKKKYRG 418

Query: 291 IPKIE---APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYA 347
           I ++E    P     PS+ N++S     +   E   VELLG+GGSS VYKV+    + YA
Sbjct: 419 IKRVEIVEPPTSTRPPSRKNVVS-----VNGTEYERVELLGRGGSSNVYKVRGLKNRVYA 473

Query: 348 LKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHV 407
           LK++  +E DE+     + EI LLK+L  + RVV+L ++++   ++ +LMECG++DLS V
Sbjct: 474 LKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQV 533

Query: 408 LHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANK 467
           LH+R N+PFD+ F+R  ++EM+ C+K VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN 
Sbjct: 534 LHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANA 593

Query: 468 IADNTLNVYRNTQMGTPNYMAPETLISQNYSX------XXXXXXWKIGKPSDIWSYGCIL 521
           + D+T+N+YR+ Q+GTPNYMAPE L++ NY+             WKIGKP+DIWS GCI+
Sbjct: 594 VPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCII 653

Query: 522 YQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLR 581
           YQM YG PPY+ + G +RLL+IM+PN++I+Y    P    +P   + L++ CL R+P+ R
Sbjct: 654 YQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEER 713

Query: 582 ATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
            +  +I    F NP+++S+ F+++LI  A++YG    +++  R++ L++ V+++L+   +
Sbjct: 714 WSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFRM 773

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  367 bits (942), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/343 (46%), Positives = 243/343 (70%), Gaps = 5/343 (1%)

Query: 303 PSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENLKT 362
           PSQ     K   ++ D E   VELLG+GGSSKVYKV+DR+   YALK+++ +E D++  +
Sbjct: 454 PSQGQ-SRKNVVKVNDVEYEKVELLGRGGSSKVYKVRDRSNNVYALKRVVFDEFDDSSVS 512

Query: 363 DLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVR 422
             + EIELLK+L  + RVV+L++++++  ++ ++MECG+ DLS +L+ R   P D+ FVR
Sbjct: 513 GFKGEIELLKKLENQNRVVQLVDHEMEHGVLYLIMECGDHDLSRILNHRAGMPLDMEFVR 572

Query: 423 LMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMG 482
             ++EM+ C+K VHDS IVHSDLKPANF+FVKG LK+IDFGIAN + D+T+N+YR  Q+G
Sbjct: 573 YHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRENQIG 632

Query: 483 TPNYMAPETLISQNYSXX----XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHD 538
           TPNYMAPE L++ NY+           WK+GKPSDIWS GCI+YQM YG PPY  F G +
Sbjct: 633 TPNYMAPEALVAMNYTQDDEKYQQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQN 692

Query: 539 RLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
           RLLAIMNP+++I + +++   + +P+S +  +K CL R+P  R T DE+   +F  P+++
Sbjct: 693 RLLAIMNPDVKIIFSDKTSRDETIPRSALDTMKACLTRNPDKRLTVDEVLESNFLKPLMV 752

Query: 599 SKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           +  F+  LI NA+ YG + + +++++++ L+++V+S+LS   L
Sbjct: 753 TPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLSRLSDFRL 795

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 78/175 (44%), Gaps = 22/175 (12%)

Query: 16  SADSTCSSIFTQSNNCQIPSDTTIPIYTKECDIYAKHERYNDIMEMQREMKDQITFKTEQ 75
           S + + S+IF QS   Q PS TT+     +         +  I  MQ+ M++++T +  Q
Sbjct: 99  SGEPSQSTIFAQSRFNQQPSMTTMDTNGIKIPASDLETSFGRIKSMQQNMREELTTRHAQ 158

Query: 76  KRLYRWRTRSKSHVLGPARRSTQA--------------LNKTTAKSHLSDLENINEP--- 118
           +R  R+   ++  VLGPA+R++                + + T  + L +   +  P   
Sbjct: 159 RRSRRFLHGTRIGVLGPAKRASSTNGADMSDLSIGNVQMVQQTDNTPLEEHREVQSPAEI 218

Query: 119 -----KRESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCNRKLDE 168
                K+E+                NP QYLK +NL + EL +L+K+Y  R+ +E
Sbjct: 219 KPDLTKKETRTRDVLDYKSIDFGDMNPVQYLKLHNLSSSELPKLSKVYFERQREE 273

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  364 bits (935), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 170/359 (47%), Positives = 246/359 (68%), Gaps = 8/359 (2%)

Query: 290 TIPKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALK 349
           TIP ++ P  ++   Q     +Q  ++   E   VELLG+GGSSKVYKV+    K YALK
Sbjct: 507 TIP-LKPPSTENGSYQTPQRKRQIIQVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALK 565

Query: 350 QILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLH 409
           ++  +E D+      + EIELLKRL  + RVVKLI+++++  ++ V+MECG+ DLS VL 
Sbjct: 566 RVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLA 625

Query: 410 ERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIA 469
           +R N PFDI FVR  ++EM++C++ VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN + 
Sbjct: 626 QRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVP 685

Query: 470 DNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXX-------WKIGKPSDIWSYGCILY 522
           D+T+N+YR+TQ+GTPNYMAPE L++ NY+              WK+GKPSDIWS GCI+Y
Sbjct: 686 DHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIY 745

Query: 523 QMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA 582
           QM YG PPY  F G +RLLAIMNP ++I YP ++  G  VP++ +  IK CL R+P+ R 
Sbjct: 746 QMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTTHGDLVPRTALDTIKACLERNPERRW 805

Query: 583 TTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           T D++    F  P+ ++  F+  LI NA+ YG + + +++++++ L+++V ++LS   L
Sbjct: 806 TVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (71%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETR 170
           NP+QYLKK+NLPT EL  ++++Y   +  E R
Sbjct: 257 NPYQYLKKHNLPTSELPNISRIYFEIQKKENR 288

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  366 bits (940), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 171/399 (42%), Positives = 259/399 (64%), Gaps = 31/399 (7%)

Query: 269 SERVDY----LIRDYNSKIQNKKH------------QTIPKIEAPVPQSVPSQANLMSKQ 312
           + R++Y     + DYN+ +Q+  H              IP +  P PQ V  +  ++  +
Sbjct: 577 ANRINYRSKSALADYNNPMQDIDHLPSSQPPVRPPPHFIPSLSQPQPQQVRKKVEIIEPE 636

Query: 313 WSR---------ITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENLKTD 363
                       + + E   V LLG+GGSSKVYKV+     YYALK++L +E D++    
Sbjct: 637 AKIHNYQKPIIIVNNIEYEKVALLGRGGSSKVYKVKGPKNSYYALKRVLFDEFDDSSIEG 696

Query: 364 LEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRL 423
            + EIELLK+L  EERVV+L +YK+++  + ++MECG+ DLS +LH+R  +P D+ F+R 
Sbjct: 697 FKGEIELLKKLEHEERVVRLFDYKMENGTLHLIMECGDLDLSRILHQRSKQPLDLEFIRY 756

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGT 483
            S+EM++C++ VH++DIVHSDLKPANF+ V   LK+IDFGIAN + D+T+N+YR  Q+GT
Sbjct: 757 YSREMLKCVQVVHNNDIVHSDLKPANFVLVGSVLKIIDFGIANAVPDHTVNIYRECQIGT 816

Query: 484 PNYMAPETLISQNYSXXXXXXX------WKIGKPSDIWSYGCILYQMTYGHPPYSSFLGH 537
           PNYMAPE L+S N +             WK+GKPSD+WS GCILYQM YG PPY  + G 
Sbjct: 817 PNYMAPEALVSMNLTSNENENAQKPVNRWKVGKPSDVWSCGCILYQMFYGKPPYGHYQGQ 876

Query: 538 DRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMI 597
           +RLLAIMNP ++I YP  +P  + +P+S +  +K CL RDP  R T +E+ +  FF+P++
Sbjct: 877 NRLLAIMNPEVEIKYPEFTPNNEPIPRSAIDTMKACLYRDPSKRFTIEELLNNPFFSPIM 936

Query: 598 ISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKL 636
           ++  FL+ LI N++ YGI+ +NI+ + ++ +S++V+++L
Sbjct: 937 VTPFFLQDLIKNSVRYGIDRKNISNEELEKMSDDVLNRL 975

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 139 NPFQYLKKNNLPTKELSRLTKLYCNRKLDETR 170
           NP QY +K++LP  EL +L K Y  ++ +E R
Sbjct: 329 NPMQYWRKHDLPPSELPKLNKAYLQKQREENR 360

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  360 bits (925), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 238/340 (70%), Gaps = 6/340 (1%)

Query: 308 LMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENLKTDLERE 367
           L  +  + + D E   +ELLG+GGSSKVYKV+D   K YALK+++ +E D++     + E
Sbjct: 508 LTRRNATTVNDVEYEKIELLGRGGSSKVYKVKDNNNKLYALKRVVFDEFDDSSVNGFKGE 567

Query: 368 IELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKE 427
           IELL +L  + RVVKL +Y+++  ++ ++MECG+ DLS +L++R   P DI FVR  ++E
Sbjct: 568 IELLNKLKDKTRVVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYHARE 627

Query: 428 MIECIKAVHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYM 487
           M++C+K VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN + D+T+N+YR TQ+GTPNYM
Sbjct: 628 MLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIGTPNYM 687

Query: 488 APETLISQNYSXX------XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLL 541
           APE L++ NY+             WK+GKPSD+WS GCI+YQM YG PPY  F G +RLL
Sbjct: 688 APEALVAMNYTGQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGGFQGQNRLL 747

Query: 542 AIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKP 601
           AIMNP ++I +  ++   + VP+S++  +K CL R+P  R T DE+    F  P++++  
Sbjct: 748 AIMNPEVKIIFSEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPFLKPVMVTPF 807

Query: 602 FLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           F+  LI NA+ YG + + +++++++ L+++V+ KL+ + L
Sbjct: 808 FIRDLIKNAVRYGADQKEVSKEKVEELADDVLGKLADIRL 847

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 103/235 (43%), Gaps = 39/235 (16%)

Query: 14  LESADSTCSSIFTQSNNCQIPSDTTI-PIYTKECDIYAKHERYNDIMEMQREMKDQITFK 72
           + S D + S++F Q  + Q PS TT+     ++ D       +  I  MQ+ M++++T +
Sbjct: 112 IHSGDPSQSTLFAQYRSHQQPSMTTMNSTDVQDKDGNDFENSFQKIKSMQQSMREELTSR 171

Query: 73  TEQKRLYRWRTRSKSHVLGPARRST----QALNK-----------TTAKSHLSDLENINE 117
             ++R  R+   S+   LGPA+R++    +AL++               +    L  +N 
Sbjct: 172 HAERRSRRFLNSSRKEFLGPAKRASAIFPEALDRRFSGTTNSNGTNDNNNSTDGLLQLN- 230

Query: 118 PKRESIXXXXXXXXXXXXXXXNPFQYLKKNNLPTKELSRLTKLYCN----RKLDETRSKK 173
            + ES                NP QYLKK++LPT EL R+++LY      RK++  R K+
Sbjct: 231 -REESPEEKLSLSSQVDLGDLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLKQ 289

Query: 174 -----------------TQAIDAHEMNSSSDQLEKRQRKVTTTTRSIYDKNRIIP 211
                             Q I     NS S   + R++   T++R+I+ +    P
Sbjct: 290 EILRESRTSSSGNNGSGVQHIPIRRENSLSAATQPRRKLSDTSSRNIFQRGFSSP 344

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score =  358 bits (918), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 245/368 (66%), Gaps = 14/368 (3%)

Query: 284 QNKKHQTI----PKIEAPVPQSV----PSQANLMSKQWSRIT--DEELSIVELLGKGGSS 333
           +NKK Q +    P  + PV + V    P+++   S   S IT  D +   +ELLG+GGSS
Sbjct: 394 ENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSS 453

Query: 334 KVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMV 393
           +VYKV+    K YALK++  +  D++     + EIELL++L  + RV++L++Y++ D ++
Sbjct: 454 RVYKVKGSGNKIYALKRVSFDAFDDSSVDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLL 513

Query: 394 QVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV 453
            ++MECG+ DLS +L++R N P D NFVR  +KEM+ CIK VHD+ IVHSDLKPANF+ V
Sbjct: 514 YLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV 573

Query: 454 KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX----XXXXWKIG 509
           KG LK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++ NY+           WK+G
Sbjct: 574 KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVG 633

Query: 510 KPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVAL 569
           +PSD+WS GCI+YQM YG PPY SF G +RLLAIMNP+++I +P  +   +K+P+S + L
Sbjct: 634 RPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIEL 693

Query: 570 IKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLS 629
           +K CL R+P  R T D++   +F  P +IS   +E LI NA+ YG E   I+ D +  + 
Sbjct: 694 MKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVV 753

Query: 630 NEVVSKLS 637
             V+ K S
Sbjct: 754 ETVLRKFS 761

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 61/130 (46%), Gaps = 16/130 (12%)

Query: 55  YNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLEN 114
           +  I  +++ MK+ +T K  ++R  R+   +++  LGPA+R+T   N       + +  N
Sbjct: 131 FERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTN--VFDEEVPNSSN 188

Query: 115 INEPKRESIXXXXXXXXXXXXXXX--------------NPFQYLKKNNLPTKELSRLTKL 160
           +    RE+I                             NP QY+KK+NLPT +L  ++++
Sbjct: 189 LPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQI 248

Query: 161 YCNRKLDETR 170
           Y +++ +E R
Sbjct: 249 YFDKQREENR 258

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score =  355 bits (911), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/360 (45%), Positives = 245/360 (68%), Gaps = 12/360 (3%)

Query: 288 HQTIPKIEAPVPQSV----PSQANLMSKQWSRIT--DEELSIVELLGKGGSSKVYKVQDR 341
           H+  PK   PV + V    P+++  +S   + IT  D +   +ELLG+GGSS+VYKV+  
Sbjct: 403 HRPAPK--PPVTKKVEIVEPAKSASLSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGS 460

Query: 342 TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGN 401
             + YALK++  +  D++     + EIELL++L  ++RV++L++Y++ D ++ ++MECG+
Sbjct: 461 GNRVYALKRVSFDAFDDSSIDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGD 520

Query: 402 FDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGTLKLID 461
            DLS +L++R   P D NFVR  +KEM+ CIK VHD+ IVHSDLKPANF+ VKG LK+ID
Sbjct: 521 HDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIID 580

Query: 462 FGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXX----XWKIGKPSDIWSY 517
           FGIAN + ++T+N+YR TQ+GTPNYMAPE L++ NY+           WK+G+PSD+WS 
Sbjct: 581 FGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSC 640

Query: 518 GCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRD 577
           GCI+YQM YG PPY SF G +RLLAIMNP+++I +P  +   +K+P+S + L+K CL R+
Sbjct: 641 GCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRN 700

Query: 578 PQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLS 637
           P  R T D++   +F  P +IS   +E LI NA+ YG E  +I+QD +  + + V+ K +
Sbjct: 701 PDKRWTVDKVLSSTFLQPFMISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFA 760

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  350 bits (899), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 157/329 (47%), Positives = 227/329 (68%), Gaps = 3/329 (0%)

Query: 316 ITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRL 374
           +   E   +ELLG+GG+SKVYKV++    K YALK++  +E D++     + EIELLK+L
Sbjct: 510 VNGTEYEKLELLGRGGTSKVYKVKNANNNKVYALKRVSFDEFDDSSIDGFKGEIELLKKL 569

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
             + RVVKLI++++D  ++ V+MECG+ DLS  L  R   P D+ FVR  ++EM++C+K 
Sbjct: 570 ETQPRVVKLIDHEMDHGVLYVVMECGDHDLSQTLAHRSGMPLDVEFVRYHAQEMLKCVKV 629

Query: 435 VHDSDIVHSDLKPANFIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLIS 494
           VHD+ IVHSDLKPANF+FVKG LK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++
Sbjct: 630 VHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 689

Query: 495 QNYSXXXX--XXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDY 552
            NY+         WK+GKPSDIWS GCI+YQM YG PPY  F G +RLLAIMNP ++I Y
Sbjct: 690 MNYTHNQAPEQSRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVY 749

Query: 553 PNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAIN 612
           P ++  G  VP++ +  +K CL R+P  R T +E+ + SF  P+ ++  F+  LI+N++ 
Sbjct: 750 PEKTSNGDTVPKTAIDTMKACLERNPNKRWTVEEVANGSFVKPVSVTHFFIRDLIENSVR 809

Query: 613 YGIENQNITQDRIKLLSNEVVSKLSTLNL 641
           YG   + I+  +++ L+ +V  +L    L
Sbjct: 810 YGANQKEISSAKVEELAEDVWHRLEEFRL 838

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 84/205 (40%), Gaps = 39/205 (19%)

Query: 3   SNSPMLSIDKILESADSTCSSIFTQSNNCQIPSDTTIP---IYTKECDIYAKHERYNDIM 59
           +NS        + S D + S++F    + Q    T  P   ++    D  +  +  + I 
Sbjct: 104 TNSSYTGPHSTIHSVDHSDSTLFATFKDNQQSMTTFNPDDQLHQSGLDRVSLEQSRSKIK 163

Query: 60  EMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLENINEPK 119
            +Q+ ++D ++ +  ++R  R+ + S+  +LGPA+R++ + + T  +S L +  NI++P+
Sbjct: 164 SLQQALRDDLSSRNSKRRTRRFAS-SRLSLLGPAKRAS-STSGTPNRSELIEESNISQPE 221

Query: 120 ----------------------------------RESIXXXXXXXXXXXXXXXNPFQYLK 145
                                                                NP+QYLK
Sbjct: 222 GNISNSSTRTASANLNEHNIFYEPQNSNQAIQSSHSPFISSTINYEDVEFGDLNPYQYLK 281

Query: 146 KNNLPTKELSRLTKLYCNRKLDETR 170
           K NLPT EL  ++++Y  R+  + R
Sbjct: 282 KYNLPTTELPNISRIYFERQKGQNR 306

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 136/278 (48%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK  + +T + YA+K + L+  D +   D++REI+ L  L +   + +
Sbjct: 26  TEVVGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQMPNITR 84

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + +LME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 85  YYGSYLKDTSLWILMEYCAGGSLRSLL-----RPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G++KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 140 VIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 197

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN---PNIQIDYPNE 555
                         DIWS G   Y++  G+PPY        +  I+    P ++      
Sbjct: 198 DTKV----------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLE------ 241

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              G+    SL   I  CL+ DP+ R + D++    F 
Sbjct: 242 ---GRSYSSSLKEFIALCLDEDPKERLSADDLLRSKFI 276

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 139/278 (50%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLE-ELDENLKTDLEREIELLKRLAREERVV 381
            E++G+G    VYK    +T   YA+K + LE +LDE    D++REI+ L  L +   + 
Sbjct: 45  TEIIGRGKFGVVYKGYHMKTKGVYAIKVLSLESDLDE--VADIQREIQFLVSLKQVPNIT 102

Query: 382 KLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDS 438
           +     + D  + ++ME C    +  +L     RP  I+  ++ ++ +E++  +  +H  
Sbjct: 103 RYYASYLKDTSLWIIMEYCAGGSVRTLL-----RPGKIDEKYIAVIMRELLVALHYIHKD 157

Query: 439 DIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
           +++H D+K AN +   +G +KL DFG+A ++  NT+   R T  GTP +MAPE ++    
Sbjct: 158 NVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNTM--RRQTMAGTPYWMAPEVIMEG-- 213

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF--LGHDRLLAIMNPNIQIDYPNE 555
                         +DIWS G   Y++  G+PP+     L   ++++   P  +++  N 
Sbjct: 214 --------ISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKP-ARLEGKNH 264

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            P  K+        I  CL+ DPQ R T D++ H S F
Sbjct: 265 DPLLKE-------FIAMCLDEDPQERPTADKLLHESAF 295

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 135/278 (48%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK  + +TG+ YA+K + L+  D +   D++REI+ L  L +   + +
Sbjct: 26  TEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISNITR 84

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + ++ME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 85  YYGSYLKDTSLWIIMEHCAGGSLRSLL-----RPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 197

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN---PNIQIDYPNE 555
                         DIWS G   Y++  G+PPY        +  I+    P ++      
Sbjct: 198 DTKV----------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLE------ 241

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               +    SL   I  CL+ DP+ R + D++    F 
Sbjct: 242 ---DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 135/278 (48%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK  + +T + YA+K + L+  D +   D++REI+ L  L +   + +
Sbjct: 26  TEVIGRGKFGVVYKGYNVKTRRVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQISNITR 84

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + ++ME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 85  YYGSYLKDTSLWIIMEYCAGGSLRSLL-----RPGKIDEKYIGVIMRELLVALKCIHKDN 139

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 197

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN---PNIQIDYPNE 555
                         DIWS G   Y++  G+PPY        +  I+    P ++      
Sbjct: 198 DTKV----------DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPPRLE------ 241

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              G+    SL   I  CL+ DP+ R + D++    F 
Sbjct: 242 ---GRSYSPSLKEFIALCLDEDPKERLSADDLLRSKFI 276

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score =  112 bits (279), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 83/277 (29%), Positives = 137/277 (49%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++GKG    VYK  + RT   YA+K + L+  DE+   D++REI+ L  L +   V +
Sbjct: 44  TEVIGKGKFGVVYKGYNLRTKHVYAIKVLNLDS-DEDEVEDVQREIQFLASLKQLPNVTR 102

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + +  + ++ME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 103 YYGSYLKNTSLWIIMEYCAGGSLRSLL-----RPGKIDEKYIGVIMRELLVALKFIHKDN 157

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           I+H D+K AN +   +G +KL DFG+A ++   TL   R T  GTP +MAPE ++   Y 
Sbjct: 158 IIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRTLR--RQTMAGTPYWMAPEVIMEGVYY 215

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF--LGHDRLLAIMNPNIQIDYPNES 556
                         DIWS G   Y+++ G+PPY     L   +L+    P  +++  N +
Sbjct: 216 DTKV----------DIWSLGITAYEISTGNPPYCDVEALRAMQLITKSKP-PRLEGRNYT 264

Query: 557 PCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           P  K+        I  CL+ DP  R + DE+    F 
Sbjct: 265 PLIKE-------FIALCLDEDPNERLSADELLKSKFI 294

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 154/309 (49%), Gaps = 40/309 (12%)

Query: 296 APVPQSVPSQANLMSKQWSRITDEELSIV----ELLGKGGSSKVYK-VQDRTGKYYALKQ 350
            P+    P  ++L  KQ S   D++++ +    E++G+G    VYK    RT + YA+K 
Sbjct: 11  GPITNGKPRASSLPKKQTS---DQDVNSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIKV 67

Query: 351 ILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLH 409
           + L+  DE+   D++RE++ L  L +   + +     + D  + ++ME C    L  +L 
Sbjct: 68  LNLDS-DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLL- 125

Query: 410 ERVNRPFDIN--FVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIAN 466
               RP  I+  ++ ++ +E++  +K +H  +++H D+K AN +   +G++KL DFG+A 
Sbjct: 126 ----RPGKIDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLITNEGSVKLCDFGVAA 181

Query: 467 KIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTY 526
           ++  +TL   R T  GTP +MAPE ++   Y               DIWS G   Y++  
Sbjct: 182 QLNQSTLR--RQTMAGTPYWMAPEVIMEGVYYDTKV----------DIWSLGITAYEIAT 229

Query: 527 GHPPYSSF--LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATT 584
           G+PPY     L   +L+    P  +++  + +P  K+        I  CL+ DP+ R + 
Sbjct: 230 GNPPYCEVEALRAMQLITKSKP-PRLESRSYTPLLKE-------FIALCLDEDPKERLSA 281

Query: 585 DEIQHCSFF 593
           +E+    F 
Sbjct: 282 EELSKTKFI 290

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 155/305 (50%), Gaps = 44/305 (14%)

Query: 300 QSVPSQANLMSKQWSRITDEELSIV----ELLGKGGSSKVYK-VQDRTGKYYALKQILLE 354
           Q++PS A L +       D++++ V    E++G+G    VYK    +T + YA+K + L+
Sbjct: 24  QTLPSHARLPA-------DKDINSVFRRTEVIGRGKFGIVYKGYHVKTKQIYAIKVLNLD 76

Query: 355 ELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVN 413
             DE+   D++REI+ L  L +   + +     + D  + ++ME C    L  +L     
Sbjct: 77  S-DEDEVEDVQREIQFLASLKQLPNITRYYGSYLKDTSLWIIMEYCAGGSLRTLL----- 130

Query: 414 RPFDIN--FVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIAD 470
           RP  I+  ++ ++++E++  +K +H  +I+H D+K AN +   +G++KL DFG+A ++  
Sbjct: 131 RPGKIDEKYIGVITREILIALKYIHKDNIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQ 190

Query: 471 NTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPP 530
           +T    R T  GTP +MAPE ++   Y               DIWS G   Y++  G+PP
Sbjct: 191 ST--KRRQTMAGTPYWMAPEVIMEGVYYDTKV----------DIWSLGITTYEIATGNPP 238

Query: 531 YSSF--LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQ 588
           Y     L   +L+    P  +++  N SP  K+     VAL   CL+ DP+ R + +++ 
Sbjct: 239 YCEIEALRAMQLITKSKP-PRLEGRNYSPLLKE----FVAL---CLDEDPKERMSAEDLL 290

Query: 589 HCSFF 593
              F 
Sbjct: 291 KTKFI 295

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 135/278 (48%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK  + +T + +A+K + L+  D +   D++REI+ L  L +   + +
Sbjct: 26  TEVIGRGKFGVVYKGYNVKTRRVFAIKVLNLDS-DSDEVEDVQREIQFLASLKQIHNITR 84

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + ++ME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 85  YYGSYLKDTSLWIIMEYCAGGSLRSLL-----RPGKIDEKYIGVIMREVLVALKCIHKDN 139

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 140 VIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 197

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN---PNIQIDYPNE 555
                         DIWS G   Y++  G+PPY        +  I+    P ++      
Sbjct: 198 DTKV----------DIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLE------ 241

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              G+    SL   I  CL+ DP+ R + D++    F 
Sbjct: 242 ---GRSYSPSLKEFIALCLDEDPKERLSADDLLKSKFI 276

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/304 (28%), Positives = 151/304 (49%), Gaps = 38/304 (12%)

Query: 301 SVPSQANLMSKQWSRITDEELSI----VELLGKGGSSKVYKVQDRTGKY-YALKQILLEE 355
           SV S++N ++ +     DE+++       ++G+G    VYK      K+ YA+K + L+ 
Sbjct: 12  SVTSRSNSVNPELDE-DDEDINFKFRRTNVIGRGKFGVVYKGYHLNTKHVYAIKVLNLDS 70

Query: 356 LDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNR 414
            DE+   D+++EI+ L  L +   + +     + +  + ++ME CG   L  +L     R
Sbjct: 71  -DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSLWIIMEYCGGGSLRSLL-----R 124

Query: 415 PFDIN--FVRLMSKEMIECIKAVHDSDIVHSDLKPAN-FIFVKGTLKLIDFGIANKIADN 471
           P  I+  ++ ++ +E++  +K +H  +++H D+K AN  I   G++KL DFG+A ++  N
Sbjct: 125 PGKIDEKYIGVIMREILIALKYIHKDNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--N 182

Query: 472 TLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
                R T  GTP +MAPE ++   Y              +DIWS G   Y++T G+PPY
Sbjct: 183 QTKSRRQTMAGTPYWMAPEVIMEGVYYDTK----------ADIWSTGITAYEVTTGNPPY 232

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPC--GKKVPQSLVALIKTCLNRDPQLRATTDEIQH 589
                 + L A     +Q+   ++ P   G+     +   I TCL+ DP  R T DE+  
Sbjct: 233 CDV---EALRA-----MQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

Query: 590 CSFF 593
            +F 
Sbjct: 285 TAFI 288

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score =  109 bits (273), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 130/278 (46%), Gaps = 35/278 (12%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T   YA+K + L+  D +   D++REI+ L  L +   + +
Sbjct: 47  TEVIGRGKFGVVYKGYHLKTKHVYAIKVLNLDS-DSDEVEDVQREIQFLASLKQVPNITR 105

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRP--FDINFVRLMSKEMIECIKAVHDSD 439
                + D  + ++ME C    L  +L     RP   D  ++ ++ +E++  ++ +H  +
Sbjct: 106 YYGSYLQDTNLWIIMEYCAGGSLRTLL-----RPGMIDEKYIGVIMRELLTALQCIHKDN 160

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 161 VIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 218

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                         DIWS G   Y++  G+PPY        +  I             P 
Sbjct: 219 DTKV----------DIWSLGITAYEIATGNPPYCEIEALRAMQLIT---------KSKPA 259

Query: 559 ---GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              G++    L   I  CL+ DP+ R + +E+Q   F 
Sbjct: 260 RLEGRQYSSGLKEFIALCLDEDPKERLSAEELQKSKFI 297

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  108 bits (269), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 160/338 (47%), Gaps = 58/338 (17%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +  L    E  +  L  EI++ K + + + VV+ I
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQIHKSM-KHQNVVQFI 145

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + ++   IK +H   ++
Sbjct: 146 DCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE----VRFFTTQICGAIKYMHSRRVI 201

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F +   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++    
Sbjct: 202 HRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMGKHSGHS 259

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       DIWS G +LY +  G PP+ S     + +  +   I+     +P E  
Sbjct: 260 YEV---------DIWSIGVMLYALLIGKPPFQS-----KDVNTIYERIKCCDFSFPKE-- 303

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLI---------- 607
             K +      LI+  L+ DP  R +  EI    +F    I  P++ES +          
Sbjct: 304 --KHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRG--IFPPYIESTVMTEVPNYDKT 359

Query: 608 ----DNAINY-------GI--ENQNITQDRIKLLSNEV 632
               ++ IN+       G+  ++ NI +D + LL +EV
Sbjct: 360 LTHQESIINFRKCLEKSGLIEDSMNINKDPVSLLGSEV 397

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 139/277 (50%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T + YA+K + L+   + ++ D++RE++ L  L +   +++
Sbjct: 49  TEVIGRGKFGVVYKGYHVKTQQVYAIKVLNLDSESDEVE-DVQREVQFLSSLKQFPNIIR 107

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + ++M+ C    +  +L     RP  I+  ++ ++ +E++  ++ +H  +
Sbjct: 108 YFGSYLKDTNLWIIMDYCAGGSIRTLL-----RPGKIDEKYIGIIMREILIALQYIHKDN 162

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N   + R T  GTP +MAPE ++   Y 
Sbjct: 163 VIHRDIKAANVLVTNEGKVKLCDFGVAAQL--NQTKLRRQTMAGTPYWMAPEVIMEGAYY 220

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF--LGHDRLLAIMNPNIQIDYPNES 556
                        +DIWS G   Y++  G+PPY     L   +L+    P  +++     
Sbjct: 221 DTK----------ADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKP-ARLE----- 264

Query: 557 PCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             G+    SL   I  CL+ DP+ R + +E+Q   F 
Sbjct: 265 --GRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFI 299

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 131/274 (47%), Gaps = 24/274 (8%)

Query: 322 SIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI + +G+G    VYK  D+ TG+  A+K + LE  DE+++  + +EI  L  L +   +
Sbjct: 22  SIQDCVGRGNFGDVYKAIDKLTGEIVAIKVVNLESSDEDIEL-IAQEIFFLAEL-KSPYI 79

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I   ++D  + ++ME CG    S ++    N     + V  ++K ++  ++ +H+  
Sbjct: 80  TNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHEQR 139

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
            +H D+K AN +    G +KL DFG++ ++        RNT +GTP +MAPE + + ++ 
Sbjct: 140 KIHRDVKAANVLLTDDGLVKLADFGVSGQLRSTA---KRNTFVGTPYWMAPEIISNSSHG 196

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                      + +DIWS G  +Y++  G PPY+ +     +  I   N+Q        C
Sbjct: 197 Y---------NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQ-------DC 240

Query: 559 GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
                 +    I  CL +DP  R T  E+    F
Sbjct: 241 MVSFSDAAKLFISACLIKDPDERPTATELLQQPF 274

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 137/278 (49%), Gaps = 29/278 (10%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + R   +V+ I
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-RHFNIVQFI 142

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + +++  +K +H   ++
Sbjct: 143 DCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE----VRFFTTQIVGAVKYMHSRRVI 198

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 199 HRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLTGKHTGHS 256

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI-DYPNESPCG 559
                       DIWS G ++Y +  G PP+ +     + + I+   I+  DY    P  
Sbjct: 257 YEV---------DIWSCGVMIYALLIGKPPFQA-----KEVNIIYERIKCGDYV--FPRD 300

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMI 597
           K + Q  + LI+  L+ DP  R + DEI    +F  + 
Sbjct: 301 KCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIF 338

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 138/276 (50%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + +   +V+ I
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-KHPNIVQFI 140

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + +++  IK +H+  ++
Sbjct: 141 DCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPE----VRYFTTQIVGAIKYMHNRRVI 196

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F     LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 197 HRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLAGKHSGHS 254

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID---YPNESP 557
                       DIWS G ++Y +  G PP+ +     + + I+   I+     +P E P
Sbjct: 255 YEV---------DIWSIGVMIYALLIGKPPFQA-----KEVNIIYERIKSGDYIFPREKP 300

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             K+V    + LI+  L+ DP  R + DEI    +F
Sbjct: 301 TSKEV----MVLIQDILSIDPIERPSLDEIMDYVWF 332

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 136/276 (49%), Gaps = 31/276 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T + YA+K + L+  ++ ++ D++REI+ L  L +   + +
Sbjct: 19  TEVIGRGKFGIVYKGYHVKTKQVYAIKVLNLDSSEDEVE-DVQREIQFLASLKQIPNITR 77

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                +    + ++ME C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 78  YYGSYLRGTSLWIIMEYCAGGSLRSLL-----RPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++  N  ++ R T  GTP +MAPE ++   Y 
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEGVYY 190

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL-LAIMNPNIQIDYPNESP 557
                         DIWS G   Y++  G+PPY        + L I +   +++  N +P
Sbjct: 191 DTKV----------DIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTP 240

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
                   L   I  CL+ DPQ R + +E+    F 
Sbjct: 241 -------QLKEFIALCLDEDPQERLSAEELLKTKFI 269

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 135/277 (48%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    RT + +A+K + L+  DE+   D++RE++ L  + +   + +
Sbjct: 29  TEIIGRGKFGVVYKGYHSRTKQVFAIKVLNLDS-DEDEVEDVQREVQFLASMKQVPNITQ 87

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + +++E C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 88  YYGSYLKDTTLWIIIEYCAGGSLRTLL-----RPGKIDEKYIGVIMRELLIALKFIHRDN 142

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H DLK AN +    G +KL DFG+A ++  N  N  R+T  GTP +MAPE ++   Y 
Sbjct: 143 VIHRDLKAANVLITNDGQVKLCDFGVAAQL--NQSNSRRHTMAGTPYWMAPEVIMEGVYY 200

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                         DIWS G   Y+   G+PPY      + L A     +Q+   ++ P 
Sbjct: 201 DTKV----------DIWSLGITTYEAATGNPPYCEV---EALRA-----MQLITKSKPPR 242

Query: 559 --GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             G+     L   I  CL+ DP+ R + +E+    F 
Sbjct: 243 LEGRSYSPLLKEFIALCLDEDPKERLSAEELLKTKFI 279

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 139/288 (48%), Gaps = 43/288 (14%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D  GK +A K +    +  E  +  L  EI++ K + R   +V+ +
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-RHTNIVQFV 142

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + +++  +K +H   ++
Sbjct: 143 DCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE----VRFFTTQIVGAVKYMHSRRVI 198

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 199 HRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLTGKHTGHS 256

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGK 560
                       DIWS G ++Y +  G PP+ +     + + I+   I+        CG 
Sbjct: 257 YEV---------DIWSCGVMIYALLIGKPPFQA-----KEVNIIYERIK--------CGD 294

Query: 561 KV--------PQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISK 600
            V        P++LV LIK  L+ DP  R + DEI    +F  +  S+
Sbjct: 295 FVFPKDKFISPEALV-LIKDILSIDPLERPSLDEIIDYVWFRGLFPSR 341

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 133/268 (49%), Gaps = 29/268 (10%)

Query: 325 ELLGKGGSSKVYKV-QDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G    VYK    +T + YA+K + L+  ++ ++ D+ +EI+ L  L +   +   
Sbjct: 20  EIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDNTEDEVE-DIRKEIQFLSSLKQTPNITHY 78

Query: 384 I-EYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
              Y ID ++  ++  C    L  +L   +    +  ++ ++ +E++  + ++H  +++H
Sbjct: 79  YGSYLIDTKLWVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISIHRDNVIH 135

Query: 443 SDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K AN +    G++KL DFG+A +++ + L   R T  GTP +MAPE ++   Y    
Sbjct: 136 RDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIMEGVYYDTK 193

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC--G 559
                      DIWS G   Y++  G+PPY     H   +  M    Q+   ++ P   G
Sbjct: 194 V----------DIWSLGITAYEIATGNPPYC----HMEAIRAM----QMITKSKPPRLEG 235

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEI 587
           ++  Q L   I  CL+ DP+ R   +E+
Sbjct: 236 REYSQPLKEFIALCLDEDPKERPYAEEL 263

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 130/281 (46%), Gaps = 37/281 (13%)

Query: 323 IVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVV 381
           I E +GKG    VY+  D+ TG+  A+K I LEE  +++   L +EI  L  L R   V 
Sbjct: 38  IKECVGKGSFGDVYRAIDKETGEMVAVKIINLEETQDDIDV-LAQEIYFLSEL-RAPFVT 95

Query: 382 KLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
              +  ++D  + ++ME CG    + +L          N V  + +E++  ++ +H    
Sbjct: 96  TYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK 155

Query: 441 VHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H D+K AN +   +G +KL DFG++ +I      + RNT +GTP +MAPE +   N   
Sbjct: 156 IHRDVKAANILLTDEGEVKLGDFGVSGQI---MATLKRNTFVGTPYWMAPEIIARDN--- 209

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN------PNIQIDYP 553
                     + +DIWS G    ++  G PPY+ +   D +  +MN      P +Q    
Sbjct: 210 -------GYDEKADIWSLGITAMELLTGQPPYAKY---DPMKVLMNIPLRKPPRLQ---- 255

Query: 554 NESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
                  +   S    I  CL +DP LR T  ++    F N
Sbjct: 256 ------GRFTSSARDFIALCLTKDPALRPTASDLLSHKFLN 290

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 165/342 (48%), Gaps = 46/342 (13%)

Query: 257 NEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRI 316
           N+  ++I+KK      D LI+  N K+  KK +T    + P     PS     SK++ R 
Sbjct: 48  NDVVQVINKK------DNLIKQNNEKLNRKKEKTNLLCKTP-----PSVIKDNSKKYFR- 95

Query: 317 TDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELD-ENLKTDLEREIELLKRLA 375
                   E LG+GG ++ + ++D  G  +A K +  + +  E  K  L  EI++ + L 
Sbjct: 96  -------RECLGEGGFARCFHIKDDVGISFACKIVSKKSIKTERTKFKLLSEIQIHQNL- 147

Query: 376 REERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
           R   +VK ++   D+  V +L+E C N  L  +L +R  +      V+ M+ ++   I  
Sbjct: 148 RYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINY 205

Query: 435 VHDSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLI 493
           +H ++I+H DLK  N  F K   +K+ DFG+A  +++ +   Y  T  GTPNY+APE ++
Sbjct: 206 MHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKY--TMCGTPNYIAPEVIL 263

Query: 494 SQNYSXXXXXXXWKIGKP--SDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
           S+           +IG    +DIWS G ++Y M  G PP+ +     + +  +   I++ 
Sbjct: 264 SK-----------QIGHSFEADIWSLGIMIYAMVLGKPPFQA-----KDVTTIYEKIKL- 306

Query: 552 YPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              E P  K +   +  LI+  L  DP  R    +I   ++F
Sbjct: 307 CQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWF 348

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  103 bits (256), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 135/282 (47%), Gaps = 33/282 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + R   VV+ I
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-RHFNVVQFI 154

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  V  P     VR    ++   IK +H   ++
Sbjct: 155 DCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPE----VRYFMTQICGAIKYMHSRRVI 210

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++    
Sbjct: 211 HRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMGKHSGHS 268

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS---FLGHDRLLAIMNPNIQIDYPNESP 557
                       DIWS G ++Y +  G PP+ S    + ++R+      N    +P +  
Sbjct: 269 YEV---------DIWSIGVMIYALLIGKPPFQSKDVNMIYERI-----KNRDFAFPKD-- 312

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIIS 599
             K +      LI   L+ DP  R + +EI    +F  +  S
Sbjct: 313 --KYISNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPS 352

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 130/270 (48%), Gaps = 30/270 (11%)

Query: 322 SIVELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI E +G+G    VYK  D+T G   A+K + LE  +E++   L +EI  L  L R   +
Sbjct: 16  SIQECVGRGNFGDVYKAFDKTNGAIVAVKVVNLEHTEEDIDL-LAQEIFFLAEL-RSPYI 73

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I   I+D  + ++ME CG    S ++          N V  +++E+++ +K +HD  
Sbjct: 74  TNYITTMIEDVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYLHDQK 133

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
            +H D+K AN +   +G +KL DFG++ +I      + R T +GTP +MAPE +  ++  
Sbjct: 134 KIHRDIKAANILLTDEGKVKLGDFGVSGQIR---ATMKRGTFVGTPYWMAPEVVNKESNG 190

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP-NIQIDYPNESP 557
                      + +DIWS G  +Y++  G PP          L+  +P  + +  P   P
Sbjct: 191 ---------YNEKADIWSLGITVYELLKGLPP----------LSKCDPMKVMVSLPRRKP 231

Query: 558 CGKKVPQSLVA--LIKTCLNRDPQLRATTD 585
                  S VA   +  CL +DP LR + +
Sbjct: 232 PKLHGQYSDVAKGFVAACLVKDPNLRPSAE 261

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  102 bits (254), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 134/276 (48%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + R   +V+  
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-RHPNIVQFT 136

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + +++  IK +H   I+
Sbjct: 137 DCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE----VRFFTTQIVGAIKYMHSRRII 192

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 193 HRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TICGTPNYIAPEVLTGKHTGHS 250

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI---DYPNESP 557
                       D+WS G ++Y +  G PP+ +     + +  +   I++   ++P + P
Sbjct: 251 FEV---------DVWSIGVMIYALLIGKPPFQA-----KEVNTIYERIKVCDFNFPRDKP 296

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              +       LIK  L+ DP  R +  EI    +F
Sbjct: 297 ISSEAK----VLIKDILSLDPLERPSLTEIMEYVWF 328

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score =  102 bits (255), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 134/275 (48%), Gaps = 31/275 (11%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            +++GKG    VYK    ++ K +A+K +L  + D N   D++ EI+ L  L     +  
Sbjct: 9   TKVIGKGKFGTVYKGHSIKSKKVFAIK-VLNLDCDINEIQDIQNEIKFLSLLRYAPNITY 67

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
                + +R + ++ME C    + +++  ++ R F+  ++ ++ +E++  ++ +H  +I+
Sbjct: 68  YYHSYLINRKIWIIMEYCNGGSVRNLI--KIGR-FNEIYISVILRELLYALEYIHHDNII 124

Query: 442 HSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H D+K AN +  + G +KL DFGIA K+  +     R T  GTP +MAPE +I  +    
Sbjct: 125 HRDIKAANILINQNGGIKLCDFGIAAKLEFSKPK--RQTMAGTPYWMAPEVIIESSLYDT 182

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN---PNIQIDYPNESP 557
                      +DIWS G   Y++T G+PPY  +     +  I     P ++        
Sbjct: 183 K----------ADIWSVGITAYEITTGNPPYCEYDATKAMQLITKLKPPRLE-------- 224

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
            GK   +SL   I  CL+ DP  R T+ ++    F
Sbjct: 225 -GKMYSKSLKEFIALCLDEDPSERLTSTKLLETEF 258

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  102 bits (253), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 143/296 (48%), Gaps = 35/296 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +  L    E  +  L  EI++ K + + + +V+ I
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSM-KHQNIVQFI 208

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + ++   IK +H   ++
Sbjct: 209 DCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE----VRFFTTQICGAIKYMHSRRVI 264

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F +   LK+ DFG+A  +A++    +  T  GTPNY+APE L+ ++    
Sbjct: 265 HRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKF--TVCGTPNYIAPEVLMGKHSGHS 322

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       D+WS G ++Y +  G PP+ +     + +  +   I+     +P E P
Sbjct: 323 YEV---------DVWSIGVMVYALLVGKPPFQA-----KDVNTIYERIKCCDFIFPKEKP 368

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINY 613
               +      L++  L+ DP  R +  EI    +F    I  P+++S +   + Y
Sbjct: 369 ----ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRG--IFPPYIQSNVMTEVPY 418

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 109/211 (51%), Gaps = 17/211 (8%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  K  L  EI++ K + +   +V+ I
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSM-KHSNIVQFI 158

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHS 443
           +   DD  V +L+E C N  L  +L +R  +      VR  + ++   IK +H   I+H 
Sbjct: 159 DCFEDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKYLHSRRIIHR 216

Query: 444 DLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXX 502
           DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++      
Sbjct: 217 DLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMGKHSGHSFE 274

Query: 503 XXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                     DIWS G ++Y +  G PP+ +
Sbjct: 275 V---------DIWSIGVMIYALLVGKPPFQA 296

>CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa]
           {ON} similar to uniprot|P12688 Saccharomyces cerevisiae
           YKL126w or uniprot|P18961 Saccharomyces cerevisiae
           YMR104c ser/thr-specific protein kinases
          Length = 704

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 142/291 (48%), Gaps = 41/291 (14%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  ++ +LGKG   KV +V+ + T K YALK I    +    E + T  ER I     L
Sbjct: 375 DDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTI-----L 429

Query: 375 AREE--RVVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431
           AR E   +V L   ++  +++  VL      +L H  H +    FDI+  R  + E++  
Sbjct: 430 ARVECPFIVPLKFTFQTPEKLYLVLACINGGELFH--HLQREGIFDISRARFYASELLLA 487

Query: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAP 489
           + ++H  D+V+ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+AP
Sbjct: 488 LDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKT---STFCGTPEYLAP 544

Query: 490 ETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ 549
           E L+ + Y+           K  D W+ G +LY+M  G PPY     +D  ++ M   I 
Sbjct: 545 EVLLGKGYT-----------KVVDWWTLGVLLYEMLTGLPPY-----YDENVSEMYKKI- 587

Query: 550 IDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMI 597
           +  P   P G   P +   L+K  LNRDP  R      DEI++  FFN +I
Sbjct: 588 LKSPLIFPDGMD-PDA-KDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLI 636

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 138/300 (46%), Gaps = 42/300 (14%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++  D +GK +A K +  L    E  +  L  EI++ K + +   +V+ I
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQIHKSM-KNVNIVQFI 146

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + ++   IK +H   ++
Sbjct: 147 DCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE----VRFFTTQICGAIKYMHSRRVI 202

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++    
Sbjct: 203 HRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMGKHTGHS 260

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGK 560
                       DIWS G +LY +  G PP+ S             ++   Y     C  
Sbjct: 261 YEV---------DIWSIGVMLYALLIGKPPFQS------------KDVNTIYERIKCCDF 299

Query: 561 KVPQS------LVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLES-LIDNAINY 613
             P+          LI+  L+ DP  R + DEI    +F  +    P +ES ++ N  NY
Sbjct: 300 TFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLF--PPQIESDVMTNIPNY 357

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 133/276 (48%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + +   +V+  
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-KHPNIVQFT 136

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L +R  +  P     VR  + +++  IK +H   I+
Sbjct: 137 DCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE----VRFFTTQIVGAIKYMHSRRII 192

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 193 HRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TICGTPNYIAPEVLTGKHTGHS 250

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI---DYPNESP 557
                       DIWS G ++Y +  G PP+ +     + +  +   I++    +P + P
Sbjct: 251 FEV---------DIWSIGVMIYALLIGKPPFQA-----KEVNTIYERIKVCDFSFPKDKP 296

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              +       LIK  L+ DP  R +  EI    +F
Sbjct: 297 ISSEAK----VLIKDILSLDPLERPSLAEIMEYVWF 328

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 149/325 (45%), Gaps = 51/325 (15%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +  +    E  K  L  EI++ K + +   +V  +
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSM-KHPNIVHFV 155

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHS 443
           +   DD  V +L+E C N  L  ++ +R  +      VR  + ++   +K +H   ++H 
Sbjct: 156 DCFEDDTNVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVKYMHSRRVIHR 213

Query: 444 DLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXX 502
           DLK  N  F K   LK+ DFG+A  +A+N    Y  T  GTPNY+APE L+ ++      
Sbjct: 214 DLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKY--TVCGTPNYIAPEVLMGKHAGHSFE 271

Query: 503 XXXWKIGKPSDIWSYGCILYQMTYGHPPYSS---FLGHDRLLAIMNPNIQIDYPNESPCG 559
                     DIWS G ++Y +  G PP+ +    + +DR+ A      Q  YP +    
Sbjct: 272 V---------DIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKA-----CQYGYPKD---- 313

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQN 619
           K V      LI   L  DP                   + +P +  +ID+    GI    
Sbjct: 314 KYVSSEAKTLIADILCVDP-------------------VERPSIREIIDDVWFRGIFPPK 354

Query: 620 ITQDRIKLL---SNEVVSKLSTLNL 641
           IT+D ++L    +NE+  + S  N 
Sbjct: 355 ITEDVMELTPKDTNEITLEESFTNF 379

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 135/277 (48%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T +  A+K + L+  D+ ++ D+++EI+ L  L +   +  
Sbjct: 22  TEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVE-DVQKEIQFLSSLKQVPNITH 80

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                ++D  + V+ME C    L  +L     RP  I   ++ ++ +E++  +  +H   
Sbjct: 81  YYGSYLNDTKLWVIMEYCAGGSLRTLL-----RPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +    G +KL DFG+A +++     + R T  GTP +MAPE ++   Y 
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQT--KIRRQTMAGTPYWMAPEVIMEGVYY 193

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                         DIWS G   Y++  G+PPY      + L A     +Q+   ++ P 
Sbjct: 194 DTKV----------DIWSLGITAYEIATGNPPYCEV---EALRA-----MQLITKSKPPR 235

Query: 559 --GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             G++   +L  +I  CL+ DP+ R + +++    F 
Sbjct: 236 LEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFI 272

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 139/281 (49%), Gaps = 33/281 (11%)

Query: 314 SRITDEELSIVELLGKGGSSKVYKV-QDRTGKYYALKQILLEELDENLKTDLEREIELLK 372
           S +T +     E++G+G    VYK    +T + YA+K + L+  ++ ++ D+++E++ L 
Sbjct: 16  SALTPQAFRRTEIVGRGKFGVVYKAYHVKTKQVYAIKVLNLDCPEDEVE-DVQKEVQFLS 74

Query: 373 RLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMI 429
            L +   + +     + +  + V+ME C    L  +L     RP  I+  ++ ++ + ++
Sbjct: 75  SLKQVPNITQYYGSFLYETKLWVIMEYCAGGSLRTLL-----RPGKIDEKYLGVIVRNLL 129

Query: 430 ECIKAVHDSDIVHSDLKPANFIFVKGT-LKLIDFGIANKIADNTLNVYRNTQMGTPNYMA 488
             +  +H  +++H D+K AN +   G  +KL DFG+A ++   T N  R T  GTP +MA
Sbjct: 130 VALLYIHKDNVIHRDIKAANVLITNGGHVKLCDFGVAAQLT--TANHKRQTMAGTPYWMA 187

Query: 489 PETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF--LGHDRLLAIMNP 546
           PE ++   Y              +DIWS G   Y++  G+PPY     L   +L+    P
Sbjct: 188 PEVIMEGVYYNTK----------ADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKP 237

Query: 547 NIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
             +++  N SP  K+        I  CL+ DP+ R T +E+
Sbjct: 238 P-RLEGRNYSPLLKE-------FIALCLDEDPEARPTAEEL 270

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  100 bits (249), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 136/276 (49%), Gaps = 32/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D  GK +A K +    +  E  +  L  EI++ K + R + +V  I
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQIHKNM-RHQNIVHFI 161

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + ++   +  +H  +I+
Sbjct: 162 DCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE----VRFFTTQICGALDHMHSRNII 217

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  I  N  N  + T  GTPNY+APE ++       
Sbjct: 218 HRDLKLGNIFFDKDFNLKIGDFGLAAII--NNENERKYTICGTPNYIAPEVIMGGK---- 271

Query: 501 XXXXXWKIGKP--SDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES-P 557
                 +IG     DIWS G +++ M  G PP+ +      +  I +   +I + N S P
Sbjct: 272 ------QIGHSFEVDIWSLGVMIFAMITGKPPFQA----KEVSTIYD---RIKHCNYSFP 318

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             K V + +  LI+  L+ +P  R T  EI + ++F
Sbjct: 319 TDKYVSKDVKKLIQDILSMNPMERPTIQEILNYNWF 354

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score =  100 bits (249), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 135/272 (49%), Gaps = 35/272 (12%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G G    VYK    RT + YA+K + L+  DE+   D++RE++ L  + +   +  
Sbjct: 32  TEVIGTGKFGVVYKGHHARTKQVYAIKVLNLDS-DEDEVEDVQREVQFLASMKQTPNITH 90

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + +++E C    L  +L     RP  I+  ++ ++ +E++  +K +H  +
Sbjct: 91  YYGSYLKDTTLWIIIEYCAGGSLRTLL-----RPGKIDEKYIGIIMREVLIALKYIHKDN 145

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ-NY 497
           ++H D+K AN +   +G +KL DFG+A ++  ++L   R T  GTP +MAPE ++   +Y
Sbjct: 146 VIHRDIKAANVLITNEGHVKLCDFGVAAQLNQSSLK--RQTMAGTPYWMAPEVIMEGVSY 203

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP 557
                          DIWS G   Y++  G+PPY      + L A     +Q+   ++ P
Sbjct: 204 DTKV-----------DIWSLGITTYEIATGNPPYCDV---EALRA-----MQLITKSKPP 244

Query: 558 C--GKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              G+     L   I  CL+ DP+ R + D++
Sbjct: 245 RLEGRHYSPMLKEFIALCLDEDPKERLSADDL 276

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  100 bits (248), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +G  +A K +    +  E  +  L  EI++ K +A    +V+ I
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN-IVQFI 145

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  ++ P     VR  + ++   IK +H   ++
Sbjct: 146 DCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE----VRFFTTQICGAIKYMHSRRVI 201

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F     LK+ DFG+A  +A+ +   Y  T  GTPNY+APE L+ ++    
Sbjct: 202 HRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVLMGKHSGHS 259

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       DIWS G +LY +  G PP+ +     R +  +   I+     +P + P
Sbjct: 260 FEV---------DIWSLGVMLYALLIGKPPFQA-----RDVNTIYERIKCRDFSFPKDKP 305

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               +      LI+  L+ DP  R +  EI    +F
Sbjct: 306 ----ISDEGKILIRDILSLDPIERPSLTEIMDYVWF 337

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 99.8 bits (247), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +G+ +A K +    +  E  +  L  EI++ K +A    +V+ +
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMAHPN-IVQFV 145

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + ++   IK +H   ++
Sbjct: 146 DCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE----VRFFTTQICGAIKYMHSRRVI 201

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F     LK+ DFG+A  +A+ +   Y  T  GTPNY+APE L+ ++    
Sbjct: 202 HRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVLMGKHSGHS 259

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       DIWS G +LY +  G PP+ +     R +  +   I+     +P + P
Sbjct: 260 FEV---------DIWSLGVMLYALLIGKPPFQA-----RDVNTIYERIKCRDFSFPKDKP 305

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               +      LI+  L+ DP  R +  EI    +F
Sbjct: 306 ----ISDEGKILIRDILSLDPIERPSLTEIMDYVWF 337

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 133/272 (48%), Gaps = 25/272 (9%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + +   +V+ I
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSM-KHVNIVQFI 158

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHS 443
           +   DD  V +L+E C N  L  +L +R  +      VR  + ++   IK +H   ++H 
Sbjct: 159 DCFEDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKYMHSRKVIHR 216

Query: 444 DLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXX 502
           DLK  N  F  K  LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++      
Sbjct: 217 DLKLGNIFFDRKYNLKIGDFGLAATLANDRERKY--TVCGTPNYIAPEVLMGKHSGHSYE 274

Query: 503 XXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI-DYPNESPCGKK 561
                     DIWS G ++Y +  G PP+ S     + +  +   I+  D+    P  K 
Sbjct: 275 V---------DIWSIGVMIYALIIGRPPFQS-----KDVNTIYERIKCRDF--SFPKDKL 318

Query: 562 VPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           +      LI+  L+ DP  R + +EI    +F
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDYIWF 350

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 135/277 (48%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    RT +  A+K + L+  ++ ++ D+++EI+ L  L +   +  
Sbjct: 29  TEVIGRGKFGVVYKGYHIRTKQICAIKVLNLDTSEDEVE-DVQKEIQFLSSLKQVPNITH 87

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + ++ME C    L  +L     RP  I+  ++ ++ +E++  +  +H  +
Sbjct: 88  YYGSYLYDTKLWIIMEYCAGGSLRTLL-----RPGKIDEKYIGVIMRELLVALLYIHKDN 142

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +    G +KL DFG+A ++  +  NV R T  GTP +MAPE ++   Y 
Sbjct: 143 VIHRDIKAANVLITNDGRVKLCDFGVAAQLTQS--NVRRQTMAGTPYWMAPEVIMEGVYY 200

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                         DIWS G   Y++T G+PPY      + L A     +Q+   ++ P 
Sbjct: 201 DTKV----------DIWSLGITTYEITTGNPPYCDV---EALRA-----MQLITKSKPPR 242

Query: 559 --GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             G++    L   I  CL+ DP+ R   +++    F 
Sbjct: 243 LEGRQYSPLLKEFIALCLDEDPKERLAAEDLLKTRFI 279

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 99.0 bits (245), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +G+ +A K +    +  E  +  L  EI++ K ++    +V+ I
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN-IVQFI 145

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + ++   IK +H   ++
Sbjct: 146 DCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE----VRFFTTQICGAIKYMHSRRVI 201

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F     LK+ DFG+A  +A+ +   Y  T  GTPNY+APE L+ ++    
Sbjct: 202 HRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVLMGKHSGHS 259

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       DIWS G +LY +  G PP+ +     R +  +   I+     +P + P
Sbjct: 260 FEV---------DIWSLGVMLYALLIGKPPFQA-----RDVNTIYERIKCRDFSFPKDKP 305

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               +      LI+  L+ DP  R +  EI    +F
Sbjct: 306 ----ISDEGKILIRDILSLDPIERPSLTEIMDYVWF 337

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 140/298 (46%), Gaps = 40/298 (13%)

Query: 306 ANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDL 364
           A +M+++ SR+ +    I E +GKG    V++   R TG+  A+K I LEE  +++   L
Sbjct: 28  AVVMNEKPSRLYE----IKECVGKGSFGDVFRATHRQTGEVVAIKIINLEETQDDIDV-L 82

Query: 365 EREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRL 423
            +EI  L  L R   V    +  ++D  + ++ME CG    + +L          N V  
Sbjct: 83  AQEIYFLSEL-RAPFVTTYFKTFVEDVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAY 141

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMG 482
           + +E++  +  +H    +H D+K AN +    G +KL DFG++ +I      + R T +G
Sbjct: 142 IIREVLFGLDYLHSQKKIHRDIKAANILLTDDGEVKLGDFGVSGQI---MATLKRTTFVG 198

Query: 483 TPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLA 542
           TP +MAPE +  ++             + +DIWS G    ++  G PPY+    HD +  
Sbjct: 199 TPYWMAPEIIAKKDNG---------YNEKADIWSLGITAIELLTGQPPYAK---HDPMKV 246

Query: 543 IMN------PNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
           ++N      P +Q  +   +       +  +AL   CL +DP LR +  E+    F N
Sbjct: 247 LVNIPLRKPPKLQGRFTGSA-------RDFIAL---CLIKDPDLRPSAAELLGHKFLN 294

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 99.0 bits (245), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 131/276 (47%), Gaps = 33/276 (11%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +G+ +A K +    +  E  +  L  EI++ K ++    +V+ I
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPN-IVQFI 145

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  L  +L  R  +  P     VR  + ++   IK +H   ++
Sbjct: 146 DCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE----VRFFTTQICGAIKYMHSRRVI 201

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F     LK+ DFG+A  +A+ +   Y  T  GTPNY+APE L+ ++    
Sbjct: 202 HRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVLMGKHSGHS 259

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ---IDYPNESP 557
                       DIWS G +LY +  G PP+ +     R +  +   I+     +P + P
Sbjct: 260 FEV---------DIWSLGVMLYALLIGKPPFQA-----RDVNTIYERIKCRDFSFPRDKP 305

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               +      LI+  L+ DP  R +  EI    +F
Sbjct: 306 ----ISDEGKILIRDILSLDPIERPSLTEIMDYVWF 337

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 137/276 (49%), Gaps = 33/276 (11%)

Query: 324 VELLGKGGSSKVYKV-QDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T + YA+K + L+  ++ ++ D+++EI+ L  L +   + +
Sbjct: 28  TEVIGRGKFGVVYKAYHAKTKQVYAVKVLNLDCPEDEVE-DVQKEIQFLASLKQVPNITR 86

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                + D  + V+ME C    L  +L     RP  I+  ++ ++ ++++  +  +H  +
Sbjct: 87  YYGSYLYDTKLWVIMEYCAGGSLRTLL-----RPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   +G +KL DFG+A ++     N  R T  GTP +MAPE ++   Y 
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVYY 199

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF--LGHDRLLAIMNPNIQIDYPNES 556
                        +DIWS G   Y++  G+PPY     L   +L+    P  +++  N S
Sbjct: 200 NTK----------ADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPP-RLEGRNYS 248

Query: 557 PCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
           P  K+        I  CL+ DP+ R T +++    F
Sbjct: 249 PLLKE-------FIALCLDEDPEERPTAEDLLSSKF 277

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 109/211 (51%), Gaps = 17/211 (8%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D +GK +A K +  L    E  +  L  EI++ K + R   +V+ I
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKTEKTRKKLLSEIQIHKSM-RHANIVQFI 164

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHS 443
           +   D+  V +L+E C N  L  +L +R  +      VR  + ++   IK +H   ++H 
Sbjct: 165 DCFEDETNVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKYMHSRRVIHR 222

Query: 444 DLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXX 502
           DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++      
Sbjct: 223 DLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLMGKHSGHSYE 280

Query: 503 XXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                     DIWS G ++Y +  G PP+ +
Sbjct: 281 V---------DIWSIGVMIYALLIGKPPFQA 302

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/306 (28%), Positives = 151/306 (49%), Gaps = 37/306 (12%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+GGS+ VY   +  T    A+KQI LE+  +  K  +  EI ++K+ ++   +V  I+
Sbjct: 619 IGRGGSALVYTAYEVGTNLSVAIKQINLEK--QPRKQLILNEIIVMKK-SQHPNIVNFID 675

Query: 386 -YKIDDRMVQVL--MECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
            Y +D ++  ++  ME G+  L+ V+   + R   I  V    +E+++ +  +H   ++H
Sbjct: 676 SYLVDGKLWVIMEYMEAGS--LTDVVTRCILREGQIGAV---CREVLKGLVFLHSKGVIH 730

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  + G +KL DFG   ++ D  +++ RNT +GTP +MAPE +  ++Y    
Sbjct: 731 RDIKSDNVLLSMDGDIKLTDFGFCAQLND--IHLKRNTMVGTPYWMAPEIVEKKHYCPKV 788

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGK- 560
                      DIWS G ++ +M  G PPY   L    L A+      +   N +P  K 
Sbjct: 789 -----------DIWSLGVMIIEMIEGEPPY---LNEPPLRALY-----LIATNGTPKLKD 829

Query: 561 --KVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQ 618
             K+ ++L   I  CL  DP+LR T  E+ +  F   +      L  L+  A    +E +
Sbjct: 830 PEKLSETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKSLSHLVKLAYLQKLEEK 889

Query: 619 NITQDR 624
           N  QD+
Sbjct: 890 NGAQDQ 895

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 127/272 (46%), Gaps = 32/272 (11%)

Query: 323 IVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVV 381
           + E +GKG    VYK  D+ TG   A+K + LEE D+ +   L +EI  L  L     + 
Sbjct: 36  VQECVGKGNFGDVYKAIDKSTGNTVAIKVVNLEETDDEIDL-LAQEIYFLAEL-HSPYIT 93

Query: 382 KLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                 ++D  + ++ME CG    S +L            V  +++E++  ++ +H    
Sbjct: 94  NYFSTFVEDVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK 153

Query: 441 VHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLI--SQNY 497
           +H D+K AN +    G +KL DFG++ ++        R+T +GTP +MAPE +    Q Y
Sbjct: 154 IHRDIKAANILLTDDGKVKLGDFGVSGQMMATR---RRDTFVGTPFWMAPEVIARSEQGY 210

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP 557
           +           + +DIWS G  ++++  G PP S    HD +  +M+       P+  P
Sbjct: 211 N-----------EKADIWSLGITVFELLKGQPPLSQ---HDPMKVLMS------IPSRRP 250

Query: 558 --CGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
                +   ++   +  CLN+DP  R T  E+
Sbjct: 251 PKLEDRYSHAIREFVSLCLNKDPAKRPTASEL 282

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 130/274 (47%), Gaps = 27/274 (9%)

Query: 325 ELLGKGGSSKVYKVQDRTGKYYALKQILLEELD-ENLKTDLEREIELLKRLAREERVVKL 383
           + LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K + + + +V+ 
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQIHKSM-KHQNIVQF 204

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDI 440
           ++   D   V +L+  C N  L  +L +R  +  P     VR  + ++   IK +H   +
Sbjct: 205 VDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE----VRFFTVQICGAIKYMHSRRV 260

Query: 441 VHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H DLK  N  F +   LK+ DFG+A  +A++    Y  T  GTPNY+APE L+ ++   
Sbjct: 261 IHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIAPEVLLGKHSGH 318

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCG 559
                        DIWS G +++ +  G PP+ +   +     I N           P  
Sbjct: 319 SYEV---------DIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTF------PIN 363

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           K + Q    LI+  L  DP  R + +EI    +F
Sbjct: 364 KSISQEAKTLIQDILINDPIARPSINEIMEYVWF 397

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 134/277 (48%), Gaps = 33/277 (11%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
            E++G+G    VYK    +T +  A+K + L+  D+ ++ D+++E++ L  L +   +  
Sbjct: 22  TEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADDEVE-DVQKEVQFLSSLKQVPNITH 80

Query: 383 LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIKAVHDSD 439
                +++  + V+ME C    L  +L     RP  I   ++ ++ +E++  +  +H   
Sbjct: 81  YYGSYLNNTELWVIMEYCAGGSLRTLL-----RPGKIGEQYIGVIMRELLIALMHIHKDG 135

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +    G +KL DFG+A +++     + R T  GTP +MAPE ++   Y 
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQT--KIRRQTMAGTPYWMAPEVIMEGVYY 193

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                         DIWS G   Y++  G+PPY      + L A     +Q+   ++ P 
Sbjct: 194 DTKV----------DIWSLGITAYEIATGNPPYCDV---EALRA-----MQLITKSKPPR 235

Query: 559 --GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             G++   +L   I  CL+ DP+ R + +E+    F 
Sbjct: 236 LEGRQHSSALKEFIALCLDEDPKERPSAEELLKTKFI 272

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 87/299 (29%), Positives = 144/299 (48%), Gaps = 47/299 (15%)

Query: 305  QANLMS-KQWSRITDEELSIVELLGKGGSSKV-YKVQDRTGKYYALKQILLEEL------ 356
            +AN+ S K+  + +D   +I++++G+G   KV   + +R      +K I  E +      
Sbjct: 826  EANIGSQKRIKKFSD--FTILQVMGEGAYGKVNLCIHNREHYIVVIKMIFKERILVDTWV 883

Query: 357  -DENLKTDLEREIELLKRLAR--EERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLH 409
             D  L T +  EI+++  L +  +E ++KL+++  DD        V  E G+ DL  V+ 
Sbjct: 884  RDRKLGT-IPSEIQIMATLNKNSQENILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIE 942

Query: 410  ERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKI 468
             +  +    +  +L+ K+++  IK +HD  IVH D+K  N I    G +KLIDFG A  I
Sbjct: 943  FK--KDMVEHEAKLVFKQVVASIKHLHDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYI 1000

Query: 469  ADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGH 528
                 +V+    +GT +Y APE L   +Y           GKP DIW+ G +LY + Y  
Sbjct: 1001 KSGPFDVF----VGTMDYAAPEVLGGSSYK----------GKPQDIWALGVLLYTIIYKE 1046

Query: 529  PPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
             PY +      +  I+   ++ D        + V +  ++LIK  L R+   R T DEI
Sbjct: 1047 NPYYN------IDEILEGELRFDK------SEHVSEECISLIKRILTREVDKRPTIDEI 1093

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 138/285 (48%), Gaps = 46/285 (16%)

Query: 319  EELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIEL 370
            ++  I++ +G+G   KV     +  KY  + +++ +E         D  L T +  EI++
Sbjct: 1119 QDFIILQKMGEGAYGKVNLCMHKMKKYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQI 1177

Query: 371  LKRLARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRL 423
            +  L ++  E +++L+++  DD        V  E G+ DL  ++    N   F+I   +L
Sbjct: 1178 MATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSNMTEFEI---KL 1234

Query: 424  MSKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMG 482
            + K+++  +K +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +G
Sbjct: 1235 LFKQVVSGVKHLHDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVKSGPFDVF----VG 1290

Query: 483  TPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLA 542
            T +Y APE L    Y           GKP DIW+ G +LY + +   P+ +      +  
Sbjct: 1291 TIDYAAPEVLGGNPYE----------GKPQDIWALGILLYTIVFKENPFYN------IDE 1334

Query: 543  IMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            I+  +++ + P      + + Q  + LIK  LNR+   R T D+I
Sbjct: 1335 ILEGDLKFNDP------ENISQDCIELIKLILNRNVFKRPTIDDI 1373

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 140/287 (48%), Gaps = 46/287 (16%)

Query: 323  IVELLGKGGSSKVYKVQDRTGKY-YALKQILLEEL-------DENLKTDLEREIELLKRL 374
            +++ +G+G   KV     +  KY   +K+I  E +       D  L T +  EI+++  L
Sbjct: 971  VLQKMGEGAYGKVDLCMHKKDKYIVVIKRIYKERILVDTWVRDRTLGT-IPSEIQIMVTL 1029

Query: 375  ARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLMSKE 427
             R+  E +++++++  DD       ++  E G+ DL  ++  + N   F+    +L+ K+
Sbjct: 1030 NRKPHENILRILDFFEDDDYYYLETEMHGETGSIDLFDLIELKTNMTEFE---AKLLFKQ 1086

Query: 428  MIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNY 486
            +   IK +HD+ IVH D+K  N I   KG +KLIDFG A  +     +V+    +GT +Y
Sbjct: 1087 VASGIKHLHDNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVF----VGTIDY 1142

Query: 487  MAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP 546
             APE L  + Y           GKP DIW+ G +LY + Y   P+ +      +  I++ 
Sbjct: 1143 AAPEVLGGEPYE----------GKPQDIWAIGVLLYTIIYKENPFYN------IDEILDG 1186

Query: 547  NIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            +++I   +E      V    VALI+  LNR    R T D+I   S+ 
Sbjct: 1187 DLRIQSTHE------VSAECVALIRKILNRSVSKRPTIDDIMEDSWL 1227

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 139/305 (45%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGAYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV----NRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R      R  ++N V+    +++E +   H++
Sbjct: 68  LYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEGLAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN--------- 545
           + YS              DIWS GCIL +M  G P +      ++L  I           
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGSNDEEQLKLIFETMGTPTEAT 232

Query: 546 -------PNIQIDYPNESP----------CGKKVPQSLVALIKTCLNRDPQLRATTDEIQ 588
                  P    ++P   P          C + +  +++ L+   L  +P +R +  +  
Sbjct: 233 WPGVSALPKYNPNFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLNPDMRLSAKQAL 292

Query: 589 HCSFF 593
           H  +F
Sbjct: 293 HHPWF 297

>KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} similar
           to uniprot|P12688 Saccharomyces cerevisiae YKL126W YPK1
           and similar to uniprot|P18961 Saccharomyces cerevisiae
           YMR104C YPK2 serine/threonine protein kinase
          Length = 716

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 169/379 (44%), Gaps = 71/379 (18%)

Query: 253 MPTANEQAKLISKKLVSERVDYLIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQAN--LMS 310
           +P+ N Q   IS        + ++ DY  KI+N     +     P+   + S +N  L +
Sbjct: 298 LPSQNWQETQISN-------NDILGDYVKKIRNNSDIHLDSFHLPLNLKIDSASNIRLYN 350

Query: 311 KQW---------------------SRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYAL 348
             W                       ++ ++  +++++GKG   KV +V+ R T K YAL
Sbjct: 351 HHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGSFGKVMQVRKRDTNKIYAL 410

Query: 349 KQI---LLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLS 405
           K I    +    E   T  ER +  L R+     V     ++  +++  VL      +L 
Sbjct: 411 KAIRKSYIVSKSEVTHTLAERTV--LARVDNPFIVPLKFSFQSSEKLYLVLAFINGGELF 468

Query: 406 HVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGI 464
           + L +R  R FD++  R  + E++  ++A+HD DI++ DLKP N +   +G + L DFG+
Sbjct: 469 YHL-QREGR-FDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDYQGHIALCDFGL 526

Query: 465 ANKIADNTLNVYRNTQM-GTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQ 523
                 N  +  + T   GTP Y+APE L+ Q Y+           K  D W+ G +LY+
Sbjct: 527 CKL---NMKDQEKTTTFCGTPEYLAPELLLGQGYT-----------KVVDWWTLGVLLYE 572

Query: 524 MTYGHPPYSSFLGHDRLLAIMNPNIQID---YPNESPCGKKVPQSLVALIKTCLNRDPQL 580
           M  G PPY     +D  +  M   I  D   +P++    K     L+ L+  C  RDP+ 
Sbjct: 573 MLTGLPPY-----YDEDVPKMYKKILQDPLRFPDD--FDKDAKDLLIGLL--C--RDPKR 621

Query: 581 RA---TTDEIQHCSFFNPM 596
           R     +DEI+   FFN +
Sbjct: 622 RLGYHGSDEIKSHPFFNQL 640

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 93.2 bits (230), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 140/305 (45%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G++ ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGEFVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R   N P   +++ V+    +++E +   H++
Sbjct: 68  LYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEGLAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LK+ DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN--------- 545
           + YS              DIWS GCIL +M  G P +      ++L  I           
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGTNEEEQLKLIFETMGTPNEQS 232

Query: 546 -------PNIQIDYPNESP----------CGKKVPQSLVALIKTCLNRDPQLRATTDEIQ 588
                  P     +P   P          C   +  +L+AL+   L  +P +R +  +  
Sbjct: 233 WPGISSLPKYNPGFPQHLPKNLKSILQAHCASDLDDTLIALLHGLLQLNPDMRLSAKQAL 292

Query: 589 HCSFF 593
           H  +F
Sbjct: 293 HHPWF 297

>Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W
           (YPK1) - 76.5 kDa Serine/threonine protein kinase with
           similarity to protein kinase C, is 90% identical to
           Ypk2p [contig 55] FULL
          Length = 691

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 148/305 (48%), Gaps = 49/305 (16%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E + T  ER +     L
Sbjct: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV-----L 410

Query: 375 AREER--VVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431
           AR E   +V L   ++  D++  VL      +L + L +R  R F ++  RL + E++  
Sbjct: 411 ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL-QREGR-FSLSRARLYTAELLCA 468

Query: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYM 487
           ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     NT  GTP Y+
Sbjct: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT-----NTFCGTPEYL 523

Query: 488 APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
           APE L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   
Sbjct: 524 APELLLGQGYS-----------KVVDWWTLGVLLYEMMTGLPPY-----YDEDVPKMYKK 567

Query: 548 IQIDYPNESPCG--KKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPF 602
           I +  P   P G  K     L+ L    L+RDP+ R      DEI+   FF+ +   + +
Sbjct: 568 I-LQEPLRFPDGFDKDAKDLLIGL----LSRDPKRRLGFNGADEIKSHPFFSQLSWKRLW 622

Query: 603 LESLI 607
           ++  I
Sbjct: 623 MKGYI 627

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 95.9 bits (237), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 132/298 (44%), Gaps = 57/298 (19%)

Query: 317 TDEELSIVELLGKGGSSKVYKVQDR-TGKYYALK--------------QILLEELDENLK 361
           T ++ S  E LG G  S VYK  DR TG+ +A+K               + +E+   NL 
Sbjct: 6   TPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNTLNLL 65

Query: 362 TDLERE--IELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDIN 419
                   I+L       E +  ++++     ++Q+L   G F+ +   H          
Sbjct: 66  AHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMC------- 118

Query: 420 FVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRN 478
                  ++I+ ++ +H   +VH DLKP N +   +G L + DFG+A+ +A        +
Sbjct: 119 -------QLIDALEYIHGCKVVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTS 171

Query: 479 TQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHD 538
           + +GT  Y++PE L+ QN S             SDIW+ GC+LYQ T G PP   F G +
Sbjct: 172 SFVGTAEYVSPELLL-QNKSNFC----------SDIWAVGCMLYQFTQGTPP---FRGEN 217

Query: 539 RLLA---IMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            L A   I+N +    Y         V Q +  L+   L  DP  R T  +I++ ++F
Sbjct: 218 ELAAFEKIVNLDYHWIY--------MVSQHITDLVSKILVLDPDSRYTLPQIKNHAWF 267

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 144/305 (47%), Gaps = 43/305 (14%)

Query: 300  QSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVY-KVQDRTGKYYALKQILLEELD- 357
            QS+ S  + +S +W +           +G G    V+  V   TG+  A+K+I +++ + 
Sbjct: 1220 QSLASSLSNVSIRWQK--------RHFIGGGAFGTVFSAVNLDTGEILAVKEIKIQDRNT 1271

Query: 358  -ENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNR 414
             + +   ++ E+ +L+ L     VV+    ++    V + ME C    L+ +L H R+  
Sbjct: 1272 MKQVFPAIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIE- 1329

Query: 415  PFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTL 473
              D    ++ + +M+E +  +H S +VH D+KP N +    G +K +DFG A  +A N  
Sbjct: 1330 --DEMVTQVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGT 1387

Query: 474  NVYRN----------TQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQ 523
             V  N          + MGTP YM+PE++              K G  SDIWS GC++ +
Sbjct: 1388 KVANNGSEGKTDGVNSMMGTPMYMSPESVTGAKKG--------KFGS-SDIWSLGCVILE 1438

Query: 524  MTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKV-PQSLVALIKTCLNRDPQLRA 582
            M  G  P+ +    D   AIM  ++   +  + P   ++ PQ    L+K CL +DP  RA
Sbjct: 1439 MATGRRPWFNL---DNEWAIMY-HVAAGHVPQLPSRDEISPQGTDFLLK-CLKQDPDKRA 1493

Query: 583  TTDEI 587
            T  E+
Sbjct: 1494 TAMEL 1498

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 158/334 (47%), Gaps = 47/334 (14%)

Query: 276  IRDYNSKIQNKKHQTIPKI------EAPVPQSVPSQANLMSKQWSRITDEELSIVELLGK 329
            I D    ++ K+H ++ K+      ++ + +S+ S  + +S +W + +         +G 
Sbjct: 1216 ITDMEKVVKVKRHYSVGKVIDDTDNQSKLLKSLASSISNLSIRWQKRS--------FIGS 1267

Query: 330  GGSSKVYK-VQDRTGKYYALKQILLEELD--ENLKTDLEREIELLKRLAREERVVKLIEY 386
            G    VY  V   TG   A+K+I +++    + +   L+ E+ +++ L     +V+    
Sbjct: 1268 GSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQYYGV 1326

Query: 387  KIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
            ++    V + ME C    L+ +L H R+    D    ++ + +++E +  +H S +VH D
Sbjct: 1327 EVHRDKVNIFMEFCEGSSLASLLEHGRIE---DEMVTQVYTLQLLEGLACLHQSGVVHRD 1383

Query: 445  LKPANFIFVK-GTLKLIDFGIANKIADNT---LNVYRNTQ-------MGTPNYMAPETLI 493
            +KP N +  + G +K +DFG A  IA N    +++  N +       +GTP YMAPET+ 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 494  SQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYP 553
             Q +         K G   DIWS GC++ +M  G  P+++    D   AIM  ++   + 
Sbjct: 1444 GQGHG--------KFGS-DDIWSLGCVVLEMVTGRRPWANL---DNEWAIMY-HVAAGHL 1490

Query: 554  NESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
             + P   ++  +    I  CL +D   RAT  E+
Sbjct: 1491 PQFPTKSEISSAGRKFISRCLIQDANKRATAMEL 1524

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/252 (31%), Positives = 127/252 (50%), Gaps = 31/252 (12%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV----NRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R      R  ++N V+    ++++ +   H+S
Sbjct: 68  LYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHES 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPN 554
           + YS              DIWS GCIL +M  G P +      ++L  I +    +  PN
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD---IMGTPN 229

Query: 555 ES--PCGKKVPQ 564
           ES  P   K+P+
Sbjct: 230 ESLWPGVTKLPK 241

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 108/213 (50%), Gaps = 21/213 (9%)

Query: 326 LLGKGGSSKVYKVQDRTGKYYALKQIL-LEELDENLKTDLEREIELLKRLAREERVVKLI 384
            LG+GG ++ ++++D  GK +A K +  L    E  +  L  EI++ K + +   +V+  
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSM-KHPNIVQFT 153

Query: 385 EYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +   DD  V +L+E C N  +  +L +R  +  P     VR    ++I  I+ +H   ++
Sbjct: 154 DCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPE----VRFCMIQIIGAIRYMHSRRVI 209

Query: 442 HSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H DLK  N  F K   LK+ DFG+A  +A++    Y  T  GTPNY+APE L  ++    
Sbjct: 210 HRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKY--TICGTPNYIAPEVLTGKHTGHS 267

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                       DIWS G +LY + +G PP+ +
Sbjct: 268 YEV---------DIWSIGVMLYALLFGKPPFQA 291

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 134/274 (48%), Gaps = 30/274 (10%)

Query: 327 LGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G    VYK V+ ++GK  A+K + LE  +E+++  L +EI  L  L R   V K + 
Sbjct: 21  VGRGNFGDVYKAVEIKSGKIVAIKVVNLEHTNEDIEL-LSQEIFFLAEL-RSPYVTKYLT 78

Query: 386 YKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
             ++D  + ++ME CG    + ++     R    N    ++KE+++ ++ +H+   +H D
Sbjct: 79  TLLEDVSIWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLHEQKKIHRD 138

Query: 445 LKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXX 503
           +K AN +    G +KL DFG++ +I      + ++T +GTP +MAPE ++ ++ S     
Sbjct: 139 IKAANILLTDDGMVKLGDFGVSGQIK---ATLKKDTFVGTPYWMAPE-VVKKDES----- 189

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI---MNPNIQIDYPNESPCGK 560
                 + +DIWS G  +Y++  G PP + +     ++++     P +   Y  ++    
Sbjct: 190 ---GYNEKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAK--- 243

Query: 561 KVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
                  + I  CL +DP  R     +    F N
Sbjct: 244 -------SFISHCLIKDPNARPNAKTLSKFPFVN 270

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 143/305 (46%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + + VV+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHDNVVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R   N P   ++N V+    +++E     H++
Sbjct: 68  LYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN--------- 545
           + YS              D+WS GCIL +M  G P +      ++L  I +         
Sbjct: 184 RTYSTSI-----------DMWSCGCILAEMVTGKPLFPGTNDEEQLKLIFDIMGTPNEST 232

Query: 546 -------PNIQIDYPNESP---------CGKK-VPQSLVALIKTCLNRDPQLRATTDEIQ 588
                  P   +++P + P         C K+ +  +L+ L+   L  +P +R +  +  
Sbjct: 233 WPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHGLLQLNPDMRLSAKQAL 292

Query: 589 HCSFF 593
           H  +F
Sbjct: 293 HHPWF 297

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 133/274 (48%), Gaps = 27/274 (9%)

Query: 325 ELLGKGGSSKVYKVQDRTGKYYALKQILLEEL-DENLKTDLEREIELLKRLAREERVVKL 383
           + LG+GG ++ ++++D +GK +A K +    +  E  +  L  EI++ K ++    +V+ 
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHTN-IVQF 143

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHER--VNRPFDINFVRLMSKEMIECIKAVHDSDI 440
           I+   D+  V +L+E C N  L  ++ +R  +  P     VR    ++   I+ +H + +
Sbjct: 144 IDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPE----VRFFMTQICGGIQYMHSNRV 199

Query: 441 VHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H DLK  N  F +   LK+ DFG+A  +A++    +  T  GTPNY+APE L+ ++   
Sbjct: 200 IHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPNYIAPEVLMGKHSGH 257

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCG 559
                        DIWS G +LY +  G PP+ +   +     I   N    YP +    
Sbjct: 258 SYEV---------DIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFA--YPKD---- 302

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           KK+ Q    LI   L+ +P  R +  EI    +F
Sbjct: 303 KKISQDAKYLIDDILSLNPMERPSIQEIMDYVWF 336

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 152/323 (47%), Gaps = 52/323 (16%)

Query: 281  SKIQNKKHQTIPKIEAPVPQ-SVPSQANLMSKQWSRITDEELSIVELLGKGGSSKV-YKV 338
            + + +KKH  +       P+ ++ SQ     K+  R +D   +I++++G+G   KV   +
Sbjct: 807  TNVLDKKHPGLKATYLITPEINIGSQ-----KRIKRFSD--FTILQVMGEGAYGKVNLCI 859

Query: 339  QDRTGKYYALKQILLEEL-------DENLKTDLEREIELLKRLAR--EERVVKLIEYKID 389
             ++      +K I  E +       D  L T +  EI+++  L +  ++ ++KL+++  D
Sbjct: 860  HNKMHYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKNSQKNILKLLDFFED 918

Query: 390  DRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDL 445
            D        V  E G+ DL  V+  +  +    +  +L+ K+++  IK +H+  IVH D+
Sbjct: 919  DDYYYIETPVHGETGSIDLFDVIEFK--KDMVEHEAKLVFKQVVASIKHLHNQGIVHRDI 976

Query: 446  KPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXX 504
            K  N I    G +KLIDFG A  +     +V+    +GT +Y APE L   +Y       
Sbjct: 977  KDENVIVDSHGFVKLIDFGSAAYVKSGPFDVF----VGTMDYAAPEVLGGSSYK------ 1026

Query: 505  XWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQ 564
                GKP DIW+ G +LY + Y   PY +      +  I+   ++ D        +KV +
Sbjct: 1027 ----GKPQDIWALGVLLYTIIYKENPYYN------IDEILEGELRFDK------AEKVSE 1070

Query: 565  SLVALIKTCLNRDPQLRATTDEI 587
              + LIK  L R+   R T DEI
Sbjct: 1071 GCIGLIKRILTREVDKRPTIDEI 1093

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 143/299 (47%), Gaps = 47/299 (15%)

Query: 305  QANLMS-KQWSRITDEELSIVELLGKGGSSKV-YKVQDRTGKYYALKQILLEEL------ 356
            +AN+ S K+  + +D   ++++++G+G   KV   + ++      +K I  E +      
Sbjct: 826  EANIGSQKRIKKFSD--FTVLQVMGEGAYGKVNLCIHNKEHYIVVIKMIFKERILVDTWV 883

Query: 357  -DENLKTDLEREIELLKRLAR--EERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLH 409
             D  L T +  EI+++  L +  +E ++KL+++  DD        V  E G+ DL  V+ 
Sbjct: 884  RDRKLGT-IPSEIQIMATLNKNSQENILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIE 942

Query: 410  ERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKI 468
             +  +    +  +L+ K+++  IK +H   IVH D+K  N I    G +KLIDFG A  I
Sbjct: 943  FK--KDMVEHEAKLVFKQVVASIKHLHGQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYI 1000

Query: 469  ADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGH 528
                 +V+    +GT +Y APE L   +Y           GKP DIW+ G +LY + Y  
Sbjct: 1001 KSGPFDVF----VGTMDYAAPEVLGGSSYK----------GKPQDIWALGVLLYTIIYKE 1046

Query: 529  PPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
             PY +      +  I+   ++ D        +KV +  + LIK  L R+   R T DEI
Sbjct: 1047 NPYYN------IDEILEGELRFDK------SEKVSEECIGLIKRILTREVDKRPTIDEI 1093

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/275 (28%), Positives = 134/275 (48%), Gaps = 32/275 (11%)

Query: 325 ELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E +G+G    VY+  DRT  K  A+K + LE  +E L+  L +EI  L  L +   ++  
Sbjct: 26  ECVGRGNFGDVYRAIDRTTNKVVAIKVVDLENTNERLEV-LAQEIFFLAEL-KSPYIINY 83

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
           I   ++D  + ++ME CG    S +L    N       V  +++E+++ ++ +H+   +H
Sbjct: 84  ITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIH 143

Query: 443 SDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K AN +   +G +KL DFG++ ++      + R T +GTP +MAPE + SQN     
Sbjct: 144 RDIKAANILLTEEGHVKLGDFGVSGQLKS---TLRRGTIVGTPYWMAPE-VASQNIEGYD 199

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN----PNIQIDYPNESP 557
                      DIWS G  ++++  G PP    L   R+LA ++    P +Q  Y + + 
Sbjct: 200 EKI--------DIWSLGITVFELLKGVPPLVK-LDPIRVLANLSRKSAPRLQGAYSDAA- 249

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
                 +S VAL   CL ++P  R    ++    F
Sbjct: 250 ------KSFVAL---CLIKNPNERPAAVDLLKFPF 275

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 127/252 (50%), Gaps = 31/252 (12%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV----NRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R      R  ++N V+    ++++ +   H++
Sbjct: 68  LYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHEN 127

Query: 439 DIVHSDLKPANFIFVK-GTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +  K G LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPN 554
           + YS              DIWS GCIL +M  G P +      ++L  I +    +  PN
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD---IMGTPN 229

Query: 555 ES--PCGKKVPQ 564
           ES  P   K+P+
Sbjct: 230 ESLWPSVTKLPK 241

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 123/242 (50%), Gaps = 29/242 (11%)

Query: 324 VELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++ TG Y ALK++ L+  +E   +   REI L+K L + + +V+
Sbjct: 9   LEKLGNGTYATVYKGLNKSTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHDNIVR 66

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHER----VNRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R      R  ++N V+    +++E +   H++
Sbjct: 67  LYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLEGLAFCHEN 126

Query: 439 DIVHSDLKPANFIFVK-GTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +  K G LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 127 KILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 182

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPN 554
           + YS              DIWS GCIL +M  G P +      ++L  I +   ++  PN
Sbjct: 183 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGTNDEEQLKLIFD---KMGTPN 228

Query: 555 ES 556
           E+
Sbjct: 229 ET 230

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 141/305 (46%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV----NRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R      R  ++N V+    ++++ +   H++
Sbjct: 68  LYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM---------- 544
           + YS              DIWS GCIL +M  G P +      ++L  I           
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPSESL 232

Query: 545 ----------NPNIQIDYPNE-----SPCGKK-VPQSLVALIKTCLNRDPQLRATTDEIQ 588
                     NPN+Q   P +      P  K+ +  +L+  +   L  +P +R +  +  
Sbjct: 233 WPAVTKLPKYNPNVQHRTPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQAL 292

Query: 589 HCSFF 593
           H  +F
Sbjct: 293 HHPWF 297

>TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {ON}
           Anc_3.60 YNL298W
          Length = 885

 Score = 93.6 bits (231), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/325 (28%), Positives = 153/325 (47%), Gaps = 62/325 (19%)

Query: 304 SQANLMS--KQWSRITDEELS--IVELLGKGGSSKVYKV--------QDRTGKY------ 345
           S A +M+  KQ + I D   S  ++E  G+G S  VY          +D+  +Y      
Sbjct: 571 SNAEIMARLKQVTFIQDPTPSFEMIEKAGQGASGSVYLAKRSALPPKEDKINQYDEPAKI 630

Query: 346 ---YALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--ME 398
               A+KQ++L +  +  K  +  EI ++K  +R + +V  +E   K +D +  V+  ME
Sbjct: 631 GDKVAIKQMMLSK--QPRKELIVNEILVMKD-SRHKNIVNFLEAYLKTEDDLWVVMEYME 687

Query: 399 CGNFDLSHVLH-----ERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF- 452
            G+  L+ ++      E +N P   + +  + +E  + +K +HD  I+H D+K  N +  
Sbjct: 688 GGS--LTDIIENSPADESINSPLTESQIAYIVRETCQGLKFLHDRHIIHRDIKSDNVLLD 745

Query: 453 VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPS 512
            +G +K+ DFG   K+ D      R T +GTP +MAPE +  + Y               
Sbjct: 746 TQGRVKITDFGFCAKLTDQ--RSKRATMVGTPYWMAPEVVKQREYDEKV----------- 792

Query: 513 DIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK- 571
           D+WS G +  +M  G PPY   L  D L A+      +   N +P  +  P+SL   IK 
Sbjct: 793 DVWSLGIMTIEMLEGEPPY---LNEDPLRALY-----LIATNGTPKLRH-PESLSLEIKR 843

Query: 572 ---TCLNRDPQLRATTDEIQHCSFF 593
               CL  D + RA+T+E+ H +FF
Sbjct: 844 FLSVCLCVDVRYRASTEELLHHNFF 868

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 115/217 (52%), Gaps = 26/217 (11%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGIYVALKEVKLDS-EEGTPSTAVREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R+  N P  F+++ V+    ++++ +   H++
Sbjct: 68  LYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQGVAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 RILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
           + YS              DIWS GCIL +M  G P +
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGRPLF 209

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 149/321 (46%), Gaps = 49/321 (15%)

Query: 284  QNKKHQTIPKIE-APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRT 342
            Q     T+ +I+ +P+    P  +    K   + +D    I++ +G+G   KV     + 
Sbjct: 941  QGATATTVGQIDDSPIFLKTPEGSIGAQKHIKKFSD--FLILQKMGEGAYGKVNLCLHKK 998

Query: 343  GKYYALKQILLEEL--------DENLKTDLEREIELLKRLAR--EERVVKLIEYKIDDRM 392
             +Y  + +++ +E         D  L T +  EI+++  L +  +E +++L+++  DD  
Sbjct: 999  ERYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMAVLNKHPDENILRLLDFFEDDDY 1057

Query: 393  ----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLMSKEMIECIKAVHDSDIVHSDLKP 447
                  V  E G+ DL  ++  + N   F+    +L+ K++I  IK +H+  IVH D+K 
Sbjct: 1058 YYIETPVHGETGSIDLFDLIELKTNMTEFE---AKLIFKQVISGIKHLHEQGIVHRDIKD 1114

Query: 448  ANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXW 506
             N I   KG +KLIDFG A  +     +V+    +GT +Y APE L  + Y         
Sbjct: 1115 ENVIVDSKGFVKLIDFGSAAYVKSGPFDVF----VGTIDYAAPEVLGGEPYE-------- 1162

Query: 507  KIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSL 566
              GKP DIW+ G +LY + +   P+ +      +  IM   ++         G +V +  
Sbjct: 1163 --GKPQDIWAVGILLYTIVFKENPFYN------IDEIMEGTLKFS------IGSEVSEEC 1208

Query: 567  VALIKTCLNRDPQLRATTDEI 587
            V LIK  LN++   R T  +I
Sbjct: 1209 VNLIKKILNKNAPKRPTIQDI 1229

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 137/283 (48%), Gaps = 44/283 (15%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELL 371
            +  I++ +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++
Sbjct: 1106 DFVILQKMGEGAYGKVNLCLHKKKRYIVVIKMIFKERILVDTWVRDRQLGT-IPSEIQIM 1164

Query: 372  KRLAR--EERVVKLIEYKIDDRMVQVLM----ECGNFDLSHVLHERVNRPFDINFVRLMS 425
              L +   E +++L+++  DD    +      E G  DL  ++  + N     +  RL+ 
Sbjct: 1165 TTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSN--MTESEARLIF 1222

Query: 426  KEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTP 484
             +++  IK +HDS+IVH D+K  N I   KG +KLIDFG A  +     +V+    +GT 
Sbjct: 1223 IQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF----VGTI 1278

Query: 485  NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
            +Y APE L  + Y          +GKP DIW+ G +LY + +   P+ +      +  I+
Sbjct: 1279 DYAAPEVLSGEPY----------LGKPQDIWAIGILLYTIMFKENPFYN------IDEIL 1322

Query: 545  NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
               ++I+  +++       Q  + LIK  L ++P  R T DEI
Sbjct: 1323 EAELKINNTSDA------SQDCIDLIKRILTKNPNKRPTIDEI 1359

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 132/286 (46%), Gaps = 43/286 (15%)

Query: 325  ELLGKGGSSKVY-KVQDRTGKYYALKQILLEEL---DEN---LKTDLEREIELLKRLARE 377
            E++GKG    VY  +   TG+  A+KQ+ + E    DE+   +   L+ E+  LK L   
Sbjct: 1042 EIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++  + +  + +E      +  ++  R+   FD   +R ++K+++E +  +H
Sbjct: 1101 VNIVQYLGFEEKNGIYSLFLEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLEGLAYLH 1158

Query: 437  DSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +    G  K+ DFGI+ K    + N+Y N+ M   GT  +MAPE +
Sbjct: 1159 SKGILHRDMKADNLLLDNDGVCKISDFGISRK----SNNIYSNSDMTMRGTVFWMAPEMV 1214

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
              +  YS              DIWS GC++ +M  G  P+S+F     +  I        
Sbjct: 1215 DTAHGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPP 1263

Query: 552  YPNE-----SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
             P++     SP G+       + +  C   DP++R T D +    F
Sbjct: 1264 IPDDTKDLVSPAGQ-------SFLDQCFEIDPEMRPTADSLVGHPF 1302

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 83/291 (28%), Positives = 138/291 (47%), Gaps = 54/291 (18%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELL 371
            + ++++ +GKG   KV     +  KY  + +++ +E         D  L T +  EI+++
Sbjct: 1064 DFTVLQNMGKGAYGKVDLCLHKKEKYVVVIKLIFKERILVDTWVRDRKLGT-IPSEIQIM 1122

Query: 372  KRLARE--ERVVKLIEYKIDDRMVQV----LMECGNFDLSHVLHERVNRP-FDINFVRLM 424
              L ++  E ++KL+++  DD+   +      E G+ DL  ++  + N   ++    +L+
Sbjct: 1123 ATLQKKPHENIMKLLDFFEDDQYYYIESPMHGETGSIDLFDLIELKTNMTEYE---AKLL 1179

Query: 425  SKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGT 483
             K++   +K +HD+ IVH D+K  N I   KG +KLIDFG A  +     +V+    +GT
Sbjct: 1180 FKQITSGVKHLHDNGIVHRDIKDENVIVDNKGCVKLIDFGSAAYVKRGPFDVF----VGT 1235

Query: 484  PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
             +Y APE L    Y           GKP DIW+ G +LY + Y   P   F   D +L  
Sbjct: 1236 IDYAAPEVLEGDPYE----------GKPQDIWAIGVLLYTIIYKENP---FYNVDEILDG 1282

Query: 544  ---MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCS 591
               +NP++             V +  VALI   L+R    R T D+I  CS
Sbjct: 1283 DLRINPSV------------IVSEECVALITMVLDRSLSKRPTVDDI--CS 1319

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 89.4 bits (220), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 141/305 (46%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R   N P   +++ V+    +++E +   H+S
Sbjct: 68  LYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVSFCHES 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM---------- 544
           + YS              D+WS GCIL +M  G P +      ++L  I           
Sbjct: 184 RTYSTSI-----------DMWSCGCILAEMITGKPLFPGTNDEEQLKLIFEIMGTPNEST 232

Query: 545 ----------NPNIQIDYPNE-----SPCGKK-VPQSLVALIKTCLNRDPQLRATTDEIQ 588
                     NPN     P +      P  K+ +  +L+ L+   L  +P +R +  +  
Sbjct: 233 WSGVSSLPKYNPNFSQKLPRDLRTILQPHTKEPLDDNLINLLHGLLQLNPDMRLSAKQAL 292

Query: 589 HCSFF 593
           H  +F
Sbjct: 293 HHPWF 297

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 112/214 (52%), Gaps = 13/214 (6%)

Query: 325 ELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K V+ +TGK +A+K I   ++  N+   + RE+E+L+RL    R+V+L
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVMGNIDG-VTRELEVLRRL-NHPRIVRL 249

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
             +  DD    +LME     DL   +    +   D    R ++K+++E +K +H   I H
Sbjct: 250 KGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITKQVLEAVKYIHGMGISH 307

Query: 443 SDLKPANFIFVKG---TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
            DLKP N +  +     +K+ DFG+A KI  N    +  T  GT  Y+APE +  +N S 
Sbjct: 308 RDLKPDNILIEQDDPVMVKITDFGLA-KIQGN--GTFMKTFCGTLAYVAPEVISGKN-SE 363

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                  K     D+WS GC++Y +  GH P+S 
Sbjct: 364 DKSQNKNKYSSLVDMWSIGCLVYVILTGHLPFSG 397

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 143/300 (47%), Gaps = 56/300 (18%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 12  LERLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 69

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERVNR----PFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R++R      +++ V+    ++++ +   H++
Sbjct: 70  LYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQLLQGVAFCHEN 129

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 130 RILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 185

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQM---------------------TYGHPPYSS 533
           + Y               DIWS GCIL +M                     T G P   +
Sbjct: 186 RTYCTSI-----------DIWSCGCILAEMIMGKALFPGTNDDEQLKLIFETMGTPTEQT 234

Query: 534 FLGHDRLLAIMNPNIQIDYPN-------ESPCGKKVPQSLVALIKTCLNRDPQLRATTDE 586
           ++G  + L   NP I + YPN       ++   +++   LV LI+  L  +P +R +  +
Sbjct: 235 WVGVSQ-LPKYNPQIPL-YPNKDIKQLLQATTKEQISDVLVNLIQGLLQLNPSMRLSAQQ 292

>NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}
          Length = 680

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/287 (29%), Positives = 136/287 (47%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 352 DDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTV--LARI 409

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L + L +     FD++  R  + E++  ++ 
Sbjct: 410 NCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQKEGR--FDLSRARFYTAELLCALET 467

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K +D T     +T  GTP Y+APE
Sbjct: 468 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDSDKT-----DTFCGTPEYLAPE 522

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 523 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 565

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             P   P G    +    L+   L+RDP  R     TDEI++  FF+
Sbjct: 566 QNPLRFPDG--FDEDAKDLLIGLLSRDPTRRLGYNGTDEIKNHPFFS 610

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 131/282 (46%), Gaps = 30/282 (10%)

Query: 323 IVELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVV 381
           I + +G+G    VYK  D+  GK  A+K + LE  +E++   L +EI  L  L R   + 
Sbjct: 17  IQQCVGRGNFGDVYKACDKVEGKVVAVKVVNLEHSEEDIDL-LAQEIFFLAEL-RSPFIT 74

Query: 382 KLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
             I    +D  + ++ME CG    + ++            V  ++ +++  +  +H+   
Sbjct: 75  NYITTLTEDVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLHEQKK 134

Query: 441 VHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H D+K AN +   +GT+KL DFG++ +I      + R T +GTP +MAPE +  +N   
Sbjct: 135 IHRDIKAANILLTDEGTVKLGDFGVSGQI---RATLKRGTFVGTPYWMAPEVVSKENDGY 191

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP-NIQIDYPNESPC 558
                     + +DIWS G  +Y++  G PP          L+  +P  + I+ P   P 
Sbjct: 192 D---------EKADIWSLGITVYELLKGAPP----------LSKCDPMKVMINLPKRKPP 232

Query: 559 G--KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
                   S    + +CL ++P  RA+  E+   +F N + +
Sbjct: 233 ALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVEHNFVNQLAV 274

>CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa]
           {ON} highly similar to uniprot|P12688 Saccharomyces
           cerevisiae YKL126w Serine/threonine-protein kinase
          Length = 703

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 136/287 (47%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 368 DDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTV--LARI 425

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L + L +R  R FD++  R  + E++  +  
Sbjct: 426 DCPFIVPLKFSFQSQEKLYLVLACINGGELFYHL-QREGR-FDLSRSRFYAAELLCALDT 483

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 484 LHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKT-----DTFCGTPEYLAPE 538

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I  
Sbjct: 539 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDENVPKMYKKILQ 582

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
           D P   P G    +    L+   L+RDPQ R      DEI++  FF+
Sbjct: 583 D-PLVFPDG--FDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFS 626

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 135/291 (46%), Gaps = 41/291 (14%)

Query: 327 LGKGGSSKVYKVQDRTGK-YYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   D T + Y A+KQ+ LE+  +  K  +  EI ++K  ++ E +V  I+
Sbjct: 656 IGQGASGGVYTAHDPTREGYVAIKQMNLEKQPK--KELIINEIIVMKE-SKHENIVNFID 712

Query: 386 ---YKIDDRMVQVLMECGNFD--LSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
               K D  ++   ME G+    ++H L            V  + +E +  ++ +H   +
Sbjct: 713 SYLLKGDLWVIMEYMEGGSLTDVVTHCLLTEAQ-------VGAVCRETLSGLQFLHSKGV 765

Query: 441 VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H D+K  N +  ++G +KL DFG   +I  N LN+ R T +GTP +MAPE +  + Y  
Sbjct: 766 IHRDIKSDNILLSMRGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPEVVSRKEY-- 821

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCG 559
                    G   DIWS G ++ +M  G PPY   L    L A+      +   N +P  
Sbjct: 822 ---------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIATNGTPSL 864

Query: 560 KK---VPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLI 607
           K+   +  +L   +  CL  +P  RA+  ++    F   +  S   L  L+
Sbjct: 865 KEPEALSDALNNFLGWCLKVNPDERASAKDLLLDPFITEIADSNESLAPLV 915

>KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.341
            YNR031C
          Length = 1656

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 130/294 (44%), Gaps = 42/294 (14%)

Query: 327  LGKGGSSKVYK-VQDRTGKYYALKQILLEELD--ENLKTDLEREIELLKRLAREERVVKL 383
            +G G    VY  V    G   A+K+I +++    E +   ++ E+ +++ L     +++ 
Sbjct: 1364 VGGGTFGSVYSAVNLDNGDILAVKEIKIQDSKAMEKIFPSVKEEMSVMEML-NHPNIIQY 1422

Query: 384  IEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
               ++    V + ME C    L+ +L H R+    D    ++ + E++E +  +H+S IV
Sbjct: 1423 YGVEVHRDKVNIFMEYCEGGSLASLLEHGRIE---DEMVTQVYTLELLEGLAYLHESGIV 1479

Query: 442  HSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNT----------------QMGTP 484
            H D+KP N +    G +K +DFG A KIA N   +                     +GTP
Sbjct: 1480 HRDIKPENILLDFNGIIKYVDFGAARKIASNETKIRTAGSGSSPGTSSSTDNLRDMIGTP 1539

Query: 485  NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
             YMAPET+                    D+WS GC++ +M  G  P+S+    D   AIM
Sbjct: 1540 MYMAPETITGSKTKGSFGV--------DDVWSLGCVVLEMVTGRRPWSNL---DNEWAIM 1588

Query: 545  NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
              ++   +  + P   ++ ++     K CL  DP  RAT  E+      +P I+
Sbjct: 1589 Y-HVAAGHIPQLPAKDEISEAGAKFFKRCLVYDPNKRATAVEL----LMDPWIV 1637

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/306 (27%), Positives = 139/306 (45%), Gaps = 52/306 (16%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G + ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 11  LEKLGNGTYATVYKGLNKTTGIFVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 68

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERVN----RPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL + +  R +    R  +++ V+    ++ E +   H++
Sbjct: 69  LYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQLFEGVTFCHEN 128

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     +T++ T  Y AP+ L+ S
Sbjct: 129 KILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----STEVVTLWYRAPDVLMGS 184

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN--------- 545
           ++YS              D+WS GCIL +M  G P +      ++L  I +         
Sbjct: 185 RSYSTSI-----------DMWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPDEQL 233

Query: 546 -------PNIQIDYPNESPCGKK----------VPQSLVALIKTCLNRDPQLRATTDEIQ 588
                  P    + P + P   K          V   ++ L+   L  +P  R T  +  
Sbjct: 234 WPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLLQLNPDARLTAKQAL 293

Query: 589 HCSFFN 594
           H  +F 
Sbjct: 294 HHPWFG 299

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 134/280 (47%), Gaps = 44/280 (15%)

Query: 323  IVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRL 374
            I++ +G+G   KV     +T +Y  + +++ +E         D  L T +  EI+++  +
Sbjct: 1078 ILQNMGEGAYGKVNLCLHKTERYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATI 1136

Query: 375  ARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEM 428
            ++E  E ++ L+++  DD        V  E G+ DL  ++  + N   +I   +L+ K++
Sbjct: 1137 SKEPHENILTLLDFFEDDDYYYIETPVHGETGSIDLFDLIEFKTNMT-EIE-AKLLFKQV 1194

Query: 429  IECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYM 487
            +  +K +HD  IVH D+K  N I   +G +K+IDFG A  +     +V+    +GT +Y 
Sbjct: 1195 VSGVKHLHDQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGPFDVF----VGTIDYA 1250

Query: 488  APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
            APE L    Y           GKP DIW+ G +LY + +   P+ +      +  I+   
Sbjct: 1251 APEVLGGSPYE----------GKPQDIWAIGILLYTIVFKENPFYN------IDEILEGE 1294

Query: 548  IQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            ++ +        + V +    LI   LNR+ Q R T D+I
Sbjct: 1295 LKFN------SSELVSEQCTTLIAKILNRNVQKRPTIDDI 1328

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 146/305 (47%), Gaps = 43/305 (14%)

Query: 300  QSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVY-KVQDRTGKYYALKQILLEELD- 357
            QS+ S  + +S +W +         + +G G    V+  V   TG+  A+K+I +++   
Sbjct: 1236 QSLASSLSNVSIRWQK--------RQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKS 1287

Query: 358  -ENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNR 414
             + +   ++ E+ +L+ L     VV+    ++    V + ME C    L+ +L H R+  
Sbjct: 1288 MKQVFPAIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIE- 1345

Query: 415  PFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTL 473
              D    ++ + +M+E +  +H S +VH D+KP N +    G +K +DFG A  +A N  
Sbjct: 1346 --DEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGT 1403

Query: 474  ---NVYR-------NTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQ 523
               NV         N+ MGTP YM+PE++              K G   DIWS GC++ +
Sbjct: 1404 KAPNVGAEGKADGVNSMMGTPMYMSPESITGAKKG--------KFGS-GDIWSLGCVILE 1454

Query: 524  MTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKV-PQSLVALIKTCLNRDPQLRA 582
            M  G  P+ +    D   AIM  ++   +  + P  +++ PQ +  L++ CL +DP  R+
Sbjct: 1455 MVTGRRPWFNL---DNEWAIMY-HVAAGHVPQLPTKEELSPQGIDFLLR-CLKQDPNKRS 1509

Query: 583  TTDEI 587
            T  E+
Sbjct: 1510 TAMEL 1514

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 126/277 (45%), Gaps = 33/277 (11%)

Query: 327 LGKGGSSKVYKVQDRTG--KYYALK----QILLEELDENLKTDLEREIELLKRLAREERV 380
           LG G  S VYK  DRT   + YA+K    Q +++E      T  +  + LL R AR   +
Sbjct: 18  LGHGSYSTVYKAVDRTNANRVYAIKVCSKQHIIKEKKVKYVTIEKNTLNLLTR-ARHPGI 76

Query: 381 VKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
           VKL   +  ++ +  VL      +L  +LH    + F   +    + ++I+ ++ +H   
Sbjct: 77  VKLHYTFHDEENLYFVLDYAPGGELLSLLHRM--KTFSEMWACHFTCQLIDSMQFLHSQG 134

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           I+H DLKP N +   +G L + DFG A            ++ +GT  Y++PE L+     
Sbjct: 135 IIHRDLKPENLLLNNEGRLMITDFGTATGTDSRG-----SSFVGTAEYVSPELLLHNQCD 189

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP- 557
                        SDIW+ GC++YQ   G PP   F G +  L      + +DYP  +P 
Sbjct: 190 VS-----------SDIWALGCMIYQFLQGSPP---FRGENE-LQTFEKTVSLDYPWNNPQ 234

Query: 558 -CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
              K +   +V L +  L  DP +R T  +I+   +F
Sbjct: 235 VTPKGINPVVVDLTRRILVLDPSVRPTLQQIKLHKWF 271

>CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa]
           {ON} similar to uniprot|P48562 Saccharomyces cerevisiae
           YNL298w CLA4
          Length = 861

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 101/347 (29%), Positives = 157/347 (45%), Gaps = 71/347 (20%)

Query: 304 SQANLMSKQWSRITDEELS----IVELLGKGGSSKVYKVQDRT----------------- 342
           S A +MSK      D + S    ++E  G+G S  VY + +RT                 
Sbjct: 543 SNAEIMSKLKQVTLDADPSTLFKMIEKAGQGASGSVY-LAERTEIIEADGPQHQRGGTEH 601

Query: 343 -----GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQV 395
                G   A+KQ++L +  +  K  +  EI ++   +R E +V  +E   K +D +  V
Sbjct: 602 EDPLIGDKVAIKQMVLSK--QPRKELIVNEIMVMND-SRHENIVNFLEAYLKTEDDLWVV 658

Query: 396 L--MECGNFDLSHVL-----HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPA 448
           +  ME G+  L+ ++     +     P     +  + +E  + +K +HD +I+H D+K  
Sbjct: 659 MEYMEGGS--LTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNIIHRDIKSD 716

Query: 449 NFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWK 507
           N +   K  +K+ DFG   K+ D      R T +GTP +MAPE +  + Y          
Sbjct: 717 NVLLDTKARVKITDFGFCAKLTDQ--RSKRATMVGTPYWMAPEVVKQKEYDAKV------ 768

Query: 508 IGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLV 567
                D+WS G +  +M  G PPY   L  D L A+      +   N +P  K  PQSL 
Sbjct: 769 -----DVWSLGIMAIEMLEGEPPY---LNEDPLKALY-----LIATNGTPKLKH-PQSLS 814

Query: 568 ALIK----TCLNRDPQLRATTDEIQHCSFFNPMIISKPF-LESLIDN 609
             IK     CL  D + RA+T+E+ H SFFN  I  +P  L SL++N
Sbjct: 815 LEIKRFLSVCLCVDVKYRASTEELLHHSFFN--IACEPEDLTSLLEN 859

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 136/303 (44%), Gaps = 54/303 (17%)

Query: 326  LLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKR------LAREE 378
             +G G    V+  V    G+  A+K+I +++      T +++   L+K       +    
Sbjct: 1534 FIGGGTFGTVFSAVNLDNGEILAVKEIRIQD-----STTMKKIFPLIKEEMTVLEMLNHP 1588

Query: 379  RVVKLIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVH 436
             +V+    ++    V + ME C    L+ +L H R+    D    ++ + E++E +  +H
Sbjct: 1589 NIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEHGRIE---DEMVTQIYTLELLEGLAYLH 1645

Query: 437  DSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADN-----TLNVYRNTQ---------- 480
             + +VH D+KP N +    G +K +DFG A KIA N      LN     +          
Sbjct: 1646 QAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRIPNLNKKNGAEPEVEEDADGG 1705

Query: 481  -----MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFL 535
                 MGTP YMAPE++     +        K G   DIWS GC++ +M  G  P+++  
Sbjct: 1706 KVHDMMGTPMYMAPESITGPGNTG-------KFGS-DDIWSLGCVVLEMVTGRRPWANL- 1756

Query: 536  GHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNP 595
              D   AIM  ++   +  + P   +V  +  A ++ CL +DP+ RAT  E+      +P
Sbjct: 1757 --DNEWAIMY-HVAAGHTPQLPNADEVTPAGRAFLQRCLVQDPKSRATAVEL----LIDP 1809

Query: 596  MII 598
             I+
Sbjct: 1810 WIV 1812

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 115/222 (51%), Gaps = 29/222 (13%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + + +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHDNIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV----NRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R+     R  +++ V+    +++E +   H++
Sbjct: 68  LYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLG 536
           + YS              DIWS GCIL +M  G P    FLG
Sbjct: 184 RTYSTSI-----------DIWSCGCILAEMITGKP---LFLG 211

>Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {ON}
            YCR073C (REAL)
          Length = 1340

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 130/283 (45%), Gaps = 37/283 (13%)

Query: 326  LLGKGGSSKVY-KVQDRTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G   KVY  +    G+  A+K+I + + +   K    ++ E+ +L+ L     +V+
Sbjct: 1038 FIGGGAFGKVYSAINLENGEILAVKEINIHDTNTMKKVFPLIKEEMTVLEML-NHPNIVQ 1096

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
                ++    V + ME C    L+  L  H R+    D    ++ + E++E +  +H S 
Sbjct: 1097 YYGVEVHRDKVNIFMEYCEGGSLASCLLDHGRIE---DEMVTQVYTLELLEGLAYLHRSG 1153

Query: 440  IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRN--------------TQMGTP 484
            +VH D+KP N +    G +K +DFG A  + +++    +N                MGTP
Sbjct: 1154 VVHRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQNETSQEIEAEPNPINGMMGTP 1213

Query: 485  NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
             YMAPE +              K+G   DIW+ GC++ +M  G  P+S+    D   AIM
Sbjct: 1214 MYMAPEAISGSAIKG-------KLG-ADDIWALGCVVLEMATGRRPWSNL---DNEWAIM 1262

Query: 545  NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              ++   Y  + P   ++  +  A ++ CL +DP  RAT  E+
Sbjct: 1263 Y-HVAAGYIPQLPSKDEITPAGRAFLERCLVQDPTRRATAVEL 1304

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 111/214 (51%), Gaps = 13/214 (6%)

Query: 325 ELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K  +R TGK +A+K I   ++  N+   + RE+E+L+RL    R+V L
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD-GVTRELEVLRRL-NHPRIVSL 278

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
             +  DD    +LME     DL   +    +   D    R ++++++E ++ +H+  I H
Sbjct: 279 KGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVRYIHEQGISH 336

Query: 443 SDLKPANFIFVKG---TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
            DLKP N +  +     +K+ DFG+A KI DNT   +  T  GT  Y+APE +  +N   
Sbjct: 337 RDLKPDNILIEQDDPVLVKITDFGLA-KIQDNT--TFMKTFCGTLAYVAPEVIGGKNPEG 393

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                        D+WS GC++Y +  GH P+S 
Sbjct: 394 NGANGNL-YSSLVDMWSIGCLVYVILTGHLPFSG 426

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 127/279 (45%), Gaps = 28/279 (10%)

Query: 322 SIVELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           +I + +G+G    VYK  D+   K  A+K + LE  DE+++  L +EI  L  L +   +
Sbjct: 16  TIQDCVGRGNFGDVYKAIDKNESKVVAIKIVNLENTDEDIEL-LTQEIFFLSEL-KSPFI 73

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I    +D  + ++ME CG    + ++    ++    + V  + ++ ++ +K +HD  
Sbjct: 74  TNYITTLTEDVTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHDQK 133

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
            +H D+K AN +    G +KL DFG++ +I      + R T +GTP +MAPE +  Q   
Sbjct: 134 KIHRDIKAANILLTDCGKVKLGDFGVSGQIR---ATMKRGTFVGTPYWMAPEVINKQCKG 190

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP- 557
                      + +DIWS G   Y++  G PP S +     +L I         P   P 
Sbjct: 191 Y---------NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNI---------PKRKPP 232

Query: 558 -CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNP 595
               +  +     +  CL +DP+ R + + +    F  P
Sbjct: 233 KLHGQYSEKAKYFVSLCLIKDPKQRPSIEALLETDFLLP 271

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 136/286 (47%), Gaps = 34/286 (11%)

Query: 322 SIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI + +G+G    VYK  ++ +GK  A+K + LE  DE++   L +EI  L  L +   +
Sbjct: 18  SIKQCVGRGNFGDVYKACEKVSGKVVAVKVVNLEHTDEDINL-LAQEIFFLAEL-KSPYI 75

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I    +D  + ++ME CG    + +L    N     +    +++E+++ ++ +H+  
Sbjct: 76  TNYITTMTEDVSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVLKGLEYLHEQK 135

Query: 440 IVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLI--SQN 496
            +H D+K AN +   +G +KL DFG++ +I      + R T +GTP +MAPE +   S  
Sbjct: 136 KIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATLKRGTFVGTPFWMAPEVVSKDSDG 192

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP-NIQIDYPNE 555
           Y            + +DIWS G  +Y++  G PP          L   +P  + ++ P  
Sbjct: 193 YD-----------EKADIWSLGITVYELLKGSPP----------LYKCDPMKVMVNLPKR 231

Query: 556 SPCGKKVPQSLVA--LIKTCLNRDPQLRATTDEIQHCSFFNPMIIS 599
            P       S  A   + +CL ++P+ R +  E+ +  F   + IS
Sbjct: 232 KPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQIS 277

>ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL126W (YPK1) and
           YMR104C (YPK2)
          Length = 722

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 138/300 (46%), Gaps = 39/300 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 387 DDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTV--LARV 444

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L    H +    FD++  R  + E++  ++ 
Sbjct: 445 DNPFIVPLKFSFQSPEKLYLVLAFINGGEL--FFHLQKEGRFDLSRARFYTAELLCALET 502

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  ++++ DLKP N +   +G + L DFG+     K  D T     NT  GTP Y+APE
Sbjct: 503 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT-----NTFCGTPEYLAPE 557

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 558 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 600

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLESLI 607
             P   P G    +    L+   L RDP+ R      DEI+   FF+ +   + +++  I
Sbjct: 601 QEPLRFPDG--FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYI 658

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/288 (28%), Positives = 138/288 (47%), Gaps = 44/288 (15%)

Query: 327 LGKGGSSKVYKVQDRTG-KYYALKQILLEE--LDENLKTDLEREIELLKRLAREERVVKL 383
           +GKG  S VYKV   T     ALK++ + +  L  N ++ + +EIE+ K +   + ++ +
Sbjct: 56  IGKGSHSIVYKVTHPTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISM 115

Query: 384 IE-YKIDDRMVQVLMECGNFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
           I+ ++ID  M  VL  CG   L  ++   +R  R ++    RLM  ++   +  +H+ +I
Sbjct: 116 IDHFEIDATMYMVLELCGAGSLYDIICRSKRSLREWEAK--RLMI-QLCGAVDWIHEKNI 172

Query: 441 VHSDLKPANFIF-VKGTLKLIDFG---IANKIADNTLNVYRNTQMGTPNYMAPETLISQN 496
           VH+DLK +N +      L+L DFG   ++  I +N++N     + GTPNY++PE  I  N
Sbjct: 173 VHADLKLSNILIDSSNNLQLCDFGHSFVSTDIDNNSIN-----KFGTPNYLSPE--IISN 225

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES 556
           +        +   K SDIWS G +LY M +   P+ +              ++  Y N  
Sbjct: 226 FILSDKKDLY-FPKESDIWSIGIVLYAMIFDKTPFEA------------TTLRSTYENIV 272

Query: 557 PC------GKKVPQSLVALIKTCLNRDPQLRAT-----TDEIQHCSFF 593
            C       K+V   +  LI+  L   P  R T     +D+  H S+F
Sbjct: 273 ECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSDDWFHTSYF 320

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 132/283 (46%), Gaps = 44/283 (15%)

Query: 320  ELSIVELLGKGGSSKV-YKVQDRTGKYYALKQILLEEL-------DENLKTDLEREIELL 371
            + +I++ +G+G   KV   + ++      +K I  E +       D  L T +  EI+++
Sbjct: 845  DFTILQAMGEGAYGKVNLCIHNKEHYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIM 903

Query: 372  KRLAR--EERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMS 425
              L +  +E +++L+++  DD        V  E G+ DL  V+  +  +    +  +L+ 
Sbjct: 904  ATLNKNPQENILRLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFK--KDMVEHEAKLVF 961

Query: 426  KEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTP 484
            K+++  IK +HD  IVH D+K  N I    G +KLIDFG A        +V+    +GT 
Sbjct: 962  KQVVSSIKHLHDQGIVHRDIKDENIIVDSHGFVKLIDFGSAAYTKSGPFDVF----VGTM 1017

Query: 485  NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
            +Y APE L   +Y           GKP DIW+ G +LY + Y   PY +      +  I+
Sbjct: 1018 DYAAPEVLGGSSYK----------GKPQDIWALGVLLYTIIYKENPYYN------IDEIL 1061

Query: 545  NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
               ++ D        + V    ++LIK  L R+   R T D+I
Sbjct: 1062 EGELRFD------NAENVSDECISLIKGILTREVDKRPTIDDI 1098

>TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.446
           YMR104C
          Length = 681

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 148/305 (48%), Gaps = 35/305 (11%)

Query: 312 QWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEEL-DENLKTDLEREIE 369
           ++ +++ ++  +++++GKG   KV +V+ + T K YALK I    +  ++  T    E  
Sbjct: 339 KYKKLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIKKAYIISKSEVTHTLAEKT 398

Query: 370 LLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMI 429
           +L R+     V     ++  +++  VL      +L +  H +    FD++  R  + E++
Sbjct: 399 VLSRIICPFIVPLKFSFQSPEKLYLVLAFINGGELFY--HLQKEGRFDLSRSRFYTAELL 456

Query: 430 ECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPN 485
             ++ +H   I++ DLKP N +   +G + L DFG++    K  D T     +T  GTP 
Sbjct: 457 CALETLHKYSIIYRDLKPENILLDYQGHIALCDFGLSKLNMKDKDKT-----DTFCGTPE 511

Query: 486 YMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN 545
           Y+APE L+ Q Y+              D W+ G +LY+M  G PPY     +D  +  M 
Sbjct: 512 YLAPELLLGQGYTNVV-----------DWWTLGVLLYEMLTGLPPY-----YDEDVPKMY 555

Query: 546 PNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPF 602
             I +  P   P G        +L+   L+RDP+ R    + DEI++  FFN +  ++ +
Sbjct: 556 KKI-LKEPLRFPEG--FDSDAKSLLIGLLSRDPKRRLGYNSPDEIKNHPFFNNLSWNRLW 612

Query: 603 LESLI 607
           L++ I
Sbjct: 613 LKAYI 617

>NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {ON} 
          Length = 706

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 88/300 (29%), Positives = 143/300 (47%), Gaps = 43/300 (14%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 372 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKSYIVSKSEVTHTLAERTV--LARV 429

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L + L +R  R FD++  R  + E++  ++ 
Sbjct: 430 NCPFIVPLKFSFQSSEKLYLVLACINGGELFYHL-QREGR-FDLSRARFYTAELLCALET 487

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H+ ++++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 488 LHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYLAPE 542

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  +  M   I  
Sbjct: 543 LLLGQGYT-----------KVVDWWTLGILLYEMLTGLPPY-----YDEDVPRMYRKILQ 586

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPM----IISKPFL 603
           D P   P G    Q    L+   LNRDP  R      DEI+   FF+ +    ++SK ++
Sbjct: 587 D-PLRFPDG--FDQDAKDLLIQLLNRDPLRRLGCNGADEIKSHPFFSQLSWKRLVSKGYI 643

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 132/286 (46%), Gaps = 34/286 (11%)

Query: 326  LLGKGGSSKVY-KVQDRTGKYYALKQILLEELD--ENLKTDLEREIELLKRLAREERVVK 382
             +G G    VY  V   TG   A+K+I   +    + +   +  E+ +L+ L     VV+
Sbjct: 1196 FIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NHPNVVQ 1254

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+ +L H R+    D    ++ S +M+E +  +H+S +
Sbjct: 1255 YYGVEVHRDRVNIFMEYCEGGSLASLLAHGRIE---DEMVTQVYSLQMLEGLAYLHESGV 1311

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNT---LNVYRNTQ----MGTPNYMAPETL 492
             H D+KP N +    G +K +DFG A  +A N    LN+ ++ +    +GTP YM+PE +
Sbjct: 1312 DHRDIKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAI 1371

Query: 493  ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDY 552
                Y         K G   DIWS GC++ +M  G  P+++    D   AI+        
Sbjct: 1372 SGTGYG--------KFGS-DDIWSLGCVILEMVTGRRPWANL---DNQWAIIYQVAAGQI 1419

Query: 553  PNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
            P   P   ++ Q+ +  +  CL +DP  R+T  E+      +P II
Sbjct: 1420 P-MFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVEL----LMDPWII 1460

>NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6.341
          Length = 1683

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 137/308 (44%), Gaps = 61/308 (19%)

Query: 326  LLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G    VY  V    G+  A+K+I +++     K    ++ E+ +L+ L     +V+
Sbjct: 1366 FIGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEML-NHPNIVQ 1424

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    ++ +L H R+    D    ++ + E++E +  +H + +
Sbjct: 1425 YYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIE---DEMVTQVYTLELLEGLAYLHQAGV 1481

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYR---------------------- 477
            VH D+KP N +    G +K +DFG A KIA N   V                        
Sbjct: 1482 VHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANS 1541

Query: 478  -NTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLG 536
             +  +GTP YMAPE++              K G   DIWS+GC++ +M  G  P+++   
Sbjct: 1542 VHDMLGTPMYMAPESITGYKNKT-------KFGS-DDIWSFGCVVLEMITGRRPWANL-- 1591

Query: 537  HDRLLAIM-----NPNIQIDYPNE-SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHC 590
             D   AI+         Q+ YPNE SP G++        ++ CL +DP  RAT  E+   
Sbjct: 1592 -DNEWAIIYHVAAGQTPQLPYPNEVSPAGRR-------FLQRCLVQDPIKRATAVEL--- 1640

Query: 591  SFFNPMII 598
               +P I+
Sbjct: 1641 -LMDPWIV 1647

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 86/299 (28%), Positives = 143/299 (47%), Gaps = 40/299 (13%)

Query: 312 QWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDE-NLKTDLEREIE 369
           Q+  +T ++  I + LGKG   KVY V+ + TG   ALK +  +E+ + N++    RE+E
Sbjct: 131 QYKPMTLDDFEIGKKLGKGKFGKVYCVRHKKTGFICALKAMEKKEITQYNVQKQFRREVE 190

Query: 370 LLKRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEM 428
           +   L R   + +L  Y  DD+ V +LME   N +L    H RVN PF+         +M
Sbjct: 191 IQASL-RHPNLTQLYGYFYDDKRVYLLMEYLVNGELYR--HLRVNGPFNDILASYYVNQM 247

Query: 429 IECIKAVHDSDIVHSDLKPAN-FIFVKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYM 487
            + +  +HD +++H D+KP N  I  + TLKL DFG +     +T    R T  GT +Y+
Sbjct: 248 ADALNYMHDRNVLHRDIKPENILIGFQNTLKLTDFGWS---VISTTGAKRKTLCGTLDYL 304

Query: 488 APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY---SSFLGHDRLLAIM 544
           +PE +  + Y               D+W+ G + Y++  G PP+   S  L + R++   
Sbjct: 305 SPELVKYREYDEKV-----------DVWALGVLAYELLVGTPPFEEASKELTYKRIV--- 350

Query: 545 NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII-SKPF 602
                + +P++     +       LI   L  DP  R +  ++      +P I+ +KPF
Sbjct: 351 --RRDLRFPDQMSIDAR------DLIGRLLENDPSTRISLKDV----LSHPWIVKNKPF 397

>KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.446
           YMR104C
          Length = 677

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 152/326 (46%), Gaps = 50/326 (15%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKSYIVSKSEVTHTLAERTV--LARV 399

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L + L +R  R FD++  R  + E++  ++ 
Sbjct: 400 DCPFIVPLKFSFQSPEKLYLVLACINGGELFYHL-QREGR-FDLSRSRFYAAELLCALET 457

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 458 LHKFDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYLAPE 512

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 513 LLLGQGYT-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 555

Query: 551 DYPNESPCG--KKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLES 605
             P   P G  K     L+ L    L+RDP  R      DEI++  FF+ +   +  ++ 
Sbjct: 556 QEPLRFPDGFDKDAKDLLIGL----LSRDPTRRLGLNGADEIKNHPFFSQLNWKRLLMKG 611

Query: 606 LI-------DNAINYGIENQNITQDR 624
            I        NA++    +Q  TQ++
Sbjct: 612 YIPPYKPSVSNAMDTSNFDQEFTQEK 637

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 127/278 (45%), Gaps = 43/278 (15%)

Query: 327 LGKGGSSKVYKVQDRTGK-YYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   D   +   A+KQ+ LE+  +  K  +  EI L+ R ++   +V  I+
Sbjct: 626 IGQGASGGVYIAHDTESEDSVAIKQMNLEK--QPKKELILNEI-LVMRESKHSNIVNFID 682

Query: 386 ---YKIDDRMVQVLMECGNFD--LSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
               K D  +V   ME G+    ++H L            +  + +E ++ ++ +H   +
Sbjct: 683 SYLAKGDLWIVMEYMEGGSLTDVVTHCL-------LSEGQIGAVCRETLKGLQFLHSKGV 735

Query: 441 VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
           +H D+K  N +  +KG +KL DFG   +I +N  N+ R T +GTP +MAPE +  + Y  
Sbjct: 736 LHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVVSRKEY-- 791

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNE 555
                    G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P  
Sbjct: 792 ---------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPKLKEP-- 837

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               + +  +L   +  CL  DP  RAT  E+    F 
Sbjct: 838 ----EALSDTLTKFLDWCLKVDPSERATATELLDDPFI 871

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 81/318 (25%), Positives = 150/318 (47%), Gaps = 49/318 (15%)

Query: 288  HQTIPKIEA-PVPQSVPS-QANLMS-KQWSRITDEELSIVELLGKGGSSKVYKVQDRTGK 344
            H T P     P+P  + + +AN+ S K   + +D E  +++ +G+G   KV     +  +
Sbjct: 919  HATNPHGRGRPIPTFLATPEANIGSMKHIKKFSDFE--VLQKMGEGAYGKVDLCMHKKDR 976

Query: 345  YYALKQILLEEL--------DENLKTDLEREIELLKRLARE--ERVVKLIEYKIDDRM-- 392
            Y  + +++ +E         D  L T +  EI+++  L  +  E ++ L+++  DD    
Sbjct: 977  YIVVIKLIFKERILVDTWVRDRKLGT-IPSEIQIMATLNAKPHENILMLLDFFEDDDYYY 1035

Query: 393  --VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANF 450
                V    G+ DL  ++  + +     +   L+ K++   IK +HD+ IVH D+K  N 
Sbjct: 1036 IETAVHGTSGSIDLFDLIEMKTD--MTEHEAMLIFKQIASGIKNLHDNGIVHRDIKDENV 1093

Query: 451  IF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIG 509
            I    G +K++DFG A  +     +V+    +GT +Y APE L  + Y           G
Sbjct: 1094 IVDCNGFVKIVDFGSAAYVKSGPFDVF----VGTIDYAAPEVLGGEPYE----------G 1139

Query: 510  KPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVAL 569
            KP DIW+ G +LY + Y   P+ +      +  I++ +++++        +++    +AL
Sbjct: 1140 KPQDIWAIGVLLYTIIYKENPFYN------IDEILDADLRVN------SSERISDDCIAL 1187

Query: 570  IKTCLNRDPQLRATTDEI 587
            I+  LNR    R + DEI
Sbjct: 1188 IRKILNRSVSKRPSIDEI 1205

>Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W
           (REAL)
          Length = 836

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 90/328 (27%), Positives = 149/328 (45%), Gaps = 63/328 (19%)

Query: 304 SQANLMSKQWSRITDEELSI----VELLGKGGSSKVYKVQDRT----------------- 342
           S A +MSK  S   + + SI    +E  G+G S  VY + +RT                 
Sbjct: 519 STAEIMSKLKSVTVNADPSICFKVIEKAGQGASGSVY-LAERTHIPIESNMIELMNNEID 577

Query: 343 ----GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL 396
               G   A+KQ++L +  +  K  +  EI ++K  +R + +V  +E   K DD +  V+
Sbjct: 578 EPQVGDKVAIKQMILSK--QPRKELIVNEILVMKD-SRHKNIVNFLEAYLKTDDDLWVVM 634

Query: 397 --MECGNF-DL--SHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFI 451
             ME G+  D+  +   ++  + P     +  + +E  + +K +HD  I+H D+K  N +
Sbjct: 635 EFMEGGSLTDIIENSTTNDTSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVL 694

Query: 452 F-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGK 510
              +  +K+ DFG   ++ D      R T +GTP +MAPE +  + Y         KI  
Sbjct: 695 LDTRARVKITDFGFCARLTDK--RSKRATMVGTPYWMAPEVVKQREYDE-------KI-- 743

Query: 511 PSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESPCGKKVPQSL 566
             D+WS G +  +M  G PPY   L  D L A+     N   ++ YP      + +   +
Sbjct: 744 --DVWSLGIMTIEMLEGEPPY---LNEDPLKALYLIATNGTPKLKYP------ETLSLEI 792

Query: 567 VALIKTCLNRDPQLRATTDEIQHCSFFN 594
              +  CL  D + RA+T+E+ H  FFN
Sbjct: 793 KRFLSVCLCVDVRYRASTEELLHHGFFN 820

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 140/305 (45%), Gaps = 52/305 (17%)

Query: 324 VELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++ TG Y ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R   N P    +  V+    ++++ +   H++
Sbjct: 68  LYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQGVAFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 RILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM---------- 544
           + YS              DIWS GCIL +M  G P +      ++L  I           
Sbjct: 184 RTYSTSI-----------DIWSCGCILVEMITGKPLFPGTSDEEQLKLIFETMGTPTERT 232

Query: 545 ----------NPNIQIDYPN------ESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQ 588
                     NPN  I  P       +S   + +  ++V L+   L  +P++R +  +  
Sbjct: 233 WPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLNPEMRLSAKQAL 292

Query: 589 HCSFF 593
           +  +F
Sbjct: 293 NHPWF 297

>SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1558

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 133/280 (47%), Gaps = 35/280 (12%)

Query: 326  LLGKGGSSKVYK-VQDRTGKYYALKQILLEELD--ENLKTDLEREIELLKRLAREERVVK 382
             +G G    V+  V   TG   A+K+I +++    + +   ++ E+ +L+ L     +V+
Sbjct: 1267 FIGGGTFGTVFSAVNLDTGDILAVKEIKIQDSKSMQQVFPSIKDEMTVLEML-NHPNIVQ 1325

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+++L H RV    D    ++ + +++E +  +H S +
Sbjct: 1326 YYGVEVHRDKVNIFMEYCEGGSLANLLEHSRVE---DEMVTQVYALQLLEGLAYLHQSGV 1382

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTL--NVYR----------NTQMGTPNYM 487
            VH D+KP N +    G +K +DFG A  +A N+   N+            NT MGTP YM
Sbjct: 1383 VHRDIKPENILLDFNGIIKYVDFGAAKLLAKNSTKGNIDATSSEAKQDRINTMMGTPMYM 1442

Query: 488  APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
            +PE++              K G   DIWS GC++ +M  G  P+++    D   AIM  +
Sbjct: 1443 SPESITG--------TIKGKFGS-DDIWSLGCVILEMVTGRRPWANL---DNEWAIMY-H 1489

Query: 548  IQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +   +  + P   ++ ++    +  CL +DP  RAT  E+
Sbjct: 1490 VAAGHAPQFPARDEISRAGRKFLSRCLIQDPNKRATAVEL 1529

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 137/289 (47%), Gaps = 44/289 (15%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELL 371
            +  I++ +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++
Sbjct: 1013 DFVILQKMGEGAYGKVDLCMHKVEQYIVVIKLIFKERILVDTWVRDRKLGT-IPSEIQIM 1071

Query: 372  KRLARE--ERVVKLIEYKIDDRMVQVLM----ECGNFDLSHVLHERVNRPFDINFVRLMS 425
              L ++  E ++ L+++  DD    +      E G+ DL  ++  + N     +  +L+ 
Sbjct: 1072 ATLNKKPHENILTLLDFFEDDDYYYIETPMHGETGSIDLFDLIELKTN--MTEHEAKLIF 1129

Query: 426  KEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTP 484
            K++   IK +HD+ IVH D+K  N I   KG +KLIDFG A  +     +V+    +GT 
Sbjct: 1130 KQVASGIKHLHDNGIVHRDIKDENIIVDNKGFVKLIDFGSAAYVKSGPFDVF----VGTI 1185

Query: 485  NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
            +Y APE L    Y           GKP DIW+ G +LY + +   P+ +      +  I+
Sbjct: 1186 DYAAPEVLGGDPYE----------GKPQDIWAIGVLLYTIIFKENPFYN------IDEIL 1229

Query: 545  NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            + +++I           V +  +ALI+  LNR    R T +EI + S+ 
Sbjct: 1230 DGDLRIS------SSVTVSEECIALIRRILNRSVPKRPTIEEIYNDSWL 1272

>NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {ON}
           Anc_2.446
          Length = 674

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 140/293 (47%), Gaps = 39/293 (13%)

Query: 315 RITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIEL 370
           R+T ++  +++++GKG   KV +V+ R T K YALK I    +    E   T  ER +  
Sbjct: 339 RLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTV-- 396

Query: 371 LKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIE 430
           L R+     V     ++  +++  VL      +L +  H +    F+++  R  + E++ 
Sbjct: 397 LARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFY--HLQKEGRFELSRARFYTAELLC 454

Query: 431 CIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNY 486
            ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y
Sbjct: 455 ALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDKT-----DTFCGTPEY 509

Query: 487 MAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNP 546
           +APE L++Q YS           K  D W+ G +LY+M  G PPY     +D  +  M  
Sbjct: 510 LAPELLLNQGYS-----------KVVDWWTLGILLYEMLTGLPPY-----YDEDVPKMYR 553

Query: 547 NIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTD---EIQHCSFFNPM 596
            I  D P   P G    +    L+   L+RDP  R   +   EI++  FF+ +
Sbjct: 554 KILQD-PLRFPEG--FDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQL 603

>SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {ON}
           similar to uniprot|P12688 Saccharomyces cerevisiae
           YKL126W YPK1 Serine/threonine protein kinase required
           for receptor-mediated endocytosis involved in
           sphingolipid- mediated and cell integrity signaling
           pathways localized to the bud neck cytosol and plasma
           membrane homolog of mammalian kinase SGK and to YMR104C
           uniprot|P18961 Saccharomyces cerevisiae YMR104C YPK2
           Protein kinase with similarityto serine/threonine
           protein kinase Ypk1p; functionally redundant with YPK1
           at the genetic level; participates in a signaling
           pathway required for optimal cell wall integrity;
           homolog of mammalian kinase SGK
          Length = 733

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/302 (28%), Positives = 141/302 (46%), Gaps = 43/302 (14%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 398 DDFDLLKVIGKGSFGKVMQVRKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTV--LARV 455

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L +  H +    FD++  R  + E++  ++ 
Sbjct: 456 DNPFIVPLKFSFQSPEKLYLVLAFINGGELFY--HLQKEGRFDLSRARFYTAELLCALET 513

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  ++++ DLKP N +   +G + L DFG+     +  D T     NT  GTP Y+APE
Sbjct: 514 LHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMQDQDKT-----NTFCGTPEYLAPE 568

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 569 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 611

Query: 551 DYPNESPCG--KKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLES 605
             P   P G  K     L+ L    L+RDP+ R      DEI+   FF+ +   + +++ 
Sbjct: 612 QEPLRFPDGFDKDAKDLLIGL----LSRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKG 667

Query: 606 LI 607
            I
Sbjct: 668 YI 669

>KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON}
           Anc_5.591 YDR466W
          Length = 962

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 134/291 (46%), Gaps = 40/291 (13%)

Query: 325 ELLGKGGSSKVYKVQDR--TGKYYALK----QILLEELDENLKTDLEREIELLKRLAREE 378
           E LG G  S VYK  DR      YA+K    Q +++E      T  +  + LL R A   
Sbjct: 15  EELGHGSYSTVYKALDRRDVKNVYAIKVCSKQHIIKEGKVKYVTIEKNTLNLLAR-ANHP 73

Query: 379 RVVKLIEYKIDDRMVQVLME--CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
            +VKL     D + +  +++  CG  +L  +LH+     F   + R  S ++++ +  +H
Sbjct: 74  GIVKLHYTFHDAQNLYFVLDYACGG-ELLTLLHKMGT--FSELWARHFSVQLVDTLAYIH 130

Query: 437 DSDIVHSDLKPANFIFVK-GTLKLIDFGIANKI-ADNTLNVY---RNTQMGTPNYMAPET 491
              ++H DLKP N +  + G L + DFG A  +     L  +    ++ +GT  Y++PE 
Sbjct: 131 SQGVIHRDLKPENVLLDQTGRLMITDFGAAFTVDRAEQLGAHCAASSSFVGTAEYVSPEL 190

Query: 492 LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
           L+             + G  SD+W+ GC+++Q   GHPP   F G + L       I +D
Sbjct: 191 LLHN-----------QCGFSSDVWALGCMVFQFVEGHPP---FRGENELRTFEK-IIALD 235

Query: 552 Y-------PNESPCGKKVPQSL-VALIKTCLNRDPQLRATTDEIQHCSFFN 594
           Y       PN+   GK     L V+L+K  L  + Q R +   IQ  S+F+
Sbjct: 236 YSWNYELHPNKIATGKPATNPLIVSLVKKMLTINTQDRISLRGIQGSSWFD 286

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 137/300 (45%), Gaps = 46/300 (15%)

Query: 325  ELLGKGGSSKVYK-VQDRTGKYYALKQILLEELD--ENLKTDLEREIELLKRLAREERVV 381
            + +G G   +VY  V   TG+  A+K+I +++    E +   ++ E+ +L+ L+    +V
Sbjct: 1212 KFVGGGTFGEVYSAVNLDTGEVLAVKEIKIQDSKSMEKIFPSIKEEMNVLEMLSHP-NIV 1270

Query: 382  KLIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
            +    ++    V + ME C    L+ +L H R+    D    ++ + +++E +  +H+S 
Sbjct: 1271 QYYGVEVHRDRVNIFMEYCEGGSLASLLEHGRIE---DEMVTQVYTLQLLEGLAYLHESG 1327

Query: 440  IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYR--------------------N 478
            IVH D+KP N +    G +K +DFG A KIA N   V                      N
Sbjct: 1328 IVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTREMPDENDDENGKVVGRNNFN 1387

Query: 479  TQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHD 538
              +GTP YMAPE +               +G   DIW+ GC++ +M  G  P+++    D
Sbjct: 1388 DIIGTPMYMAPEAITGS-------PKKGHLG-ADDIWALGCVVLEMITGKRPWANL---D 1436

Query: 539  RLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
               AIM        P + P   +V  + +  +K CL ++P  RA+  E+      +P II
Sbjct: 1437 NEWAIMYHVAAGQIP-QLPTNDEVSPAGMHFLKRCLKQNPAQRASAVEL----LMDPWII 1491

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 134/289 (46%), Gaps = 49/289 (16%)

Query: 325  ELLGKGGSSKVYKVQD-RTGKYYALKQILLEEL---DENLKTDLE---REIELLKRLARE 377
            E++GKG    VY   +  TG+  A+KQ+ + +    D+N+   +E    E+  LK L   
Sbjct: 1279 EMIGKGSFGAVYLCLNLTTGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDLDHL 1338

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++ D  +  + +E  G   +  ++  R+   FD   +R ++ +++E +  +H
Sbjct: 1339 N-IVQYLGFENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAYLH 1395

Query: 437  DSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  + G  K+ DFGI+ K  D    +Y N+ M   GT  +MAPE +
Sbjct: 1396 SKGILHRDMKADNLLLDLDGVCKISDFGISRKSKD----IYSNSDMTMRGTVFWMAPEMV 1451

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GC++ +M  G  P+S+      ++A M    +I 
Sbjct: 1452 DTKQGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNL----EVVAAM---FKIG 1493

Query: 552  YPNESPCGKKVPQSLVALIK--------TCLNRDPQLRATTDEIQHCSF 592
                +P    +P+  + LI          C   DP LR T D++    F
Sbjct: 1494 KNKSAP---PIPEDTLPLISQDGRQFLNACFEIDPDLRPTADKLLSHPF 1539

>KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} similar
           to uniprot|P12688 Saccharomyces cerevisiae or to YMR
           104C, YKL126W YPK1 Serine/threonine protein kinase
           required for receptor-mediated endocytosis involved in
           sphingolipid-mediated and cell integrity signaling
           pathways localized to the bud neck cytosol and plasma
           membrane homolog of mammalian kinase SGK
          Length = 691

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 137/289 (47%), Gaps = 43/289 (14%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 356 DDFDLLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVTHTLAERTV--LARV 413

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  D++  VL      +L + L +R  R F ++  R  + E++  ++ 
Sbjct: 414 DNPFIVPLKFSFQSPDKLYIVLAFINGGELFYHL-QREGR-FSLSRARFYTAELLCALET 471

Query: 435 VHDSDIVHSDLKPANFIFV-KGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H+ D+++ DLKP N +   +G + L DFG+     K  + T     NT  GTP Y+APE
Sbjct: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQEKT-----NTFCGTPEYLAPE 526

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 527 LLLGQGYS-----------KVVDWWTLGVLLYEMMTGLPPY-----YDEDVPKMYKKI-L 569

Query: 551 DYPNESPCG--KKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             P   P G  K     L+ L    L+RDP+ R      +EI+   FF+
Sbjct: 570 QEPLRFPDGFDKDAKDLLIGL----LSRDPKRRLGFNGAEEIKSHPFFS 614

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 86.3 bits (212), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 114/220 (51%), Gaps = 26/220 (11%)

Query: 317 TDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLA 375
           T  +   +E LG G  + VYK  ++ TG Y ALK++ L+  +E   +   REI L+K L 
Sbjct: 3   TTSQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDS-EEGTPSTAIREISLMKEL- 60

Query: 376 REERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVN----RPFDINFVRLMSKEMIEC 431
           + E +V+L +    +  + ++ E  + DL   +  RV+    R  +++ V+    ++++ 
Sbjct: 61  KHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQG 120

Query: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMA 488
           +   H++ I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y A
Sbjct: 121 VAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRA 176

Query: 489 PETLI-SQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYG 527
           P+ L+ S++Y               DIWS GCIL +M  G
Sbjct: 177 PDVLMGSRSYCTSI-----------DIWSCGCILAEMIMG 205

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 134/289 (46%), Gaps = 49/289 (16%)

Query: 325  ELLGKGGSSKVY-KVQDRTGKYYALKQILL------EELDENLKTDLEREIELLKRLARE 377
            E++GKG    VY  +   TG+  A+KQ+ +       EL +++   L+ E+  LK L   
Sbjct: 1155 EMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHL 1214

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ +  +I   +  + +E      +  ++  R+   FD   +R ++ +++  +K +H
Sbjct: 1215 N-IVQYLGSEIRGNIYSLFLEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLH 1271

Query: 437  DSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  + G  K+ DFGI+ K    + N+Y N+ M   GT  +MAPE +
Sbjct: 1272 SKGILHRDMKADNLLLDEDGICKISDFGISKK----SKNIYSNSDMTMRGTVFWMAPEMV 1327

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GC++ +M  G  P+S+      ++A M    QI 
Sbjct: 1328 DTKQGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNL----EVVAAM---FQIG 1369

Query: 552  YPNESPCGKKVPQSLVALIKT--------CLNRDPQLRATTDEIQHCSF 592
                +P    +P   + LI +        C   DP+ R T D++   SF
Sbjct: 1370 KSKSAP---PIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSF 1415

>KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.446
           YMR104C
          Length = 692

 Score = 89.4 bits (220), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 92/327 (28%), Positives = 153/327 (46%), Gaps = 52/327 (15%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +     L
Sbjct: 357 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKSYIVSKSEVTHTLAERTV-----L 411

Query: 375 AREE--RVVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431
           AR E   +V L   ++  +++  VL      +L + L +     FD++  R  + E++  
Sbjct: 412 ARVECPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGR--FDLSRSRFYAAELLCA 469

Query: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYM 487
           ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+
Sbjct: 470 LETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYL 524

Query: 488 APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
           APE L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   
Sbjct: 525 APELLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDIPKMYKK 568

Query: 548 IQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLE 604
           I +  P   P G    +    L+   L+RDP  R      DEI++  FF+ +   +  ++
Sbjct: 569 I-LQAPLRFPDG--FDRDAKDLLIGLLSRDPVRRLGRNGADEIKNHQFFSQLSWKRLMMK 625

Query: 605 SLI-------DNAINYGIENQNITQDR 624
             I        +AI+    NQ  T+++
Sbjct: 626 GYIPPYKPPVSSAIDTSNFNQEFTKEK 652

>NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa] {ON}
            Anc_7.86
          Length = 1317

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 139/301 (46%), Gaps = 53/301 (17%)

Query: 306  ANLMS-KQWSRITDEELSIVELLGKGGSSKV-YKVQDRTGKYYALKQILLEEL------- 356
            AN+ S K+  + TD   +I+E +G+G   KV   +   + +   +K I+ E +       
Sbjct: 1043 ANIGSQKRVKKFTD--FAILEEMGQGAYGKVNLCIHKLSRQIVVIKMIVKERILVDTWVR 1100

Query: 357  DENLKTDLEREIELLKRLAR--EERVVKLIEYKIDDRMVQVLM----ECGNFDLSHVLHE 410
            D  L T +  EI+++  L +   E ++ ++++  DD    V M    E G  DL  ++  
Sbjct: 1101 DRKLGT-IPSEIQIMATLNKTPHENILSILDFFEDDNYYYVEMPTHGETGTIDLYDLIEF 1159

Query: 411  RVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIA 469
            + N   ++   +LM K+++  IK +HD  IVH D+K  N I   KG +KLID+G A    
Sbjct: 1160 KKNMT-ELE-CKLMFKQVVSAIKCMHDQGIVHRDIKDENIIVDSKGCIKLIDYGSAAYTK 1217

Query: 470  DNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHP 529
                +V+    +GT +Y APE L    Y           GKP DIW+ G +LY + +   
Sbjct: 1218 SGPFDVF----VGTIDYAAPEVLSGNLYD----------GKPQDIWALGILLYTIVFKEN 1263

Query: 530  PYSSFLGHDRLL---AIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDE 586
            P   F   D ++      N ++ ID    S C        + LIK  LNR    R T D 
Sbjct: 1264 P---FYNIDEIVDGELTFNESMSID----SKC--------IILIKKMLNRVVGQRPTIDA 1308

Query: 587  I 587
            I
Sbjct: 1309 I 1309

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 89.7 bits (221), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 142/293 (48%), Gaps = 46/293 (15%)

Query: 310  SKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLK 361
            SK  ++ +D   ++++ +G+G   KV     +  KY  + +++ +E         D  L 
Sbjct: 990  SKHVTKFSD--FTVLQKMGEGAYGKVDLCMHKKEKYVVVIKLIFKERILVDTWVRDRKLG 1047

Query: 362  TDLEREIELLKRLARE--ERVVKLIEYKIDDRMVQV----LMECGNFDLSHVLHERVNRP 415
            T +  EI+++  L ++  E +++L+++  DD    +      E G+ DL  ++  + N  
Sbjct: 1048 T-IPSEIQIMATLNKKPHENIMRLLDFFEDDEYYYIESPMHGETGSIDLFDLIELKTN-- 1104

Query: 416  FDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLN 474
               +  +L+ K++   ++ +H++ IVH D+K  N I   +G +K+IDFG A  +     +
Sbjct: 1105 MTEHEAKLLFKQVASGLRHLHENGIVHRDIKDENVIVDNRGRVKIIDFGSAAYVKRGPFD 1164

Query: 475  VYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
            V+    +GT +Y APE L    Y           GKP D+W+ G +LY + Y   P+ + 
Sbjct: 1165 VF----VGTIDYAAPEVLGGDPYE----------GKPQDVWAVGVLLYTIIYKENPFYN- 1209

Query: 535  LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
                 +  I++ +++I     SP    V +  VALI   LNR    R T D+I
Sbjct: 1210 -----IDEILDGDLRI-----SPA-VVVSEECVALITRILNRSVNRRPTVDDI 1251

>ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P12688 Saccharomyces cerevisiae
           YKL126W and highly similar to uniprot|P18961
           Saccharomyces cerevisiae YMR104C
          Length = 704

 Score = 89.4 bits (220), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 96/356 (26%), Positives = 156/356 (43%), Gaps = 68/356 (19%)

Query: 276 IRDYNSKIQNKKHQTIPKIEAPVPQSVPSQAN--LMSKQWSRITD--------------- 318
           +RD  +KI   +   +     PV   + S AN  L +  W R+ +               
Sbjct: 303 LRDMFNKINTNQDIHLDSFLLPVNLKIDSAANIRLYNHHWVRLENGLGNINFSVDYKPSK 362

Query: 319 ------EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREI 368
                 ++  +++++GKG   KV +V+ + T K YALK +    +    E   T  ER +
Sbjct: 363 NKSLSIDDFDLLKVIGKGSFGKVMQVKKKDTQKVYALKAVRKSYIVSKSEVTHTLAERTV 422

Query: 369 ELLKRLAREE--RVVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMS 425
                LAR E   +V L   ++  +++  VL      +L + L +     FD++  R  +
Sbjct: 423 -----LARVECPFIVPLKFSFQSQEKLYLVLAFINGGELFYHLQKEGR--FDLSRARFYT 475

Query: 426 KEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQM 481
            E++  ++ +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  
Sbjct: 476 AELLCALETLHGLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDKDKT-----DTFC 530

Query: 482 GTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLL 541
           GTP Y+APE L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +
Sbjct: 531 GTPEYLAPELLLGQGYS-----------KIVDWWTLGVLLYEMLTGLPPY-----YDEDV 574

Query: 542 AIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             M   I +  P   P G         L+   L+RDP+ R      +EI+   FF+
Sbjct: 575 PKMYKKI-LQEPLRFPDG--FDHDAKDLLIGLLSRDPKRRLGYHGAEEIRSHPFFS 627

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 131/287 (45%), Gaps = 35/287 (12%)

Query: 326  LLGKGGSSKVYK-VQDRTGKYYALKQILLEELDE--NLKTDLEREIELLKRLAREERVVK 382
             +G G    VY  V   TG   A+K+I   +      +   ++ E+ +L+ L     +V+
Sbjct: 1249 FIGGGSFGSVYSAVNLDTGDILAVKEIRFHDRKSMRQVFPSIKDEMTVLEML-NHPNIVQ 1307

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+ +L H R+    D    ++ S +++E +  +H+S +
Sbjct: 1308 YYGVEVHRDRVNIFMEYCEGGSLASLLEHGRIE---DEMVTQVYSLQLLEGLAYLHESGV 1364

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYR--------NTQMGTPNYMAPET 491
             H D+KP N +    G +K +DFG A  IA N   V          +  +GTP YM+PE+
Sbjct: 1365 HHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNGRDSTDKMIGTPMYMSPES 1424

Query: 492  LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
            + +  Y         K G   DIWS GC++ +M  G  P+++    D   AIM       
Sbjct: 1425 ISASGYG--------KFGS-DDIWSLGCVVLEMVTGRRPWANL---DNQWAIMYQVAAGQ 1472

Query: 552  YPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMII 598
             P+  P   ++  + +  +  CL +DP +R++  E+      +P I+
Sbjct: 1473 IPS-FPTKHEMSPTGIKFLSRCLIQDPNMRSSAVEL----LMDPWIV 1514

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 133/288 (46%), Gaps = 41/288 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + ++   +V  I+
Sbjct: 672 IGQGASGGVYTAYEVGTNASVAIKQMNLEK--QPKKELIINEI-LVMKASKHANIVNFID 728

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               + D  +V   ME G+  L+ V+   +     I  V   S+E ++ ++ +H   ++H
Sbjct: 729 SYLLRGDLWVVMEYMEGGS--LTDVVTHCILTEGQIGAV---SRETLKGLQFLHSKGVIH 783

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y    
Sbjct: 784 RDIKSDNILLSMTGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY---- 837

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKK 561
                  G   DIWS G ++ +M  G PPY   L    L A+    I  +   E      
Sbjct: 838 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY--LIATNGTPELKDADS 885

Query: 562 VPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDN 609
           +   L   +  CL+ DP  RAT  E          ++S PF+ +  D+
Sbjct: 886 LSDDLKGFLGWCLHVDPDERATASE----------LLSDPFIATYADD 923

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 135/284 (47%), Gaps = 46/284 (16%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELL 371
            +  +++ +G+G   KV     +  +Y  + +++++E         D  L T +  EI+++
Sbjct: 1001 DFVVLQKMGEGAYGKVNLCLHKKKRYIVVIKLIIKERILVDTWVRDRKLGT-IPSEIQIM 1059

Query: 372  KRLAR--EERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLM 424
              L +  +  ++ LI++  DD        V  E G  DL  ++  + N   ++    +L+
Sbjct: 1060 AALNKHPDGNILTLIDFFEDDDYYYIETPVHGETGCIDLFDLIELKTNMTEYE---AKLI 1116

Query: 425  SKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGT 483
             ++++  I+ +H   IVH D+K  N +   KG +KLIDFG A  +     +V+    +GT
Sbjct: 1117 FRQVVSAIRHLHSQGIVHRDIKDENVVVDSKGFVKLIDFGSAAYVKSGPFDVF----VGT 1172

Query: 484  PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
             +Y APE L  + +           GKP DIW+ G +LY + +   P+ +    D +L +
Sbjct: 1173 IDYAAPEVLSGEPFD----------GKPQDIWAIGVLLYTIVFKENPFYNI---DEILEV 1219

Query: 544  MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
               N++          K V +  + LIK  LN++P  R T DE+
Sbjct: 1220 ---NLKFH------GTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 128/274 (46%), Gaps = 35/274 (12%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   D  T    A+K++  E+  +  K  +  EI L+ + +R E +V  I+
Sbjct: 571 IGQGASGGVYTATDVNTEASVAIKKMNFEKQPK--KELIVNEI-LVMKASRHENIVNFID 627

Query: 386 YKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
               +  + V+ME      L+ V+   +     I+ V   ++E +  ++ +H   ++H D
Sbjct: 628 SYFLNGNLWVIMEYMKGGSLTDVVTHCILTEQQISTV---TRETLNGLRFLHSKGVIHRD 684

Query: 445 LKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXX 503
           +K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y      
Sbjct: 685 IKSDNVLLSLSGDIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY------ 736

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESPCG 559
                G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P+     
Sbjct: 737 -----GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPELKDPDS---- 784

Query: 560 KKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             + + L A +  CL  DP  RA+  E+ +  F 
Sbjct: 785 --LSECLKAFLDWCLKVDPHERASATELLNDRFI 816

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 15/214 (7%)

Query: 325 ELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K ++ RTGK +A+K I   ++  N+   + RE+E+L+RL    R+V L
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMGNMDG-VTRELEVLRRL-NHPRIVSL 249

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
             +  D     ++ME     DL   +    +   D    R ++++++E +K +H   I H
Sbjct: 250 KGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAG--REITRQVLEAVKYIHAMGISH 307

Query: 443 SDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
            DLKP N +  +     +K+ DFG+A KI DN    +  T  GT  Y+APE +  +N   
Sbjct: 308 RDLKPDNILIERDDPVLVKITDFGLA-KIQDN--GTFMKTFCGTLAYVAPEVISGKNSEE 364

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                  K     D+WS GC++Y +  GH P+S 
Sbjct: 365 KEGN---KYSSLVDMWSIGCLVYVILTGHLPFSG 395

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 113/217 (52%), Gaps = 26/217 (11%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + + +V+
Sbjct: 10  LEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHDNIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERV--NRP--FDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R   N P   +++ V+    ++ E I   H++
Sbjct: 68  LYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEGISFCHEN 127

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 128 KILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
           ++YS              D+WS GCIL +M  G P +
Sbjct: 184 RSYSTSI-----------DMWSCGCILAEMLTGKPLF 209

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 150/326 (46%), Gaps = 48/326 (14%)

Query: 323 IVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREE 378
           I++ LG+G   KV   Y +   TG+  ALK I  + L + +++  +EREI  L RL R  
Sbjct: 34  IIKTLGEGSFGKVKLAYHIT--TGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHP 90

Query: 379 RVVKLIEY-KIDDRMVQVLMECGNFDLSHVLH-ERVNRPFDINFVRLMSKEMIECIKAVH 436
            ++KL +  K  D +V V+   GN    +++  +++N     +  R   +++I  ++  H
Sbjct: 91  HIIKLYDVIKSKDEIVMVIEYAGNELFDYIVQRDKMNE----DEARRFFQQIISAVEYCH 146

Query: 437 DSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ 495
              IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  +
Sbjct: 147 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGK 203

Query: 496 NYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNE 555
            Y+          G   D+WS G ILY M     P+             + +I + + N 
Sbjct: 204 LYA----------GPEVDVWSSGVILYVMLCRRLPFD------------DESIPVLFKNI 241

Query: 556 SPCGKKVPQSLVA----LIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAI 611
           S     +P+ L      LIK  L  +P  R T  EI    +F    +  P  E LI   +
Sbjct: 242 SNGVYTLPKFLSPGASNLIKRMLIVNPLNRITIHEIMQDEWFK---VGMP--EYLIPPEL 296

Query: 612 NYGIENQNITQDRIKLLSNEVVSKLS 637
                N   + D I+ + + +VS LS
Sbjct: 297 KNESSNAQASNDNIEEVDDSLVSTLS 322

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 131/280 (46%), Gaps = 33/280 (11%)

Query: 321 LSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREER 379
             I E +G+G    VYK  D  T KY A+K I LE  DE++   L +EI  L  L + + 
Sbjct: 16  FDIKECVGRGNFGDVYKAIDNITKKYVAIKVINLEYSDEDIDL-LAQEIFFLAEL-KSDY 73

Query: 380 VVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDI--NFVRLMSKEMIECIKAVH 436
           ++  I   ++D  + ++M+ CG    S ++  ++  P  I    V  + K ++  ++ +H
Sbjct: 74  IINYITTIMEDVSMWIVMDYCGGGSCSDLI--KIVYPNGIVEEKVSFIVKNVLLGLQYLH 131

Query: 437 DSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETL--- 492
           +   +H D+K AN +    G +KL DFG++ +I      + R+T +GTP +MAPE +   
Sbjct: 132 EQKKIHRDIKAANILLTDDGQVKLGDFGVSGQIK---ATLKRDTFVGTPYWMAPEVINKE 188

Query: 493 ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDY 552
           I+  Y            +  DIWS G   Y++  G PP S +      + +M   ++   
Sbjct: 189 INNGYD-----------EKVDIWSLGITTYELLKGVPPLSKY----DPVKVMTSLVKRKP 233

Query: 553 PNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
           P          +S ++    CL +DP+LR     +    F
Sbjct: 234 PKLHGPYNDFTKSFISF---CLIKDPKLRPNVQNLLKTDF 270

>ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {ON}
           some similarities with uniprot|P48562 Saccharomyces
           cerevisiae YNL298W CLA4 Involved in localizing cell
           growth with respect to the septin ring protein kinase
           homologous to Ste20p interacts with CDC42
          Length = 907

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 146/323 (45%), Gaps = 58/323 (17%)

Query: 304 SQANLMSKQWSRITDEELS----IVELLGKGGSSKVYKVQ-----------------DRT 342
           S A +MSK  S   D + S    +VE  G+G S  VY  +                  + 
Sbjct: 593 SNAEIMSKLRSVTLDTDPSSFFDMVEKAGQGASGSVYLAKRAQLLPHPPEDVTNLDPPQI 652

Query: 343 GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--ME 398
           G   A+KQ++L +  +  K  +  EI ++K  +R + +V  +E   K DD +  ++  ME
Sbjct: 653 GDKVAIKQMILSK--QPRKELIVNEIIVMKD-SRHKNIVNFLEAYLKTDDDLWVIMEYME 709

Query: 399 CGNF-DL--SHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VK 454
            G+  D+  +    E  + P     +  + +E  + +K +HD +I+H D+K  N +   +
Sbjct: 710 GGSLTDIIENSAAMESNHSPLTEPQIAYIVRETCQGLKFLHDRNIIHRDIKSDNVLLDTR 769

Query: 455 GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDI 514
             +K+ DFG   K+ D      R T +GTP +MAPE +  + Y               D+
Sbjct: 770 ARVKITDFGFCAKLTDK--KSKRATMVGTPYWMAPEVVKQREYDEKV-----------DV 816

Query: 515 WSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK--- 571
           WS G +  +M  G PPY   L  D L A+      +   N +P   + P+ L   IK   
Sbjct: 817 WSMGIMTIEMLEGEPPY---LNEDPLKALY-----LIATNGTP-KLRSPERLSLEIKRFL 867

Query: 572 -TCLNRDPQLRATTDEIQHCSFF 593
             CL  D + RA+T+E+ H SFF
Sbjct: 868 SVCLCVDVKYRASTEELLHHSFF 890

>NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446
          Length = 684

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 135/287 (47%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 349 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTV--LARI 406

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  D++  VL      +L + L +     FD++  R  + E++  ++ 
Sbjct: 407 DCPFIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGR--FDLSRSRFYAAELLCALET 464

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H+ ++++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 465 LHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYLAPE 519

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  +  M   I  
Sbjct: 520 LLLGQGYT-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKILQ 563

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
           D P   P G    +    L+   L+RDP  R      DEI++  FF+
Sbjct: 564 D-PLRFPDG--FDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFS 607

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 128/276 (46%), Gaps = 44/276 (15%)

Query: 327  LGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRLARE- 377
            +G+G   KV     +  KY  + +++ +E         D  L T +  EI+++  L ++ 
Sbjct: 1186 MGEGAYGKVNLCMHKKEKYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKQP 1244

Query: 378  -ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECI 432
             E +++L+++  DD        +  E G  DL  ++ E  N   ++  V+L+ K+++  I
Sbjct: 1245 HENILRLLDFFEDDDYYYIETPIHGETGCIDLFDLI-ELKNNMTEME-VKLIFKQIVSGI 1302

Query: 433  KAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPET 491
            K +HD  I+H D+K  N I    G +KLIDFG A  +     +V+    +GT +Y APE 
Sbjct: 1303 KHLHDQAIIHRDIKDENVIVDATGFVKLIDFGSAAHVKSGPFDVF----VGTIDYAAPEV 1358

Query: 492  LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
            L    Y           GKP DIW+ G +LY + +   P   F   D +L       ++ 
Sbjct: 1359 LSGDPYE----------GKPQDIWAIGILLYTIVFKENP---FYNIDEIL-----EGELT 1400

Query: 552  YPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +   S     V     ALI   LNR+ Q R T D+I
Sbjct: 1401 FSESS----DVSAECKALISMILNRNVQKRPTIDDI 1432

>Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {ON}
            YNR031C (REAL)
          Length = 1376

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 136/304 (44%), Gaps = 50/304 (16%)

Query: 326  LLGKGGSSKVY-KVQDRTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G   +VY  V    G+  A+K+I L +     K    ++ E+ +L+ L     VV+
Sbjct: 1079 FIGGGTFGQVYSAVNLENGEILAVKEINLHDTKTMKKIFPLIKEEMNVLEML-NHPNVVQ 1137

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+ +L H R+    D    ++ + E++E +  +H S +
Sbjct: 1138 YYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIE---DEMVTQVYTLELLEGLTYLHQSGV 1194

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNT-------------------Q 480
            VH D+KP N +    G +K +DFG A    + +    RN                     
Sbjct: 1195 VHRDIKPENILLDFNGIIKYVDFGTARTFVETSTRAMRNATINDLDLPESEPETNYMDGM 1254

Query: 481  MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL 540
            MGTP YMAPET IS + +        K+G   D+W+ GC++ +M  G  P+S+    D  
Sbjct: 1255 MGTPMYMAPET-ISGSAAKG------KLG-ADDVWALGCVVLEMVTGRRPWSNL---DNE 1303

Query: 541  LAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDE---------IQHCS 591
             AIM  ++   +  + P   +V     A ++ CL +DP  RA+  E         I+  +
Sbjct: 1304 WAIMY-HVAAGHIPQFPNKDEVTSKGRAFLERCLVQDPASRASAVELLIDPWMAQIRDIA 1362

Query: 592  FFNP 595
            F NP
Sbjct: 1363 FGNP 1366

>TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {ON}
           Anc_2.446 YMR104C
          Length = 774

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 135/287 (47%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           E+  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 439 EDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTV--LARV 496

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L + L +R  R FD++  R  + E++  ++ 
Sbjct: 497 DCPFIVPLKFSFQSPEKLYLVLACINGGELFYHL-QREGR-FDLSRARFYTAELLCALET 554

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 555 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDKDKT-----DTFCGTPEYLAPE 609

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 610 LLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDIPKMYKKI-L 652

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             P   P G    +    L+   L+RDP+ R       EI+   FF+
Sbjct: 653 QEPLRFPDG--FDRDAKDLLIGLLSRDPKRRLGYNGASEIKSHPFFS 697

>Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687
           aa] {ON} (138831..140555,140557..140895) [2064 nt, 688
           aa]
          Length = 687

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 139/295 (47%), Gaps = 51/295 (17%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLARE 377
           ++  +++++GKG   KV +V+ + T K YALK I         K  +  + E+   LA +
Sbjct: 352 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIR--------KAYIVSKAEVTHTLAEK 403

Query: 378 ERVVKL---------IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEM 428
             + K+           ++  +++  VL      +L +  H +    FD++  R  + E+
Sbjct: 404 TVLAKVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFY--HLQKEGRFDLSRSRFYAAEL 461

Query: 429 IECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTP 484
           +  ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP
Sbjct: 462 LCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDKDKT-----DTFCGTP 516

Query: 485 NYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIM 544
            Y+APE L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M
Sbjct: 517 EYLAPELLLGQGYS-----------KVVDWWTLGVLLYEMLTGLPPY-----YDEDVPKM 560

Query: 545 NPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPM 596
              I +  P   P G  + +    L+   L+RDP+ R      +EI++  FF+ +
Sbjct: 561 YKKI-LQEPLRFPDG--IDKDARDLLIGLLSRDPKRRLGFNGAEEIKNHPFFSQL 612

>Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {ON}
           complement(76786..79428) [2643 nt, 881 aa]
          Length = 880

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 137/305 (44%), Gaps = 60/305 (19%)

Query: 323 IVELLGKGGSSKVYKVQDR-------------------TGKYYALKQILLEELDENLKTD 363
           ++E  G+G S  VY  + +                    G   A+KQ++L +  +  K  
Sbjct: 587 MIEKAGQGASGSVYLAERQQIQSNNLEMIQSTNEEKAHIGDKVAIKQMILSK--QPRKEL 644

Query: 364 LEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--MECGNFDLSHVLHE-----RVNR 414
           +  EI ++K  +R + +V  +E   K +D +  V+  ME G+  L+ ++         N 
Sbjct: 645 IVNEILVMKD-SRHKNIVNFLEAYLKTEDDLWVVMEFMEGGS--LTDIIENSPANGETNS 701

Query: 415 PFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTL 473
           P     +  + +E  + +K +HD  I+H D+K  N +   +  +K+ DFG   K+ D   
Sbjct: 702 PLTEGQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCAKLTDQ-- 759

Query: 474 NVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
              R T +GTP +MAPE +  + Y               D+WS G +  +M  G PPY  
Sbjct: 760 RSKRATMVGTPYWMAPEVVKQREYDEKV-----------DVWSLGIMSIEMLEGEPPY-- 806

Query: 534 FLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK----TCLNRDPQLRATTDEIQH 589
            L  D L A+      +   N +P  K  P+SL   IK     CL  D + RA+T+E+ H
Sbjct: 807 -LNEDPLKALY-----LIATNGTPKLKH-PESLSLEIKRFLSVCLCVDVRYRASTEELLH 859

Query: 590 CSFFN 594
            +FFN
Sbjct: 860 HTFFN 864

>Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {ON}
            YCR073C (REAL)
          Length = 1334

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 130/284 (45%), Gaps = 37/284 (13%)

Query: 326  LLGKGGSSKVY-KVQDRTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G   +VY  +    G+  A+K+I + ++    K    ++ E+ +L+ L     VV+
Sbjct: 1039 FIGGGTFGQVYSAINLENGEILAVKEIKMHDIKTMKKIFPLIKEEMTVLEML-NHPNVVQ 1097

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
                ++    V + ME C    L+ +L     R  D    ++ + E++E +  +H S +V
Sbjct: 1098 YYGVEVHRDKVNIFMEYCEGGSLASLLDR--GRIEDEMVTQVYTLELLEGLVYLHKSGVV 1155

Query: 442  HSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYR-----------------NTQMGT 483
            H D+KP N +    G +K +DFG A  + +++    +                 N  MGT
Sbjct: 1156 HRDIKPENILLDFNGIIKYVDFGTARTVVESSTRALQKAATGDLQEAEPETKPVNCMMGT 1215

Query: 484  PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
            P YMAPE +              K+G   D+W+ GC++ +M  G  P+S+    D   AI
Sbjct: 1216 PMYMAPEAISGSTVKG-------KLG-ADDVWALGCVVLEMATGRRPWSNL---DNEWAI 1264

Query: 544  MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            M  ++   +  + P   ++  +  A ++ CL +DP +RAT  E+
Sbjct: 1265 MY-HVAAGHVPQLPSTDEMTPAGRAFLERCLVQDPSMRATATEL 1307

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 128/282 (45%), Gaps = 36/282 (12%)

Query: 326  LLGKGGSSKVY-KVQDRTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G   +VY  +    G+  A+K+I + +     K    ++ E+ +L+ L     +V+
Sbjct: 1039 FIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEML-NHPNIVQ 1097

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+ +L H R+    D    ++ + E++E +  +H S +
Sbjct: 1098 YYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIE---DEMVTQVYTFELLEGLAYLHQSGV 1154

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNT--------------QMGTPN 485
            VH D+KP N +    G +K +DFG A  +  +     RN                MGTP 
Sbjct: 1155 VHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPM 1214

Query: 486  YMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN 545
            YMAPET+              K+G   D+W+ GC++ +M  G  P+S+    D   AIM 
Sbjct: 1215 YMAPETISGSAVKG-------KLG-ADDVWALGCVVLEMATGRRPWSNL---DNEWAIMY 1263

Query: 546  PNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
                   P + P   ++  +  A ++ CL +DP +RAT  E+
Sbjct: 1264 HVAAGRIP-QLPNRDEMTAAGRAFLERCLVQDPTMRATAVEL 1304

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 128/262 (48%), Gaps = 25/262 (9%)

Query: 281 SKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD 340
           S ++N    T P + +  P  V +    + K +S I        E++G+G  + V K  +
Sbjct: 165 SNLKNASKTTSPGLTSSTPSVVAAHKTGIFKDFSIID-------EVVGQGAFATVKKAIE 217

Query: 341 RT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLME- 398
           RT GK +A+K I   ++  N+   + RE+E+L++L    R+V+L  +  D     ++ME 
Sbjct: 218 RTTGKTFAVKIISKRKVIGNMD-GVTRELEVLQKL-HHPRIVRLKGFYEDTESYYMVMEF 275

Query: 399 CGNFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT 456
               DL   +  H  V      +  R +S++++E +K +H   I H DLKP N +  +  
Sbjct: 276 VSGGDLMDFVAAHGAVGE----DAGREISRQILEAVKYIHSMGISHRDLKPDNILIEQDD 331

Query: 457 ---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPS- 512
              +K+ DFG+A K+  N    +  T  GT  Y+APE +  ++ S        +    S 
Sbjct: 332 PVLVKITDFGLA-KVQGN--GSFMKTFCGTLAYVAPEVIRGKDSSVSPDEYEERNEYSSL 388

Query: 513 -DIWSYGCILYQMTYGHPPYSS 533
            D+WS GC++Y +  GH P+S 
Sbjct: 389 VDMWSMGCLVYVILTGHLPFSG 410

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 114/217 (52%), Gaps = 22/217 (10%)

Query: 326 LLGKGGSSKVYKVQDR-TGKYYALKQI----LLEELDENLKTDLEREIELLKRLAREERV 380
           ++G+G  + V K  +R TGK +A+K I    ++++ D      ++RE+++L++L    R+
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD-----GVKRELDVLQKL-NHPRI 250

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
           VKL ++  D+    +LME     DL   +        D    R ++++++E +K +HD  
Sbjct: 251 VKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAG--REITRQVLEAVKYMHDQG 308

Query: 440 IVHSDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQN 496
           I H DLKP N +  +     +K+ DFG+A K+ +   N + NT  GT  Y+APE +  +N
Sbjct: 309 ISHRDLKPDNIMIEQDDPVLIKITDFGLA-KVQNQ--NTFLNTFCGTLAYVAPEVIDGKN 365

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                    +      D+WS GC++Y +  GH P+S 
Sbjct: 366 AEDKTNRDLYS--SLVDMWSIGCLVYVILTGHLPFSG 400

>NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa]
           {ON} Anc_2.496
          Length = 893

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 133/274 (48%), Gaps = 35/274 (12%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  + +  A+KQ+ LE+  +  K  +  EI L+ + +R   +V  I+
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPK--KELIINEI-LVMKGSRHPNIVNFID 673

Query: 386 YKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
             + D  + V+ME      L+ V+   +     I  V    +E +  ++ +H   ++H D
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAV---CRETLSGLQFLHSKGVLHRD 730

Query: 445 LKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXX 503
           +K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y      
Sbjct: 731 IKSDNILLSISGDIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY------ 782

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVP 563
                G   DIWS G ++ +M  G PPY   L    L A+      +   N +P  K+ P
Sbjct: 783 -----GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIATNGTPELKE-P 828

Query: 564 QSLVALIKT----CLNRDPQLRATTDEIQHCSFF 593
           ++L A+++     CL  DP+ RA+  ++ +  F 
Sbjct: 829 ENLSAVLRNFLDWCLKVDPEQRASATDLLNDVFI 862

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 128/270 (47%), Gaps = 39/270 (14%)

Query: 327  LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
            +G+G S  VY   +  T    A+KQ+ LE+     KT+L     ++ + ++ + +V  I+
Sbjct: 1033 IGQGASGGVYTAYEVGTNASVAVKQMNLEK---QPKTELIINEIIVMKESKHKNIVNFID 1089

Query: 386  ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
                K D  +V   ME G+  L+ V+   +     I  V    +E +  +K +H   ++H
Sbjct: 1090 SYLLKGDLWVVMEYMEGGS--LTDVVTHCILTEGQIGAV---CRETLNGLKFLHSKGVIH 1144

Query: 443  SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
             D+K  N +  ++G +KL DFG   +I  N +++ R T +GTP +MAPE +  + Y    
Sbjct: 1145 RDIKSDNILLSMQGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVVSRKEY---- 1198

Query: 502  XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESP 557
                   G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P    
Sbjct: 1199 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPELKEP---- 1244

Query: 558  CGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              +K+   L   +  CL  DP++RAT  E+
Sbjct: 1245 --EKLSSILHNFLDACLKVDPEVRATATEL 1272

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 111/214 (51%), Gaps = 13/214 (6%)

Query: 325 ELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K V+ +TGK +A+K I   ++  N++  + RE+E+L RL    R+V L
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKRKVMGNVEG-VTRELEVLHRL-NHPRIVSL 251

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
             +  D+    +LME     DL   +    +   D    R ++++++E +K +H  +I H
Sbjct: 252 KGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHQQEISH 309

Query: 443 SDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
            DLKP N +  +     +K+ DFG+A KI DN    +  T  GT  Y+APE +  ++   
Sbjct: 310 RDLKPDNILIEQDDPVLVKITDFGLA-KIQDN--GTFMKTFCGTLAYVAPEVIDGKSLEE 366

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                        D+WS GC++Y +  GH P+S 
Sbjct: 367 KSVNKNL-YSSLVDMWSIGCLVYVILTGHLPFSG 399

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/228 (28%), Positives = 114/228 (50%), Gaps = 33/228 (14%)

Query: 325 ELLGKGGSSKVYKVQDR-TGKYYALKQILLE---ELDENLKTDLEREIELLKRLAREERV 380
           +++G+G    VY+   R T K  A+KQI  E   EL+E++      EI+LLK L R + +
Sbjct: 14  QVIGRGAYGVVYRAVKRGTNKPCAIKQIEFEDESELNEHM-----LEIDLLKNL-RHQNI 67

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           V+   +      + +++E C    L  +L H  +     +N+V     + +  ++ +H+ 
Sbjct: 68  VEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLEDDTVNYV----TQTLYGLQYLHEQ 123

Query: 439 DIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            ++H D+K AN +  + G +KL DFG++ +I     N    T  G+PN+MAPE +  Q  
Sbjct: 124 GVIHRDIKAANLLLTEEGIVKLADFGVSTRI-----NRMAMTYAGSPNWMAPEVMTGQGA 178

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN 545
           S             SDIWS G  + ++  G+PP+ + +      AI+N
Sbjct: 179 STV-----------SDIWSLGATVVELLTGNPPFHNLVNESACYAIVN 215

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 145/320 (45%), Gaps = 55/320 (17%)

Query: 310 SKQWSRITDEELSIVELLGKGGSSKVYKV-QDRTGKYYALKQILLEELDENLKTDLEREI 368
           +KQ++ +T         +G+G S  VY   Q ++ +  A+KQ+ LE+  +  K  +  EI
Sbjct: 514 TKQYANLTK--------IGQGASGGVYTANQVKSNELVAIKQMDLEK--QPKKELILNEI 563

Query: 369 ELLKRLAREERVVKLIEYKIDDR---MVQVLMECGNFD--LSHVLHERVNRPFDINFVRL 423
            ++K  +R   VV  I   +      +V   ME G+    ++H L            +  
Sbjct: 564 IVMKE-SRHNNVVNFINAHLSKGNLWIVMEYMEGGSLTDVVTHCLLSEGQ-------IGA 615

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMG 482
           + +E +E +K +H   ++H D+K  N +  +KG +KL DFG   +I D  LN  R T +G
Sbjct: 616 VCRETLEGLKFLHSKGVIHRDIKSDNVLLSMKGDIKLTDFGFCAQINDIDLN--RTTMVG 673

Query: 483 TPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLA 542
           TP +MAPE +  + Y           G   DIWS G ++ +M  G PPY   L    L A
Sbjct: 674 TPYWMAPEVVSRKEY-----------GPKVDIWSLGIMIIEMIEGEPPY---LNEAPLKA 719

Query: 543 IMNPNIQIDYPNESPCGKKVPQSLVALIKT----CLNRDPQLRATTDEIQHCSFF----N 594
           +      +   N +P  K+ P++L  +       CL  +P+ RA+  E+    F      
Sbjct: 720 LY-----LIATNGTPKLKE-PENLSDVFSNFLDRCLRVEPEERASAIELLADEFVVACAE 773

Query: 595 PMIISKPFLESLIDNAINYG 614
           P I   P +   + N ++ G
Sbjct: 774 PTISLAPLVRLSLANKLSEG 793

>Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W
           (REAL)
          Length = 864

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 93/328 (28%), Positives = 150/328 (45%), Gaps = 63/328 (19%)

Query: 304 SQANLMSKQWSRITDEELSI----VELLGKGGSSKVYKVQDRT----------------- 342
           S A +MSK  S   + + SI    +E  G+G S  VY + +RT                 
Sbjct: 547 STAEIMSKLKSVTVNADPSICFKVIEKAGQGASGSVY-LAERTYIPTESNMIELMNNEID 605

Query: 343 ----GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL 396
               G   A+KQ++L +  +  K  +  EI ++K  +R + +V  +E   + DD +  V+
Sbjct: 606 EPQVGDKVAIKQMILSK--QPRKELIVNEILVMKD-SRHKNIVNFLEAYLRTDDDLWVVM 662

Query: 397 --MECGNF-DL--SHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFI 451
             ME G+  D+  +   ++    P     +  + +E  + +K +HD  I+H D+K  N +
Sbjct: 663 EFMEGGSLTDIIENSPANDTSRSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVL 722

Query: 452 F-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGK 510
              +  +K+ DFG   ++ D      R T +GTP +MAPE +  + Y         KI  
Sbjct: 723 LDTRARVKITDFGFCARLTDK--RSKRATMVGTPYWMAPEVVKQREYDE-------KI-- 771

Query: 511 PSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALI 570
             D+WS G +  +M  G PPY   L  D L A+      +   N +P   K P++L   I
Sbjct: 772 --DVWSLGIMTIEMLEGEPPY---LNEDPLKALY-----LIATNGTP-KLKYPETLSLEI 820

Query: 571 K----TCLNRDPQLRATTDEIQHCSFFN 594
           K     CL  D + RA+T+E+ H  FFN
Sbjct: 821 KRFLSVCLCVDVRYRASTEELLHHGFFN 848

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 109/216 (50%), Gaps = 16/216 (7%)

Query: 325 ELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K  +RT GK YA+K I   ++  NL   + RE+E+LKRL    R+V L
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMGNLDG-VTRELEVLKRL-NHPRIVSL 248

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
             +  D+    ++ME     DL   +  H  V      +  + +S++++E +K +H   I
Sbjct: 249 KGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGE----DAGKEISRQILEAVKYIHSMGI 304

Query: 441 VHSDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            H DLKP N +  +     +K+ DFG+A    + T   +  T  GT  Y+APE + S + 
Sbjct: 305 SHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVIGSSSK 361

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                    +     D+WS GC++Y +  GH P+S 
Sbjct: 362 YNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPFSG 397

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 131/277 (47%), Gaps = 46/277 (16%)

Query: 327  LGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRLARE- 377
            +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++  L ++ 
Sbjct: 1102 MGEGAYGKVNLCIHKKNRYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKKP 1160

Query: 378  -ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVN-RPFDINFVRLMSKEMIEC 431
             E +++L+++  DD        V  E G  DL  ++  + N   F+    +L+ K+++  
Sbjct: 1161 HENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFE---AKLIFKQVVAG 1217

Query: 432  IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPE 490
            IK +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT +Y APE
Sbjct: 1218 IKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPE 1273

Query: 491  TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
             L    Y           G+P DIW+ G +LY + +   P+ +      +  I+  +++ 
Sbjct: 1274 VLGGNPYE----------GQPQDIWAIGILLYTVVFKENPFYN------IDEILEGDLKF 1317

Query: 551  DYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +   E      V +  + LIK+ LNR    R T D+I
Sbjct: 1318 NNAEE------VSEDCIELIKSILNRCVPKRPTIDDI 1348

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 139/303 (45%), Gaps = 40/303 (13%)

Query: 309 MSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTD-LER 366
           ++K   ++  ++    E LG G  S V     R +GK YA+K +  E L    K   +  
Sbjct: 113 LTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTV 172

Query: 367 EIELLKRLAREERVVKLIEYKIDDRMVQVLMEC---GNFDLSHVLHERVNRPFDINFVRL 423
           E   L++L   + + KL     D+  +  L+E    G+F      +  +N        R 
Sbjct: 173 EKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNE----TCARY 228

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT-LKLIDFGIA-------NKIADNT--L 473
            + ++I+ + ++H+  I+H D+KP N +  K   +KL DFG A       +  AD     
Sbjct: 229 YASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYF 288

Query: 474 NVYRNTQ--MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
           ++Y  ++  +GT  Y++PE L++ NY+              DIW++GCILYQM  G PP+
Sbjct: 289 DLYAKSKSFVGTAEYVSPE-LLNDNYTDSR----------CDIWAFGCILYQMLAGKPPF 337

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCS 591
            +   +     +M    +I Y   +      PQ +  L+K  L RDP  R T  +I+   
Sbjct: 338 KAANEYLTFQKVM----KIQYAFTA----GFPQIVKDLVKKLLVRDPNDRLTIKQIKAHL 389

Query: 592 FFN 594
           FF+
Sbjct: 390 FFH 392

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 86.3 bits (212), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 129/277 (46%), Gaps = 40/277 (14%)

Query: 327 LGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G    VYK +D    +  A+K + LE  +E ++  L +EI  L  L +   V   I 
Sbjct: 11  IGRGNFGDVYKAKDTWLNEVVAVKVVNLENSEEEVEL-LAQEIFFLAEL-KSPYVTNYIA 68

Query: 386 YKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
             ++D  + + ME CG   +  +L          +  R +++E+++ +  +H    +H D
Sbjct: 69  TVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQRKIHRD 128

Query: 445 LKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLI--SQNYSXXX 501
           +K AN +   +G +KL DFG++ K+  +     R+T +GTP +MAPE +   S+ Y    
Sbjct: 129 IKAANILLTDEGKVKLSDFGVSGKLLSS---FRRDTFVGTPYWMAPEIVAHDSEGYDER- 184

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMN------PNIQIDYPNE 555
                     +DIWS G  + +M  G PP S +   D +  I N      P +  D+ ++
Sbjct: 185 ----------ADIWSLGITVIEMLRGSPPLSKY---DPMKVIANLPKRKPPKLHGDFSDD 231

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
           +       +  VAL   CL ++  +R T  ++    F
Sbjct: 232 A-------KHFVAL---CLIKESAIRPTAADLLTTRF 258

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 149/326 (45%), Gaps = 39/326 (11%)

Query: 283 IQNKKHQTIPKIEAPVPQSVPS-QANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD- 340
           +Q ++ +   +  A + + VP  Q   ++KQ  +    +    E LG G  S V      
Sbjct: 116 MQRRQKEWADRGAAMIVKDVPDKQTGKITKQVIKKGINDFKFGETLGDGSYSTVLLATSI 175

Query: 341 RTGKYYALKQILLEELDENLKTD-LEREIELLKRLAREERVVKLIEYKIDDRMVQVLMEC 399
            + K YA+K +  E L +  K   +  E   L+RL   + ++ L     D+  +  L+E 
Sbjct: 176 ESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLKNTKGIISLYFTFQDESSLYFLLEY 235

Query: 400 G-NFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKG 455
             N DL  ++  H  VN        +  + ++I+ +  +HD  ++H DLKP N +  V  
Sbjct: 236 APNGDLLSLMRKHGSVNE----KCTQYYAAQIIDALGFMHDKGVIHRDLKPENILLDVDM 291

Query: 456 TLKLIDFGIANKIADNT--------LNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWK 507
            +KL DFG A ++ D+T        L    N+ +GT  Y++PE L++ NY          
Sbjct: 292 KVKLTDFGTA-RLLDSTSEDDLKYDLLTRSNSFVGTAEYVSPE-LLNDNY---------- 339

Query: 508 IGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLV 567
           +    DIW++GCIL+QM  G PP+ +   +     +M   +Q  +          P ++ 
Sbjct: 340 VDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVM--KVQFAF------TAGFPMTVR 391

Query: 568 ALIKTCLNRDPQLRATTDEIQHCSFF 593
            L+K  L ++P+ R   ++I+   FF
Sbjct: 392 DLVKNILIKNPERRLLINQIKAHQFF 417

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 119/236 (50%), Gaps = 32/236 (13%)

Query: 305 QANLMSKQWS-RITDEELSIVELLGKGGSSKVYKVQ-DRTGKYYALKQI---LLEELDEN 359
           Q NL  K  S + + ++  I+  LG G   +V+ ++ +  G++YALK +   L+ +L + 
Sbjct: 97  QPNLQGKPTSGKYSLKDFQILRTLGTGSFGRVHLIRSNHNGRFYALKILKKRLIVKLKQV 156

Query: 360 LKTDLEREIELLKRLAREERVVKL---IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPF 416
             T+ ER   L+  L     +V++    +  +   MV   +E G  +L  +L  R ++ F
Sbjct: 157 EHTNDER---LMLSLVSHPFIVRMWGTFQDSVHLYMVMDYVEGG--ELFSLL--RKSQRF 209

Query: 417 DINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNV 475
                +  + E+   ++ +H  DI++ DLKP N +  K G +KL DFG A  + D T   
Sbjct: 210 PNPVAKFYAAEVCLSLEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTY-- 267

Query: 476 YRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
              T  GTP+Y+APE + ++ Y+           K  D WS+G ++Y+M  GH P+
Sbjct: 268 ---TLCGTPDYIAPEVVSTKPYN-----------KSVDWWSFGILIYEMLAGHTPF 309

>CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} similar
           to uniprot|P32490 Saccharomyces cerevisiae YOR231w MKK1
           ser/thr protein kinase or uniprot|P32491 Saccharomyces
           cerevisiae YPL140c MKK2
          Length = 467

 Score = 85.9 bits (211), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 136/290 (46%), Gaps = 44/290 (15%)

Query: 320 ELSIVELLGKGGSSKVYKVQDRTGK-YYALKQILLEELDENLKTDLEREIELLKRLAREE 378
           E+    +LG+G    V K + RTGK  +ALK I +   D   +  L RE++  K   + E
Sbjct: 179 EIETQGVLGEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQKQLLRELQFNKSF-KSE 237

Query: 379 RVVKLIEYKIDDR--MVQVLME-CGNFDLSHVLHERVNRPFDIN--FVRLMSKEMIECIK 433
            +V+      D++   + + ME  G   L  +  E ++R   I+   +  +S+ ++  + 
Sbjct: 238 YIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRGLS 297

Query: 434 AVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETL 492
            +H+  ++H D+KP N +  + G +KL DFG++ +     +N    T  GT  YMAPE +
Sbjct: 298 YLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGE----AVNSLATTFTGTSYYMAPERI 353

Query: 493 ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI-- 550
             Q YS              D+WS G  + ++  GH P+    G D++   + P I++  
Sbjct: 354 QGQPYSVT-----------CDVWSLGLTILEVAQGHFPF----GPDKMATTIAP-IELLT 397

Query: 551 ----------DYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDE-IQH 589
                     D P+++    K  ++  + I+ CL ++ + R +  + IQH
Sbjct: 398 LILTFTPHLDDEPDKN---IKWSRAFKSFIEYCLRKEARARPSPRQMIQH 444

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 125/275 (45%), Gaps = 29/275 (10%)

Query: 323 IVELLGKGGSSKV-YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREERV 380
           IV+ LG+G   KV       TG+  ALK I  + L + +++  +EREI  L RL R   +
Sbjct: 63  IVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHPHI 121

Query: 381 VKLIEY-KIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
           +KL +  K  D ++ V+   GN    +++          N  R   +++I  ++  H   
Sbjct: 122 IKLYDVIKSKDEIIMVMEYAGNELFDYIVQRD---KMSENEARRFFQQIISAVEYCHRHK 178

Query: 440 IVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  + Y+
Sbjct: 179 IVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLYA 235

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPC 558
                     G   D+WS G ILY M     P+      D  + ++  NI          
Sbjct: 236 ----------GPEVDVWSSGVILYVMLCRRLPFD-----DESIPVLFKNIN---NGVYTI 277

Query: 559 GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            K + Q   +LIK  L  +P  R +  EI    +F
Sbjct: 278 PKFLSQGASSLIKRMLIVNPLNRISISEIMQDEWF 312

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 134/287 (46%), Gaps = 35/287 (12%)

Query: 316 ITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRL 374
           +T  +  ++ ++GKG    VYK  +R T +  A+KQ+  +  DE L  D+  EI LLK L
Sbjct: 74  VTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYDN-DEELN-DIMSEINLLKNL 131

Query: 375 AREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIK 433
              + +VK   +      + +L+E C +  L +++      P      +   + +I+ + 
Sbjct: 132 -NHKHIVKYHGFMQKSDTLYILLEYCAHGSLKNLISSSKGIP-----EKDAQQYIIQTLY 185

Query: 434 AV---HDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAP 489
            +   H   ++H D+K AN +  K  T+KL DFG++ ++ + T+ +   T  G+ N+MAP
Sbjct: 186 GLVYLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGSLNWMAP 242

Query: 490 ETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ 549
           E L ++  S             SDIWS G  + ++  G+PP+ + +  +   AI N N  
Sbjct: 243 EILGNKGASTL-----------SDIWSLGATVVELITGNPPFHNLVDINIYYAIENDNY- 290

Query: 550 IDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPM 596
                  P      ++ +  +  C  ++   R T  ++ +  +  PM
Sbjct: 291 ------IPPEGAFSETAIDFLNLCFKKNMYRRPTAQQLLNHKWLQPM 331

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 132/279 (47%), Gaps = 46/279 (16%)

Query: 327  LGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRLARE- 377
            +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++  L ++ 
Sbjct: 1102 MGEGAYGKVNLCIHKKERYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKKP 1160

Query: 378  -ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVN-RPFDINFVRLMSKEMIEC 431
             E +++L+++  DD        V  E G  DL  ++  + N   F+    +L+ K+++  
Sbjct: 1161 HENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFE---AKLIFKQVVAG 1217

Query: 432  IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPE 490
            IK +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT +Y APE
Sbjct: 1218 IKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPE 1273

Query: 491  TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
             L    Y           G+P DIW+ G +LY + +   P+ +      +  I+  +++ 
Sbjct: 1274 VLGGNPYE----------GQPQDIWAIGILLYTVVFKENPFYN------IDEILEGDLKF 1317

Query: 551  DYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQH 589
            +   E      V +  + LIK+ LNR    R T D+I +
Sbjct: 1318 NNAEE------VSEDCIELIKSILNRRVPNRPTIDDINN 1350

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 132/279 (47%), Gaps = 46/279 (16%)

Query: 327  LGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRLARE- 377
            +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++  L ++ 
Sbjct: 1103 MGEGAYGKVNLCIHKKNRYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKKP 1161

Query: 378  -ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLMSKEMIEC 431
             E +++L+++  DD        V  E G  DL  ++  + N   F+    +L+ K+++  
Sbjct: 1162 HENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFE---AKLIFKQVVAG 1218

Query: 432  IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPE 490
            IK +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT +Y APE
Sbjct: 1219 IKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPE 1274

Query: 491  TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
             L    Y           G+P DIW+ G +LY + +   P+ +      +  I+  +++ 
Sbjct: 1275 VLGGNPYE----------GQPQDIWAIGILLYTVVFKENPFYN------IDEILEGDLKF 1318

Query: 551  DYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQH 589
            +        + V +  + LIK+ LNR    R T D+I +
Sbjct: 1319 N------NAEGVSEDCIELIKSILNRCVPKRPTIDDINN 1351

>KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} similar
           to uniprot|P41808 Saccharomyces cerevisiae YPR054W SMK1
           Mitogen-activated protein kinase required for spore
           morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 411

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 110/239 (46%), Gaps = 31/239 (12%)

Query: 317 TDEELSIVELLGKGGSSKVYKVQDRTG----KYYALKQILLEELDENLKTDLEREIELLK 372
           T     I+++LGKG    V    D+ G    +  A+K++      E L     RE++ L 
Sbjct: 64  TPGNFDILQVLGKGSYGTVVSAIDKNGSGKPRRLAIKKVTNIFAREILLKRAIRELKFLN 123

Query: 373 RLAREERVVKLIEYKIDDR----MVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEM 428
                + +V +++ +I        +    E   +DL+ V+H  V   F    +R    ++
Sbjct: 124 FFRGHKNIVSIVDLEIVTEKPYDGLYCYQELVEYDLARVIHSTVQ--FSEFHIRHFLYQI 181

Query: 429 IECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYM 487
           +  +K +H +++VH DLKP N +  + GTLK+ DFG+A  IA       +  ++   NY+
Sbjct: 182 LCGLKYIHSAEVVHRDLKPGNILCSINGTLKICDFGLARGIAQRHFGT-KGAELSITNYV 240

Query: 488 ------APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL 540
                 APE ++S+           K  K  D+W+ GCIL +  YG  P   F+G D L
Sbjct: 241 ATRWYRAPELILSRK----------KYTKAIDMWAVGCILAEF-YGRKPI--FMGQDSL 286

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 129/281 (45%), Gaps = 41/281 (14%)

Query: 323 IVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREE 378
           I++ LG+G   KV   Y +   TG+  ALK I  + L + +++  +EREI  L RL R  
Sbjct: 37  IIKTLGEGSFGKVKLAYHIS--TGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHP 93

Query: 379 RVVKLIEY-KIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHD 437
            ++KL +  K  D ++ V+   GN    +++ +R   P      R   +++I  +   H 
Sbjct: 94  HIIKLYDVIKSKDEIIMVIEYAGNELFDYIV-QRDKMPE--QEARRFFQQIISAVDYCHR 150

Query: 438 SDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQN 496
             IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  + 
Sbjct: 151 HKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKL 207

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES 556
           Y+          G   D+WS G ILY M              R L   + +I + + N S
Sbjct: 208 YA----------GPEVDVWSSGVILYVMLC------------RRLPFDDESIPVLFKNIS 245

Query: 557 PCGKKVP----QSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
                +P    Q   +LIK  L  +P  R T  EI    +F
Sbjct: 246 NGVYTIPNFLSQGAASLIKKMLIVNPVNRITVHEIMQDEWF 286

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 110/225 (48%), Gaps = 34/225 (15%)

Query: 323  IVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRL 374
            I++ +G+G   KV     +  KY  + +++ +E         D  L T +  EI+++  L
Sbjct: 1124 ILQKMGEGAYGKVNMCIHKVKKYIVVIKMIFKERILVDTWVRDRQLGT-IPSEIQIMATL 1182

Query: 375  ARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLMSKE 427
             ++  + ++ L+++  DD        V  E G  DL  ++  + N   F+    +L+ K+
Sbjct: 1183 NKKPHDNILSLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTEFE---AKLIFKQ 1239

Query: 428  MIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNY 486
            ++  IK +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT +Y
Sbjct: 1240 IVSGIKHLHDQGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVKSGPFDVF----VGTIDY 1295

Query: 487  MAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
             APE L  + Y           GKP DIW+ G +LY + +   P+
Sbjct: 1296 AAPEVLSGEPYE----------GKPQDIWAIGILLYTIVFKENPF 1330

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 150/340 (44%), Gaps = 56/340 (16%)

Query: 275  LIRDYNSKIQNKKHQTIPKIEAPVPQSVPSQANLMSKQWSRITD------------EELS 322
            LI    S   NK + ++     PVP S   +A    + +    +             E  
Sbjct: 905  LIMSLKSLSPNKGNGSLASTSPPVPNSSSEEAGGQGEVFLSTPEPNIGSLKHVKKFSEFE 964

Query: 323  IVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRL 374
            +++ +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++  L
Sbjct: 965  VLQKMGEGAYGKVDLCLHKKDRYIVVIKLIFKERILVDTWVRDRKLGT-IPSEIQIMATL 1023

Query: 375  ARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEM 428
              +  E ++ L+++  DD        +    G+ DL  ++  + +     +  +L+ K++
Sbjct: 1024 NTKPHENILMLLDFFEDDEYYYIETPIHGTSGSVDLFDLIELKTD--MTEHEAKLIFKQI 1081

Query: 429  IECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYM 487
            +  IK +HD+ IVH D+K  N I    G +K+IDFG A  +     +V+    +GT +Y 
Sbjct: 1082 VSGIKHLHDNGIVHRDIKDENVIVDSNGFVKIIDFGSAAYVKSGPFDVF----VGTIDYA 1137

Query: 488  APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
            APE L  + Y           GKP DIW+ G +LY + +   P+ +      +  I++ +
Sbjct: 1138 APEVLGGEPYE----------GKPQDIWAIGVLLYTIIFKENPFYN------IDEILDAD 1181

Query: 548  IQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +++D         +V    +ALI+  LNR    R +  +I
Sbjct: 1182 LRVD------SNHRVSDECIALIRKILNRPISKRPSISKI 1215

>YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON}
           YPK2Protein kinase with similarity to serine/threonine
           protein kinase Ypk1p; functionally redundant with YPK1
           at the genetic level; participates in a signaling
           pathway required for optimal cell wall integrity;
           homolog of mammalian kinase SGK
          Length = 677

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 141/303 (46%), Gaps = 45/303 (14%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK +    +    E   T  ER +  L R+
Sbjct: 342 DDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTV--LARV 399

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDL-SHVLHERVNRPFDINFVRLMSKEMIECIK 433
                V     ++  +++  VL      +L  H+ HE     F +   R    E++  + 
Sbjct: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGR---FSLARSRFYIAELLCALD 456

Query: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAPET 491
           ++H  D+++ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+APE 
Sbjct: 457 SLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT---DTFCGTPEYLAPEI 513

Query: 492 LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNI--- 548
           L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  + +M   I   
Sbjct: 514 LLGQGYT-----------KTVDWWTLGILLYEMMTGLPPY-----YDENVPVMYKKILQQ 557

Query: 549 QIDYPNE-SPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLE 604
            + +P+   P  K +   L+ L    L+RDP  R     TDEI++  FF  +   K  L+
Sbjct: 558 PLLFPDGFDPAAKDL---LIGL----LSRDPSRRLGVNGTDEIRNHPFFKDISWKKLLLK 610

Query: 605 SLI 607
             I
Sbjct: 611 GYI 613

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score = 85.9 bits (211), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 133/284 (46%), Gaps = 30/284 (10%)

Query: 316 ITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEELDENL--KTDLEREIELLKR 373
           I D EL      G  G  +  +++  +    A+K + L    E+   + D+ RE+ L  +
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 374 LAREERVVKLIEYKIDDRMVQVLMECGNF-DLSHVLHERVNRPFDINFVRLMSKEMIECI 432
            ++   V+++I+  +    + +++E  +  DL   +   V    D +  +   +++I  +
Sbjct: 71  CSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVG--VDPDVAQFYFQQLIRAL 128

Query: 433 KAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKI--ADNTLNVYRNTQMGTPNYMAP 489
             +HD  + H D+KP N +   KG LKL DFG+A++    D TL V  + Q G+P YMAP
Sbjct: 129 NYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTD-QRGSPPYMAP 187

Query: 490 ETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ 549
           E L SQ Y              +DIWS G +L+ +  G  P+S       + A  + N +
Sbjct: 188 EILSSQGY----------YANITDIWSAGVLLFVLLTGEIPWS-------IPAKEDDNYE 230

Query: 550 IDYPNESPCG----KKVPQSLVALIKTCLNRDPQLRATTDEIQH 589
               NE        ++V    + L++  L  DP+ R + ++++H
Sbjct: 231 WFVNNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVSLEKLRH 274

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 85.5 bits (210), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 130/285 (45%), Gaps = 32/285 (11%)

Query: 322 SIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI   +G+G    VYK  DR T +  A+K + LE  DE+++  L +EI  L  L +   +
Sbjct: 19  SIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIEL-LAQEIFFLAEL-KSPLI 76

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I   ++D  + ++ME CG    S +L            V  +  E+   +K +H+  
Sbjct: 77  TNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQR 136

Query: 440 IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ--N 496
            +H D+K AN +   +G +KL DFG++  I  +TL   R+T +GTP +MAPE +  +   
Sbjct: 137 KIHRDIKAANILLNEEGMVKLGDFGVSGHIR-STLK--RDTFVGTPYWMAPEVVCCEVDG 193

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES 556
           Y+           + +DIWS G   Y++  G PP S +   D +  + N       P   
Sbjct: 194 YN-----------EKADIWSLGITTYELLKGLPPLSKY---DPMKVMTN------LPKRK 233

Query: 557 PCGKKVPQSLVA--LIKTCLNRDPQLRATTDEIQHCSFFNPMIIS 599
           P   + P S  A   +  CL + P  R +   +    F   + I+
Sbjct: 234 PPKLQGPFSDAAKDFVAGCLVKTPADRPSAYNLLSFEFVKNITIT 278

>YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}
            SSK2MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; interacts with
            Ssk1p, leading to autophosphorylation and activation of
            Ssk2p which phosphorylates Pbs2p; also mediates actin
            cytoskeleton recovery from osmotic stress
          Length = 1579

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 139/309 (44%), Gaps = 56/309 (18%)

Query: 326  LLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTD--LEREIELLKRLAREERVVK 382
             +G G   +VY   D   G+  A+K+I +++     K    ++ E+ +L+ L     +V 
Sbjct: 1271 FIGGGTFGRVYSAVDLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEIL-NHPNIVS 1329

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    L+ +L H R+    D    ++ + +++E +  +H+S I
Sbjct: 1330 YYGVEVHRDKVNIFMEYCEGGSLAALLEHGRIE---DEMVTQVYTLQLLEGLAYLHESGI 1386

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIADN-----TLNVYRNTQ-------------- 480
            VH D+KP N +    G +K +DFG A KIA+N     ++N   N                
Sbjct: 1387 VHRDVKPENILLDFNGVIKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKA 1446

Query: 481  -----------MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHP 529
                       MGTP YMAPE++              K+G   D+WS GC++ +M  G  
Sbjct: 1447 VKNNENALLDMMGTPMYMAPESITGSTTKG-------KLG-ADDVWSLGCVVLEMITGRR 1498

Query: 530  PYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQH 589
            P+++    D   AIM  ++   +  + P   +V  + +  ++ CL ++P  RA+  E+  
Sbjct: 1499 PWANL---DNEWAIMY-HVAAGHTPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVEL-- 1552

Query: 590  CSFFNPMII 598
                +P I+
Sbjct: 1553 --LMDPWIV 1559

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 113/219 (51%), Gaps = 26/219 (11%)

Query: 324 VELLGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E +G G  + VYK  ++T G Y ALK++ L+  +E   +   REI L+K L + + +V+
Sbjct: 10  LEKVGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKEL-KHDNIVR 67

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHER----VNRPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  R     ++  +++ V+    ++++ +   H++
Sbjct: 68  LFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQGVAFCHEN 127

Query: 439 DIVHSDLKPANFIFV-KGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   +G LKL DFG+A    I  NT +    +++ T  Y AP+ L+ S
Sbjct: 128 RILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPDVLMGS 183

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
           +NY               DIWS GCIL +M  G P +  
Sbjct: 184 RNYCTSI-----------DIWSCGCILAEMIMGKPLFPG 211

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 108/213 (50%), Gaps = 26/213 (12%)

Query: 324 VELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVK 382
           +E LG G  + VYK +   TG + ALK++ L+  +E   +   REI L+K L + E +V+
Sbjct: 11  LEKLGNGTYATVYKGLNKSTGAFVALKEVKLDS-EEGTPSTAIREISLMKEL-KHENIVR 68

Query: 383 LIEYKIDDRMVQVLMECGNFDLSHVLHERVN----RPFDINFVRLMSKEMIECIKAVHDS 438
           L +    +  + ++ E  + DL   +  +      R  ++N V+    ++ E +   H++
Sbjct: 69  LYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQLFEGLAFCHEN 128

Query: 439 DIVHSDLKPANFIF-VKGTLKLIDFGIANK--IADNTLNVYRNTQMGTPNYMAPETLI-S 494
            I+H DLKP N +   KG LKL DFG+A    I  NT     ++++ T  Y AP+ L+ S
Sbjct: 129 KILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTF----SSEVVTLWYRAPDVLMGS 184

Query: 495 QNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYG 527
           + Y+              DIWS GCIL +M  G
Sbjct: 185 RTYTTSI-----------DIWSCGCILAEMITG 206

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 134/286 (46%), Gaps = 43/286 (15%)

Query: 325  ELLGKGGSSKVY-KVQDRTGKYYALKQILL------EELDENLKTDLEREIELLKRLARE 377
            E++GKG    VY  +   TG+  A+KQ+ +      +E   ++   L+ E+  LK L   
Sbjct: 1150 EIIGKGSFGSVYLGLNVTTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHV 1209

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++  + +  + +E      +  ++  R+   FD + +R ++ +++  +  +H
Sbjct: 1210 N-IVQYLGFENKNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLH 1266

Query: 437  DSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  V G  K+ DFGI+ K    + N+Y N+ M   GT  +MAPE +
Sbjct: 1267 SKGILHRDMKADNLLLDVDGICKISDFGISKK----SNNIYSNSDMTMRGTVFWMAPEMV 1322

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GC++ +M  G  P+S+F     ++A M    +I 
Sbjct: 1323 DTKQGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNF----EVVAAM---FKIG 1364

Query: 552  YPNESPCGKKVPQSLV-----ALIKTCLNRDPQLRATTDEIQHCSF 592
                +P   +  Q L+     + +  C   DP+ R T D++    F
Sbjct: 1365 KFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTADDLLSHPF 1410

>TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.446
           YMR104C
          Length = 683

 Score = 85.9 bits (211), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 93/347 (26%), Positives = 151/347 (43%), Gaps = 62/347 (17%)

Query: 281 SKIQNKKHQTIPKIEAPVPQSVPSQAN--LMSKQWSRITD-------------------- 318
           SKI + +   I   E P+   + S AN  L +  W  + D                    
Sbjct: 293 SKINSNQDIHIDSFELPLSLFINSAANVRLYNHHWVNLKDGFGKLNLSIDYRPSRNKPLS 352

Query: 319 -EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKR 373
            ++  +++++GKG   KV +V+ + T   YALK I    +    E   T  ER +  L R
Sbjct: 353 IDDFDLLKVIGKGSFGKVMQVRKKDTKNIYALKAIKKSYIISKSEVTHTLAERTV--LSR 410

Query: 374 LAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIK 433
           +     V     ++  +++  VL      +L +  H +    FD++  R  + E++  ++
Sbjct: 411 VNCPFIVPLKFSFQSPEKLYLVLAFINGGELFY--HLQKEGRFDLSRSRFYTAELLCALE 468

Query: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAP 489
            +H+ ++++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+AP
Sbjct: 469 TLHNLNVIYRDLKPENILLDYQGHITLCDFGLCKLNMKDDDKT-----DTFCGTPEYLAP 523

Query: 490 ETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQ 549
           E L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   I 
Sbjct: 524 ELLLGQGYS-----------KEVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI- 566

Query: 550 IDYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFF 593
           +  P   P G         L+   L+RDP+ R      DEI++  FF
Sbjct: 567 LKEPLRFPEG--FDSDAKDLLIGLLSRDPKRRLGYNGADEIKNHPFF 611

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 132/284 (46%), Gaps = 46/284 (16%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYA-LKQILLEEL-------DENLKTDLEREIELL 371
            +  I++ +G+G   KV     +  KY   +K I  E +       D  L T +  EI+++
Sbjct: 1150 DFVILQKMGEGAYGKVNLCIHKKEKYIVCIKMIFKERILVDTWVRDRKLGT-IPSEIQIM 1208

Query: 372  KRLARE--ERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRP-FDINFVRLM 424
              L ++  E +++L+++  DD        +  E G  DL  ++  + N   F+    +L+
Sbjct: 1209 ATLNKKPHENILRLLDFFEDDNYYYIETPIHGETGCIDLFDLIEFKTNMTEFE---AKLI 1265

Query: 425  SKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGT 483
             K+++  IK +H   IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT
Sbjct: 1266 FKQVVSGIKHLHHQGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGPFDVF----VGT 1321

Query: 484  PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
             +Y APE L  + Y           GKP DIW+ G +LY + +   P+ +      +  I
Sbjct: 1322 IDYAAPEVLSGEPYE----------GKPQDIWALGILLYTIVFKENPFYN------IDEI 1365

Query: 544  MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +  +++ D   E      V +  + LIK  L R  + R   DEI
Sbjct: 1366 LEGDLKFDSNTE------VTEDCMELIKKVLIRQVRNRPAIDEI 1403

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 85.1 bits (209), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 117/276 (42%), Gaps = 30/276 (10%)

Query: 323 IVELLGKGGSSKVYKVQDRTG-KYYALKQILLEELDENLKTDLEREIELLKRLAREERVV 381
           I++ +G+G    VYK +D T  +  A+K + LE+ DE +   L +EI  L  L       
Sbjct: 22  ILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEPIDL-LAQEIFFLSELRSPYITN 80

Query: 382 KLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
               + +D  M  V+  CG    + +L               +  E++  +  +H    +
Sbjct: 81  YKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHSQRKI 140

Query: 442 HSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLI--SQNYS 498
           H D+K AN +    G +KL DFG++ ++    +   R+T +GTP +MAPE +    Q Y+
Sbjct: 141 HRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPEVIDRNKQGYN 197

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP- 557
                        +DIWS G  + ++  GHPP   +     L+AI         P   P 
Sbjct: 198 EM-----------ADIWSLGITVIELLMGHPPLDKYDAMKALMAI---------PKRDPP 237

Query: 558 -CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
              K+        +  CL +DP  R T  E+    F
Sbjct: 238 KLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRF 273

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 85.5 bits (210), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 115/241 (47%), Gaps = 45/241 (18%)

Query: 324 VELLGKGGSSKVYKVQDR-TGKYYALKQILLEEL---DENLKTDLEREIELLKRLAR--E 377
           + +LGKG  SKV  V+D  + K YA+KQ+   E+   ++ ++ D E    L KR+ R   
Sbjct: 117 IRVLGKGAYSKVVLVKDHHSNKLYAMKQLKKAEILINEKEVREDSEDPTTLQKRIERTFA 176

Query: 378 ER----------VVKLIEYKIDD--RMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMS 425
           ER          VVKL  Y   D  ++  +L      +L   L ER     D + V   +
Sbjct: 177 ERIILSKLEHPNVVKLF-YSFHDHSKLYLILQYIPGGELFFHLKERGT--LDEDTVAFYA 233

Query: 426 KEMIECIKAVHDSDIVHSDLKPANFIFV-KGTLKLIDFGIANKIADNT-------LN--- 474
            E+   +K +HD+ IV+ DLKP N +   +G L L DFG++ +  DN        LN   
Sbjct: 234 AEISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTELNSPE 293

Query: 475 -VYR-NTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYS 532
            +Y  ++ +GTP Y APE L    Y+           K  D +S GC+L+ M  G PPY+
Sbjct: 294 DIYTLHSIIGTPEYAAPEILQGLPYN-----------KNCDWYSLGCLLFDMLVGKPPYT 342

Query: 533 S 533
            
Sbjct: 343 G 343

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 129/276 (46%), Gaps = 39/276 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + +R   +V  I+
Sbjct: 628 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPK--KELIINEI-LVMKGSRHPNIVNFID 684

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               K D  ++   ME G+  L+ V+   +     I  V    +E +  +K +H   ++H
Sbjct: 685 SYVLKGDLWVIMEYMEGGS--LTDVVTHCILTEGQIGAV---CRETLSGLKFLHSKGVLH 739

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  ++G +KL DFG   +I  N LN+ R T +GTP +MAPE +  + Y    
Sbjct: 740 RDIKSDNILLSMEGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPEVVSRKEY---- 793

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESP 557
                  G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P    
Sbjct: 794 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPKLKEP---- 839

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             + +  SL   +  CL  +P+ RA+  E+ H  + 
Sbjct: 840 --ENLSSSLKKFLDWCLCVEPEERASATELLHDEYI 873

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 130/282 (46%), Gaps = 44/282 (15%)

Query: 327  LGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELLKRLAR-- 376
            +G+G   KV     +  +Y  + +++ +E         D  L T +  EI+++  L +  
Sbjct: 1106 MGEGAYGKVDLCIHKKERYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIMATLNKTP 1164

Query: 377  EERVVKLIEYKIDDRM----VQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECI 432
             E +++L+++  DD        V  E G  DL  ++  + N        +L+ K+++  I
Sbjct: 1165 HENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTN--MTECEAKLIVKQVVAGI 1222

Query: 433  KAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPET 491
            K +HD  IVH D+K  N I   KG +K+IDFG A  +     +V+    +GT +Y APE 
Sbjct: 1223 KHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF----VGTIDYAAPEV 1278

Query: 492  LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
            L    Y           GKP DIW+ G +LY + +   P+ +      +  I+  +++ +
Sbjct: 1279 LGGNPYE----------GKPQDIWAIGILLYTVVFKENPFYN------IDEILEGDLKFN 1322

Query: 552  YPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
               E      V +  + LIK+ LNR    R T D+I +  + 
Sbjct: 1323 NAEE------VSEDCIELIKSILNRCVPKRPTIDDINNGKWL 1358

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 86.3 bits (212), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 84/302 (27%), Positives = 137/302 (45%), Gaps = 37/302 (12%)

Query: 319 EELSIVELLGKGGSSKVY-KVQDRTGKYYALKQILLEELDENLKTD-LEREIELLKRLAR 376
           ++    E+LG G  S V     + +GK YA+K +  E L    K   +  E   L+RL  
Sbjct: 172 KDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNN 231

Query: 377 EERVVKLIEYKIDDRMVQVLMECG-NFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAV 435
              +++L     D+  +  L+E   N DL  ++ +  +   +         ++I+ IK +
Sbjct: 232 SRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGS--LNEECCCYYGAQIIDAIKFM 289

Query: 436 HDSDIVHSDLKPANFIFVKGT-LKLIDFGIANKIADNT-------LNVYRNTQMGTPNYM 487
           H   I+H D+KP N +  K   +K+ DFG A KI DN        L     + +GT  Y+
Sbjct: 290 HSKGIIHRDIKPENILLDKDMKVKITDFGTA-KILDNKPPGTSYDLLTRSKSFVGTAEYV 348

Query: 488 APETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547
           +PE L++ NY+             SDIW++GCI++QM  G PP+ +   +     +M   
Sbjct: 349 SPE-LLNDNYTDAR----------SDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVM--K 395

Query: 548 IQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLI 607
           +Q  +          P  +  L+K  L + P+ R T + I+   FF     SK F +S I
Sbjct: 396 VQYAF------TAGFPTVVRDLVKRILIKAPEQRLTIEAIEKHHFFR----SKNFQDSSI 445

Query: 608 DN 609
            N
Sbjct: 446 WN 447

>Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {ON}
           YMR104C (REAL)
          Length = 677

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 138/299 (46%), Gaps = 37/299 (12%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++G+G   KV +V+ R T K YALK +    +    E   T  ER +  L R+
Sbjct: 342 DDFDLLKVIGRGSFGKVMQVRKRDTQKVYALKALRKAYIVSKCEVTHTLAERTV--LARV 399

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDL-SHVLHERVNRPFDINFVRLMSKEMIECIK 433
                V     ++  +++  VL      +L  H+ HE     F +   R    E++  + 
Sbjct: 400 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEG---QFSLARSRFYISELLCALD 456

Query: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAPET 491
           ++H  D+++ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+APE 
Sbjct: 457 SLHRLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT---DTFCGTPEYLAPEI 513

Query: 492 LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
           L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  + +M   I + 
Sbjct: 514 LLGQGYT-----------KTVDWWTLGILLYEMMTGLPPY-----YDENVPVMYKKI-LQ 556

Query: 552 YPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLESLI 607
            P   P G  +      L+   L+RDP  R     TDEI++  FF  +   K  L+  I
Sbjct: 557 QPLLFPDGFDLAAK--DLLIGLLSRDPNRRLGVNGTDEIRNHFFFKDISWKKLLLKGYI 613

>YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}
           CLA4Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family, along with Ste20p and
           Skm1p; involved in septin ring assembly, vacuole
           inheritance, cytokinesis, sterol uptake regulation;
           phosphorylates Cdc3p and Cdc10p
          Length = 842

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 86/307 (28%), Positives = 141/307 (45%), Gaps = 59/307 (19%)

Query: 321 LSIVELLGKGGSSKVYKVQDRT---------------------GKYYALKQILLEELDEN 359
             ++E  G+G S  VY + +RT                     G   A+KQ++L +  + 
Sbjct: 546 FKVIEKAGQGASGSVY-LAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSK--QP 602

Query: 360 LKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--MECGNF-DL--SHVLHERV 412
            K  +  EI ++K  +R + +V  +E   + DD +  V+  ME G+  D+  +   ++  
Sbjct: 603 RKELIVNEILVMKD-SRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNS 661

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADN 471
           + P     +  + +E  + +K +HD  I+H D+K  N +   +  +K+ DFG   ++ D 
Sbjct: 662 HSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDK 721

Query: 472 TLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
                R T +GTP +MAPE +  + Y         KI    D+WS G +  +M  G PPY
Sbjct: 722 --RSKRATMVGTPYWMAPEVVKQREYDE-------KI----DVWSLGIMTIEMLEGEPPY 768

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK----TCLNRDPQLRATTDEI 587
              L  D L A+      +   N +P   K P+SL   IK     CL  D + RA+T+E+
Sbjct: 769 ---LNEDPLKALY-----LIATNGTP-KLKHPESLSLEIKRFLSVCLCVDVRYRASTEEL 819

Query: 588 QHCSFFN 594
            H  FFN
Sbjct: 820 LHHGFFN 826

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 134/289 (46%), Gaps = 49/289 (16%)

Query: 325  ELLGKGGSSKVYKVQD-RTGKYYALKQILLEEL---DENLKTDLE---REIELLKRLARE 377
            E++GKG    VY   +  TG+  A+KQ+ + +    DE + + ++    E+  LK L   
Sbjct: 1258 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKDL-DH 1316

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++  D +  + +E      +  ++  R+   FD   +R ++ +++  +  +H
Sbjct: 1317 LNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--RIYGRFDEPLIRHLNIQVLRGLAYLH 1374

Query: 437  DSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  + G  K+ DFGI+ K  D    +Y N+ M   GT  +MAPE +
Sbjct: 1375 ARGILHRDMKADNLLLDQDGVCKISDFGISRKSKD----IYSNSDMTMRGTVFWMAPEMV 1430

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GCI+ +M  G  P+S+F     ++A M    +I 
Sbjct: 1431 DTKQGYSAKV-----------DIWSLGCIVLEMFAGKRPWSNF----EVVAAM---FKIG 1472

Query: 552  YPNESPCGKKVPQSLVALIK--------TCLNRDPQLRATTDEIQHCSF 592
                +P    +P+  + LI          C   DP  R T DE+ + +F
Sbjct: 1473 KSKSAP---PIPEDTLPLISAEGREFLDACFEIDPDKRPTADELLYHTF 1518

>Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W
           (REAL)
          Length = 838

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 81/307 (26%), Positives = 139/307 (45%), Gaps = 59/307 (19%)

Query: 321 LSIVELLGKGGSSKVYKVQDRT---------------------GKYYALKQILLEELDEN 359
             ++E  G+G S  VY + +RT                     G   A+KQ++L +  + 
Sbjct: 542 FKVIEKAGQGASGSVY-LAERTHIPTESNMIELINNEIDEPQVGDKVAIKQMVLSK--QP 598

Query: 360 LKTDLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--MECGNF-DL--SHVLHERV 412
            K  +  EI ++K  +R + +V  +E   + DD +  V+  ME G+  D+  +   ++  
Sbjct: 599 RKELIVNEILVMKD-SRHKNIVNFLEAYLRTDDDLWVVMEYMEGGSLTDIIENSPTNDTS 657

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADN 471
           + P     +  + +E  + +K +HD  I+H D+K  N +   +  +K+ DFG   ++ D 
Sbjct: 658 HSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDK 717

Query: 472 TLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
                R T +GTP +MAPE +  + Y         KI    D+WS G +  +M  G PPY
Sbjct: 718 --RSKRATMVGTPYWMAPEVVKQREYDE-------KI----DVWSLGIMTIEMLEGEPPY 764

Query: 532 SSFLGHDRLLAI----MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              L  D L A+     N   ++ YP      + +   +   +  CL  D + RA+T+E+
Sbjct: 765 ---LNEDPLKALYLIATNGTPKLKYP------ETLSLEIKRFLSVCLCVDVRYRASTEEL 815

Query: 588 QHCSFFN 594
            H  FFN
Sbjct: 816 LHHGFFN 822

>SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} similar
           to uniprot|P27636 Saccharomyces cerevisiae YAR019C CDC15
           Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p
          Length = 912

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 118/235 (50%), Gaps = 28/235 (11%)

Query: 322 SIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           ++ +++GKG    VYK  +R T K  A+K I  E  +E    D   EI+LLK L R   +
Sbjct: 41  ALKQVIGKGAYGIVYKAVNRQTRKEVAIKVI--EYDNEEELNDHMLEIDLLKNL-RHPNI 97

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
           VK   +      + +L+E C    L  V  +    P D    R+  ++ ++ ++ +H   
Sbjct: 98  VKYHGFIQKRHQLCILLEYCSRGSLRDVFKQH---PIDEQQARVYVQQTLQGLQYLHSQG 154

Query: 440 IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +   + T+KL DFG++ ++  N+L +   T  G+PN+M+PE ++ +  +
Sbjct: 155 VIHRDIKAANLLLDAQNTVKLADFGVSTRV--NSLAM---TYAGSPNWMSPEVMLGKGAT 209

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYP 553
                        SD+WS G  + ++  G+PP+ + +      AI+N    + YP
Sbjct: 210 TV-----------SDVWSLGATVVEILTGNPPFHNLVNEAACYAIVN---DVYYP 250

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 110/221 (49%), Gaps = 20/221 (9%)

Query: 325 ELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K  +R TGK +A+K I   ++  +    + RE+E+L+RL    R+V+L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRLDHP-RIVRL 264

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVL--HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
             +  D     +LME     DL   +  H  V      +  R +S++++E IK +H   I
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGE----DAGREISRQILEAIKYIHSMGI 320

Query: 441 VHSDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            H DLKP N +  +     +K+ DFG+A K+ DN    +  T  GT  Y+APE +  +N 
Sbjct: 321 SHRDLKPDNILIEQDDPVLVKITDFGLA-KVQDN--GTFMKTFCGTLAYVAPEIISGKND 377

Query: 498 SXXXXXXXW-----KIGKPSDIWSYGCILYQMTYGHPPYSS 533
                         +     D+WS GC++Y +  GH P+S 
Sbjct: 378 GELRENADANSERNEYSSLVDMWSMGCLVYVILTGHLPFSG 418

>Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {ON}
           YDR523C (REAL)
          Length = 490

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 128/285 (44%), Gaps = 32/285 (11%)

Query: 322 SIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI   +G+G    VYK  DR T +  A+K + LE  DE+++  L +EI  L  L +   +
Sbjct: 19  SIQSCIGRGNFGDVYKAMDRVTQEIVAIKVVNLEHSDEDIEL-LAQEIFFLAEL-KSPLI 76

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I   ++D  + ++ME CG    S +L            V  +  ++   +K +H+  
Sbjct: 77  TNYITTMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHQVTLGLKYLHEQR 136

Query: 440 IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ--N 496
            +H D+K AN +   +G +KL DFG++  I        R+T +GTP +MAPE +  +   
Sbjct: 137 KIHRDIKAANILLNEEGMVKLGDFGVSGHIRST---FKRDTFVGTPYWMAPEVVCCEVDG 193

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES 556
           Y+           + +DIWS G   Y++  G PP S +   D +  + N       P   
Sbjct: 194 YN-----------EKADIWSLGITTYELLKGLPPLSKY---DPMKVMTN------LPKRK 233

Query: 557 PCGKKVPQSLVA--LIKTCLNRDPQLRATTDEIQHCSFFNPMIIS 599
           P   + P S  A   +  CL + P  R +  ++    F   + ++
Sbjct: 234 PPKLQGPFSEAAKEFVAGCLVKTPADRPSAYDLLSFEFIKNITVT 278

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 128/276 (46%), Gaps = 31/276 (11%)

Query: 323 IVELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREERV 380
           +++ LG+G   KV       TG+  ALK I  + L + +++  +EREI  L RL R   +
Sbjct: 41  VIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHPHI 99

Query: 381 VKLIEY-KIDDRMVQVLMECGNFDLSHVLH-ERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           +KL +  K  D ++ V+   GN    +++  ++++     N  R   +++I  ++  H  
Sbjct: 100 IKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSE----NEARRFFQQIISAVEYCHRH 155

Query: 439 DIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  + Y
Sbjct: 156 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 212

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP 557
           +          G   D+WS G ILY M     P+      D  + ++  NI         
Sbjct: 213 A----------GPEVDVWSSGVILYVMLCRRLPFD-----DESIPVLFKNIS---NGVYS 254

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             K + Q    LIK  L  +P  R T  EI    +F
Sbjct: 255 IPKFLSQGAANLIKRMLIVNPLNRITIHEIMEDEWF 290

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 132/284 (46%), Gaps = 46/284 (16%)

Query: 320  ELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL--------DENLKTDLEREIELL 371
            +  +++ +G+G   KV     +  KY  + +++ +E         D  L T +  EI++L
Sbjct: 945  DFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGT-IPSEIQIL 1003

Query: 372  KRLAR--EERVVKLIEYKIDDRMVQVLM----ECGNFDLSHVLHERVNRP-FDINFVRLM 424
              + +   E ++ L+++  DD    +      + G+ DL  ++  + N   F+    +L+
Sbjct: 1004 ATINKRPHENILGLLDFFEDDDYYYLETPPHGQTGSVDLFDIIEFKSNMTEFE---AKLI 1060

Query: 425  SKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGT 483
             K+++  IK +HD  IVH D+K  N I   KG +KLIDFG A  +     +V+    +GT
Sbjct: 1061 FKQIVSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGPFDVF----VGT 1116

Query: 484  PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
             +Y APE L    Y           GK  DIW+ G +LY + Y   P+ +      +  I
Sbjct: 1117 IDYAAPEVLGGNPYE----------GKSQDIWAIGILLYTLIYKENPFYN------IDEI 1160

Query: 544  MNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
            +   ++    N+S     V Q   ALI   LNR  + R T DEI
Sbjct: 1161 LEGELRF---NDSA---DVSQECKALITKILNRCVRKRPTIDEI 1198

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/228 (29%), Positives = 107/228 (46%), Gaps = 31/228 (13%)

Query: 324 VELLGKGGSSKVYKVQD-RTGKYYALKQILLEEL--DENLKTDLEREIE-------LLKR 373
           V +LGKG   KV  V+D RT K YA+KQ+   E+  + +   D+ + +E       +L +
Sbjct: 82  VRVLGKGAYGKVVLVKDERTSKLYAMKQLQKAEIIIENDESQDVSKRVERIFAERTILSQ 141

Query: 374 LAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIK 433
           L     V     +  + R+  +L      +L + L ER     D +     + E+   +K
Sbjct: 142 LDHPNVVKLFYTFHDNSRLYLLLQYIPGGELFYHLKERGT--LDEDTAAFYAAEISCALK 199

Query: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIAD--NTLNVYRNTQ-----MGTPN 485
            +H+  IV+ DLKP N +    G L L DFG++ K  D  N+L+   +       +GTP 
Sbjct: 200 FLHEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLHSIIGTPE 259

Query: 486 YMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
           Y APE L  + Y+           +  D +S GC++Y M  G PPY+ 
Sbjct: 260 YCAPEILKGEPYT-----------RNCDWYSLGCLVYDMLVGKPPYTG 296

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 134/288 (46%), Gaps = 41/288 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + ++   +V  I+
Sbjct: 673 IGQGASGGVYTAYEVGTNASVAIKQMNLEK--QPKKELIINEI-LVMKASKHANIVNFID 729

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               + D  +V   ME G+  L+ V+   +     I  V   S+E ++ ++ +H   ++H
Sbjct: 730 SYLLRGDLWVVMEYMEGGS--LTDVVTHCILTEGQIGAV---SRETLKGLQFLHSKGVIH 784

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y    
Sbjct: 785 RDIKSDNVLLSMSGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY---- 838

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKK 561
                  G   DIWS G ++ +M  G PPY   L    L A+    I  +   E      
Sbjct: 839 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY--LIATNGTPELKDADS 886

Query: 562 VPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDN 609
           +   L + +  CL+ +P  RAT  +          ++S PF+ +  D+
Sbjct: 887 LSDDLKSFLGWCLHVNPDERATASQ----------LLSDPFISTYADH 924

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 135/296 (45%), Gaps = 53/296 (17%)

Query: 323 IVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREE 378
           I++ LG+G   KV   Y V   TG+  ALK I  + L + +++  +EREI  L RL R  
Sbjct: 32  IIKTLGEGSFGKVKLAYHVT--TGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHP 88

Query: 379 RVVKLIEY-KIDDRMVQVLMECGNFDLSHVLH-----ERVNRPFDINFVRLMSKEMIECI 432
            ++KL +  K  D +V V+   GN    +++      ER  R F         +++I  +
Sbjct: 89  HIIKLYDVIKSKDEIVMVIEYAGNELFDYIVQRDKMSEREARRF--------FQQIISAV 140

Query: 433 KAVHDSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPET 491
           +  H   IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE 
Sbjct: 141 EYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEV 197

Query: 492 LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
           +  + Y+          G   D+WS G ILY M     P+             + +I I 
Sbjct: 198 ISGKLYA----------GPEVDVWSSGVILYVMLCRRLPFD------------DESIPIL 235

Query: 552 YPNESPCGKKVPQSL----VALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFL 603
           + N S     +P+ L      LIK  L  +P  R T  EI    +F   I  +P+L
Sbjct: 236 FKNISNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIMEDEWFKVDI--QPYL 289

>KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON}
           Anc_2.496 YHL007C
          Length = 791

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 126/267 (47%), Gaps = 33/267 (12%)

Query: 327 LGKGGSSKVYKVQDRT-GKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  V+  +  T G Y A+KQ+ LE+  +  K  +  EI L+   +R+E +V  I+
Sbjct: 518 IGQGASGGVFIAKSTTNGSYVAIKQMNLEK--QPKKELILNEI-LVMNESRQENIVNFID 574

Query: 386 -YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSD 444
            Y ++D +  V+       L+ V+   +     I  V    +E ++ ++ +H   ++H D
Sbjct: 575 AYLLNDDLWIVMEYMQGGSLTDVVTYCLLSEGQIGTV---CRETLKGLRFLHSKGVLHRD 631

Query: 445 LKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXX 503
           +K  N +  + G +K+ DFG   +I D+  N  R T +GTP +MAPE +  + Y      
Sbjct: 632 IKSDNILLSLTGNIKVTDFGFCAQINDD--NAKRVTMVGTPYWMAPEIISRKEY------ 683

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGK--- 560
                G   DIWS G ++ +M  G PPY   L    L A+      +   N  P  K   
Sbjct: 684 -----GPKVDIWSLGIMVIEMIEGEPPY---LNETPLKALY-----LIATNGKPSLKEPE 730

Query: 561 KVPQSLVALIKTCLNRDPQLRATTDEI 587
           K+ ++    +  CL  DP  RA   ++
Sbjct: 731 KLSKTFFLFLDKCLAVDPDKRAEATDL 757

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 135/289 (46%), Gaps = 42/289 (14%)

Query: 311 KQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDE--NLKTDLERE 367
           K+ SR T     + + LGKG S +V   ++  TGK  A+K +   +     +L   +ERE
Sbjct: 48  KRRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIERE 107

Query: 368 IELLKRLAREE--RVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMS 425
           I ++K ++      + ++ E K++  +V   ++ G      V   R+     I++ R   
Sbjct: 108 IIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFR--- 164

Query: 426 KEMIECIKAVHDSDIVHSDLKPANFIFVKGT--LKLIDFGIANKIADNTLNVYRNTQMGT 483
            ++IE     H  +I H DLKP N +  K    +K+ DFG+A   A  T N    T  G+
Sbjct: 165 -QIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMA---ALQTSNKLLETSCGS 220

Query: 484 PNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI 543
           P+Y +PE ++ +NY+          G PSD+WS G IL+ +  GH P++       LL +
Sbjct: 221 PHYASPEIVMGKNYN----------GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKV 270

Query: 544 MNPNIQIDYPNESPCGK-KVPQSLVA----LIKTCLNRDPQLRATTDEI 587
                          GK ++PQS+ +    LI   L  DP  R + +EI
Sbjct: 271 Q-------------AGKYQMPQSVSSGAQDLISRILVVDPDKRISINEI 306

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 132/282 (46%), Gaps = 43/282 (15%)

Query: 323 IVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREE 378
           I++ LG+G   KV   Y V   TG+  ALK I  + L + +++  +EREI  L RL R  
Sbjct: 33  IIKTLGEGSFGKVKLAYHVT--TGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHP 89

Query: 379 RVVKLIEY-KIDDRMVQVLMECGNFDLSHVLH-ERVNRPFDINFVRLMSKEMIECIKAVH 436
            ++KL +  K  D +V V+   GN    +++  ++++     N  R   +++I  ++  H
Sbjct: 90  HIIKLYDVVKSKDEIVMVIEYAGNELFDYIVQRDKMSE----NEARRFFQQIISAVEYCH 145

Query: 437 DSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ 495
              IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  +
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLRTSCGSPNYAAPEVISGK 202

Query: 496 NYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNE 555
            Y+          G   D+WS G ILY M     P+             + +I + + N 
Sbjct: 203 LYA----------GPEVDVWSSGVILYVMLCRRLPFD------------DESIPVLFKNI 240

Query: 556 SPCGKKVPQSL----VALIKTCLNRDPQLRATTDEIQHCSFF 593
           S     +P+ L      LIK  L  +P  R T  EI    +F
Sbjct: 241 SNGIYTLPKFLSPGAANLIKRMLIVNPLNRITIHEIMQDEWF 282

>Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR054W
           (SMK1) - MAP kinase [contig 260] FULL
          Length = 414

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 110/232 (47%), Gaps = 29/232 (12%)

Query: 323 IVELLGKGG----SSKVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREE 378
           I+++LGKG      S + K +D   +  A+K++      E L     RE++ L      +
Sbjct: 68  IIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIRELKFLNFFKGHK 127

Query: 379 RVVKLIEYKIDDR----MVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
            +V L++ +I        +    E  ++DL+ V+H  V   F    ++    +++  +K 
Sbjct: 128 NIVSLVDLEIVSEKPYDGLYCYQELVDYDLARVIHSTVQ--FSEFHIKHFLYQILCGLKY 185

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTL-----NVYRNTQMGTPNYMA 488
           +H +D++H DLKP N +  + G LK+ DFG+A  IA          ++  + + T  Y A
Sbjct: 186 IHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFEQKSDEIHITSYVATRWYRA 245

Query: 489 PETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRL 540
           PE ++S            +  K  DIW+ GCIL +  YG  P   F+GHD L
Sbjct: 246 PELILSHR----------RYTKAIDIWAVGCILAEF-YGRKPI--FMGHDSL 284

>Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C
           (REAL)
          Length = 684

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 133/287 (46%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 349 DDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTV--LARV 406

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L +  H +    FD++  R  + E++  +  
Sbjct: 407 DCPFIVPLKFSFQSPEKLYFVLAFINGGELFY--HLQKEGRFDLSRARFYTAELLCALDN 464

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 465 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYLAPE 519

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+   YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 520 LLLGLGYS-----------KAVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 562

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             P   P G    +    L+ + L+RDP  R      DEI++  FF+
Sbjct: 563 QEPLVFPDG--FDREAKDLLISLLSRDPTRRLGYNGADEIRNHPFFS 607

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 132/304 (43%), Gaps = 63/304 (20%)

Query: 310 SKQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDEN----LKTDL 364
           SK+ +R T     + + LGKG S +V   ++  TGK  A+K +  + +  N    L   +
Sbjct: 62  SKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGI 121

Query: 365 EREIELLKRLAR------------EERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERV 412
           EREI ++K ++             +  +  ++EY     +   L+  G    S  +H   
Sbjct: 122 EREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIH--- 178

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKG--TLKLIDFGIANKIAD 470
                        K++++ +   H  +I H DLKP N +  K   ++K+ DFG+A   A 
Sbjct: 179 -----------YFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMA---AL 224

Query: 471 NTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPP 530
            T +    T  G+P+Y +PE ++ + Y           G PSD+WS G IL+ +  GH P
Sbjct: 225 ETSDKLLETSCGSPHYASPEIVLGRKYH----------GSPSDVWSCGIILFALLTGHLP 274

Query: 531 YSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNR----DPQLRATTDE 586
           ++       LL + +   Q+            PQ L    K  ++R    DP  R T D+
Sbjct: 275 FNDDNVKKLLLKVQSGKYQM------------PQWLSVEAKDLISRILVVDPNRRITIDQ 322

Query: 587 I-QH 589
           I QH
Sbjct: 323 ILQH 326

>TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {ON}
           Anc_1.255 YJL106W
          Length = 927

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 128/300 (42%), Gaps = 75/300 (25%)

Query: 366 REIELLKRLAREERVVKLIEYKID--DRMVQVLMECGNFDLSHVLHERVNRPFDINFVRL 423
           REI+ + ++   + +V++ E  +D  +  + ++MEC   +L  +++ R ++ F I  ++ 
Sbjct: 150 REIKFIFKIPSHKHLVQIFEVFVDSLNNKLHIVMECMEQNLYQMINNRNHKLFCIPSLKS 209

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANF------------------IFVKGTLKLIDFGIA 465
           +  +++  I+ +H+ D  H D+KP N                   I     +KL DFG+A
Sbjct: 210 ILSQILSGIRHIHNQDFFHRDIKPENILISPIKRYYNIDYINKNNIMDNYVVKLADFGLA 269

Query: 466 NKIAD-NTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQM 524
             I + N    Y +T+     Y +PE L+   Y            KP DIW++GC+  + 
Sbjct: 270 RHINNKNPYTAYVSTRW----YRSPEILLRSGY----------YSKPIDIWAFGCVAIET 315

Query: 525 TYGHPPYSSFLGHDRLLAIM----NPNIQIDYPNE-----SPCGK--------------K 561
           T   P +      D++  I+     P+  I  PNE     SP G               K
Sbjct: 316 TIFKPLFPGSNEIDQIWKILEILGTPHTMI-CPNEKTINHSPPGGFWEISQDLAKDLQLK 374

Query: 562 VP----------------QSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLES 605
            P                ++L+ +IK CL  DP  RAT DE+    FF   I+   FL+S
Sbjct: 375 FPFVRGHSIDAIIKTPFLKNLIDVIKRCLRWDPNDRATVDELCSMKFFENSIVDPKFLKS 434

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 125/272 (45%), Gaps = 36/272 (13%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDEN------LKTDLEREIELLKRLAREE- 378
           LGKG S +V   ++ ++GK  A+K +    +  N      L   +EREI ++K +     
Sbjct: 67  LGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREIIIMKLITHPNI 126

Query: 379 -RVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHD 437
             + ++ E K +  +V   +E G      +   ++     I++     K++++ +   H+
Sbjct: 127 MALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYF----KQIVQGVSYCHN 182

Query: 438 SDIVHSDLKPANFIFVKG--TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ 495
            +I H DLKP N +  K   T+K+ DFG+A   A  T N    T  G+P+Y +PE ++ Q
Sbjct: 183 FNICHRDLKPENLLLDKKNKTVKIADFGMA---ALETTNRLLETSCGSPHYASPEIVMGQ 239

Query: 496 NYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNE 555
            Y           G PSD+WS G IL+ +  GH P++       LL + +   Q+     
Sbjct: 240 KYH----------GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP---- 285

Query: 556 SPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
                 V +    LI   L  DP+ R T D+I
Sbjct: 286 ----SNVSKEAKDLISKILVVDPEKRITVDKI 313

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 135/289 (46%), Gaps = 49/289 (16%)

Query: 325  ELLGKGGSSKVYKVQD-RTGKYYALKQILLEEL---DENLKTDLE---REIELLKRLARE 377
            E++GKG    VY   +  TG+  A+KQ+ + +    DEN+ + +E    E+  LK L   
Sbjct: 1100 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DH 1158

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++  D +  + +E      +  ++  R+   FD   +R ++ +++  +  +H
Sbjct: 1159 LNIVQYLGFENKDNIYSLFLEYVAGGSVGSLI--RMYGRFDEAMIRHLTIQVLRGLSYLH 1216

Query: 437  DSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  + G  K+ DFGI+ K  D    +Y N+ M   GT  +MAPE +
Sbjct: 1217 SRGILHRDMKADNLLLDQDGVCKISDFGISRKSND----IYSNSDMTMRGTVFWMAPEMV 1272

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GC++ +M  G  P+S+      ++A M    +I 
Sbjct: 1273 DTKQGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNL----EVVAAM---FKIG 1314

Query: 552  YPNESPCGKKVPQSLVALIK--------TCLNRDPQLRATTDEIQHCSF 592
                +P    +P+  + LI         +C   DP+ R T D++   +F
Sbjct: 1315 KSKSAP---PIPEDTLPLISQDGRQFLDSCFEIDPESRPTADKLLSHAF 1360

>NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa]
           {ON} Anc_3.60
          Length = 819

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/332 (26%), Positives = 149/332 (44%), Gaps = 57/332 (17%)

Query: 294 IEAPVPQSVPSQAN--LMSKQWSRITD----EELSIVELLGKGGSSKVYKVQ-------- 339
           +  P  QS PS +N  +MSK  S   +    E   ++E  G+G S  VY  +        
Sbjct: 496 VTKPRKQSKPSMSNAEIMSKLKSVTINTDPTEYFQMIEKAGQGASGSVYLAKRINIPPAE 555

Query: 340 ------DRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE--YKIDDR 391
                    G   A+KQ++L +  +  K  +  EI ++K  +  + +V  +E   K +D 
Sbjct: 556 FEESEIPGIGDKVAIKQMILSK--QPRKELIVNEILVMKD-SHHKNIVNFLEAYLKTEDD 612

Query: 392 MVQVL--MECGNF-DL--SHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLK 446
           +  V+  ME G+  D+  +  + +  + P   + +  + +E  + +K +HD  I+H D+K
Sbjct: 613 LWVVMEFMEGGSLTDIIENSPVDDTSHSPLTESQIAYIVRETCQGLKFLHDKHIIHRDIK 672

Query: 447 PANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXX 505
             N +  + G +K+ DFG   K+ D      R T +GTP +MAPE +  + Y        
Sbjct: 673 SDNVLLDMNGRVKITDFGFCAKLTDQ--RSKRATMVGTPYWMAPEVVKQREYDEKV---- 726

Query: 506 WKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESPCGKK 561
                  D+WS G +  +M    PPY   L  D L A+     N   ++ +P      +K
Sbjct: 727 -------DVWSLGIMTIEMLESEPPY---LNEDPLKALYLIATNGTPKLKHP------EK 770

Query: 562 VPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
           +   +   +  CL  D + RA+T+E+ H  FF
Sbjct: 771 LSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 802

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 136/291 (46%), Gaps = 43/291 (14%)

Query: 311 KQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEEL-------DENLKT 362
           K+  + +D E  +V  LG+G   +V  VQ++ T ++  LK+I  E +       D    T
Sbjct: 99  KRVKKFSDYE--VVLELGQGAYGQVSLVQNKSTEEFLILKKIFKERILLDTWVRDRKYGT 156

Query: 363 DLEREIELLKRLAR--EERVVKLIEYKIDDRMVQVLMEC-GNFDLSHVLHERVNRPFDIN 419
            +  EI +L +L     + VV +I++  DD    V M   G  D    L + ++   +++
Sbjct: 157 -VPSEIHILTKLTELPHDNVVSMIDFFEDDDFYYVEMPIHGQGDGCIELFDFIDIRDEVS 215

Query: 420 F--VRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVY 476
               +L+ K+++  IK +HD DIVH D+K  N I   +G ++LIDFG A     N +   
Sbjct: 216 DWECKLIIKQLVSAIKYLHDRDIVHRDIKDENIIMDARGHIQLIDFGSAT----NAVRGP 271

Query: 477 RNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLG 536
             T +GT +Y  PE    + +          +GKP DIW+ G +LY + +  PP   FL 
Sbjct: 272 FRTFLGTIDYEPPEVARGEPF----------LGKPQDIWALGILLYILRFKEPP---FLD 318

Query: 537 HDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
                AI+  +++       P G  V    + LI   L+     R T D+I
Sbjct: 319 QK---AILTGDLKF------PQGTSVNTDCIDLINAILSPRVDERPTIDDI 360

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 109/214 (50%), Gaps = 13/214 (6%)

Query: 325 ELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKL 383
           E++G+G  + V K  +R TGK +A K I   ++  N+   + RE+E+L++L    ++V+L
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMGNMDG-VTRELEVLRKL-NHPKIVRL 254

Query: 384 IEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
             +  DD    +LME     DL   +    +   D    R ++++++E +K +H   I H
Sbjct: 255 KGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQVLEGVKYIHSQGISH 312

Query: 443 SDLKPANFIFVKGT---LKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSX 499
            DLKP N +  +     +K+ DFG+A    + T   +  T  GT  Y+APE +I+   + 
Sbjct: 313 RDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPE-VIAGKANA 368

Query: 500 XXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS 533
                  +     D+WS GC++Y +  GH P+S 
Sbjct: 369 EENEKRNEYSSLVDMWSMGCLVYVILTGHLPFSG 402

>Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar to
           Ashbya gossypii AEL205W
          Length = 818

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 140/305 (45%), Gaps = 59/305 (19%)

Query: 321 LSIVELLGKGGSSKVYKV-------------QDR-----TGKYYALKQILLEELDENLKT 362
             ++E  G+G S  VY               +D+      G   A+KQ++L +  +  K 
Sbjct: 522 FQMIEKAGQGASGSVYLARRLKLPPYDENLDEDKQLICEVGNKVAIKQMILSK--QPRKE 579

Query: 363 DLEREIELLKRLAREERVVKLIE--YKIDDRMVQVL--MECGNFDLSHVL-----HERVN 413
            +  EI ++K  ++ + +V  +E   K +D +  V+  ME G+  L+ V+     +E   
Sbjct: 580 LIVNEILVMKD-SQHKNIVNFLEAYLKTEDDLWVVMEYMEGGS--LTDVIENSMGNETSE 636

Query: 414 RPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNT 472
            P     +  + +E  + +K +HD +I+H D+K  N +    G +K+ DFG   K+ D  
Sbjct: 637 SPMTEPQIAYIVRETCQGLKFLHDKNIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDK- 695

Query: 473 LNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYS 532
               R T +GTP +MAPE +  + Y               D+WS G +  +M  G PPY 
Sbjct: 696 -RSKRATMVGTPYWMAPEVVKQREYDEKV-----------DVWSLGIMTIEMLEGEPPY- 742

Query: 533 SFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIK----TCLNRDPQLRATTDEIQ 588
             L  + L A+      +   N +P  K+ P+SL   IK     CL  D + RA+T+E+ 
Sbjct: 743 --LNEEPLKALY-----LIATNGTPKLKR-PESLSLEIKRFLSVCLCVDVRYRASTEELL 794

Query: 589 HCSFF 593
           H SFF
Sbjct: 795 HHSFF 799

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 136/304 (44%), Gaps = 51/304 (16%)

Query: 326  LLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKT--DLEREIELLKRLAREERVVK 382
             +G G    VY  V    G+  A+K+I +++ +   K    ++ E+ +L+ L+    VV+
Sbjct: 1268 FVGGGTFGTVYSAVNLDNGEILAVKEIKIQDANAMKKFFPSIKEEMSVLEMLSHP-NVVQ 1326

Query: 383  LIEYKIDDRMVQVLME-CGNFDLSHVL-HERVNRPFDINFVRLMSKEMIECIKAVHDSDI 440
                ++    V + ME C    ++ +L H R+    D    ++ + E++E +  +H S +
Sbjct: 1327 YYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIE---DEMVTQVYTLELLEGLAYLHQSGV 1383

Query: 441  VHSDLKPANFIF-VKGTLKLIDFGIANKIA---------------DNTLNVYRNTQ---- 480
            VH D+KP N +    G +K +DFG A KIA               D++     NT     
Sbjct: 1384 VHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFARSVASDSSTGSADNTSEQDG 1443

Query: 481  ------MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
                  MGTP YMAPE++              ++G   DIWS GC++ +M  G  P++  
Sbjct: 1444 LALQDMMGTPMYMAPESITGS-------PNKGRLGA-DDIWSLGCVILEMITGRRPWAKL 1495

Query: 535  LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
               D   AIM  ++   +  + P   +V  +    ++ CL  +P  RA+  E+      +
Sbjct: 1496 ---DNEWAIMY-HVAAGHIPQLPSNDEVSSAGKKFLRRCLQENPFKRASAVEL----LMD 1547

Query: 595  PMII 598
            P I+
Sbjct: 1548 PWIV 1551

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/233 (29%), Positives = 112/233 (48%), Gaps = 24/233 (10%)

Query: 306 ANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQI--LLEELDENLKT 362
           A   SK+ SR T     + + LGKG S +V   ++  TGK  A+K +          L  
Sbjct: 43  ATQSSKRRSRDTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKTKSSRPNALPY 102

Query: 363 DLEREIELLKRLAREE--RVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINF 420
            +EREI ++K ++      + ++ E K++  +V   ++ G      V   R++    I++
Sbjct: 103 GIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHY 162

Query: 421 VRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT--LKLIDFGIANKIADNTLNVYRN 478
            R    ++IE     H  +I H DLKP N +  K    +K+ DFG+A   A  T N    
Sbjct: 163 FR----QIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMA---ALQTSNKLLE 215

Query: 479 TQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
           T  G+P+Y +PE ++ + Y+          G PSD+WS G IL+ +  GH P+
Sbjct: 216 TSCGSPHYASPEIVMGKTYN----------GGPSDVWSCGIILFALLTGHLPF 258

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 138/302 (45%), Gaps = 40/302 (13%)

Query: 309 MSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTD-LER 366
           ++KQ  ++  ++    E LG G  S V     R +GK YA+K +  E L    K   +  
Sbjct: 112 LTKQVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTV 171

Query: 367 EIELLKRLAREERVVKLIEYKIDDRMVQVLMEC---GNFDLSHVLHERVNRPFDINFVRL 423
           E   L++L   + +++L     D+  +  L+E    G+F      +  +N        R 
Sbjct: 172 EKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYGSLNE----QCARY 227

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT-LKLIDFGIANKI-------ADNT--- 472
            + ++I+ + ++H   I+H D+KP N +  K   +KL DFG A  +       AD     
Sbjct: 228 YASQIIDAVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCF 287

Query: 473 -LNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
            LN    + +GT  Y++PE L++ +Y+              DIW++GCIL+QM  G PP+
Sbjct: 288 DLNARSKSFVGTAEYVSPE-LLNDSYTDSR----------CDIWAFGCILFQMVAGKPPF 336

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCS 591
            +   +     +M    +I Y   +      PQ +  L+K  L ++P  R T ++I+   
Sbjct: 337 KASNEYLTFQKVM----KIQYAFTA----GFPQIIKDLVKKLLVKEPNDRLTIEQIKAHI 388

Query: 592 FF 593
           FF
Sbjct: 389 FF 390

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 129/276 (46%), Gaps = 39/276 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + ++   +V  I+
Sbjct: 605 IGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPK--KELIINEI-LVMKGSKHPNIVNFID 661

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               K D  ++   ME G+  L+ V+   +     I  V    +E +  +K +H   ++H
Sbjct: 662 SYVLKGDLWVIMEYMEGGS--LTDVVTHCILTEGQIGAV---CRETLSGLKFLHSKGVLH 716

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  ++G +KL DFG   +I  N LN+ R T +GTP +MAPE +  + Y    
Sbjct: 717 RDIKSDNILLSMEGDIKLTDFGFCAQI--NELNLKRTTMVGTPYWMAPEVVSRKEY---- 770

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESP 557
                  G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P    
Sbjct: 771 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPKLKEP---- 816

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             + +  SL   +  CL  +P+ RA+  E+ H  + 
Sbjct: 817 --ENLSSSLKKFLDWCLCVEPEERASATELLHDEYI 850

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 142/299 (47%), Gaps = 37/299 (12%)

Query: 243 QKALSQCQQEMPTANEQAKLISKKLVSERVDYLIRDYNSKIQNK-KHQTIPKIEAPVPQS 301
           QK L   Q E    +E ++  +     E  D    + + + Q K KH  +        + 
Sbjct: 11  QKPLDDRQGEESHTDEGSEKETTATKGENEDKDAENESEETQEKPKHSQVTYYNEEQYKQ 70

Query: 302 VPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENL 360
             SQA +   ++S    ++  I+  LG G   +V+ ++ R  G+YYA+K +L +E+   L
Sbjct: 71  FISQARVTGGKYSL---QDFQILRTLGTGSFGRVHLIRSRHNGRYYAMK-VLKKEIVVRL 126

Query: 361 K----TDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLM---ECGNFDLSHVLHERVN 413
           K    T+ ER   L+  +     ++++     D + + ++M   E G  +L  +L  R +
Sbjct: 127 KQVEHTNDER---LMLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGG--ELFSLL--RKS 179

Query: 414 RPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNT 472
           + F     +  + E+   ++ +H  DI++ DLKP N +  K G +K+ DFG A  + D T
Sbjct: 180 QRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT 239

Query: 473 LNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
                 T  GTP+Y+APE + ++ Y+           K  D WS+G ++Y+M  G+ P+
Sbjct: 240 Y-----TLCGTPDYIAPEVVSTKPYN-----------KSIDWWSFGILIYEMLAGYTPF 282

>KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} similar
           to uniprot|P53104 Saccharomyces cerevisiae YGL180W ATG1
           Protein serine/threonine kinase required for autophagy
           and for the cytoplasm-to-vacuole targeting (Cvt) pathway
          Length = 831

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 87/337 (25%), Positives = 144/337 (42%), Gaps = 79/337 (23%)

Query: 315 RITDEELSIVELLGKGGSSKVYK-VQDRTGKYYALKQILLEEL-DENLKTDLEREIELLK 372
           R+  E  S+ + +GKG  + VYK +  R G+  A+K +   +L ++ L  +LE EI +LK
Sbjct: 15  RLPTENYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILK 74

Query: 373 RLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVL----------------------- 408
           ++ +   +V LI+ +       ++ME C   DL+  +                       
Sbjct: 75  KI-KHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPP 133

Query: 409 ---HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFI-------------- 451
              H  +NR   +N+++ +S      +K +   ++VH D+KP N +              
Sbjct: 134 STEHNGLNRVLVVNYLQQLSS----ALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTF 189

Query: 452 ----FVK----GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXX 503
               FV       LK+ DFG A  + + +L     T  G+P YMAPE L  Q Y+     
Sbjct: 190 HELGFVGIYNLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEILNYQKYNAK--- 243

Query: 504 XXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVP 563
                   +D+WS G +LY+M  G PP+ +    +    I   N +I  P  S C   + 
Sbjct: 244 --------ADLWSVGTVLYEMCCGRPPFKASNHLELFQKIKKANDEITVP--SNC--YIE 291

Query: 564 QSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISK 600
             L  LI+  L  DP  R     +    FFN  ++++
Sbjct: 292 PKLFNLIRGLLTFDPDSR-----MGFTDFFNNEVVTE 323

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 138/300 (46%), Gaps = 34/300 (11%)

Query: 309 MSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLKTD-LER 366
           ++K   ++  ++    E LG G  S V     R +GK YA+K +  E L    K   +  
Sbjct: 113 LTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARESGKKYAVKVLSKEYLIRQKKVKYVTV 172

Query: 367 EIELLKRLAREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSK 426
           E   L++L   + +++L     D+  +  L+E         L ++     +I   R  + 
Sbjct: 173 EKLALQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNEI-CARYYAS 231

Query: 427 EMIECIKAVHDSDIVHSDLKPANFIFVKGT-LKLIDFGIA-------NKIADN--TLNVY 476
           ++I+ + ++H   I+H D+KP N +  K   +KL DFG A       +  AD     ++Y
Sbjct: 232 QIIDAVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLY 291

Query: 477 RNTQ--MGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
             ++  +GT  Y++PE L++ +Y+              DIW++GCILYQM  G PP+ + 
Sbjct: 292 AKSKSFVGTAEYVSPE-LLNDSYTDSR----------CDIWAFGCILYQMLAGKPPFKAA 340

Query: 535 LGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
             +     +M    +I Y   +      PQ +  L+K  L RDP  R   ++I+   FF+
Sbjct: 341 NEYLTFQKVM----KIQYAFTA----GFPQIVKDLVKKLLVRDPNDRLAIEQIKAHVFFD 392

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 137/297 (46%), Gaps = 46/297 (15%)

Query: 325  ELLGKGGSSKVY-KVQDRTGKYYALKQILLEEL---DENLKTDLE---REIELLKRLARE 377
            E++GKG    V+  +   TG+  A+KQ+ +      DE   + LE    E+  LK L   
Sbjct: 1150 EMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DH 1208

Query: 378  ERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVH 436
              +V+ + ++  + +  + +E      +  ++  R+   FD N +R ++ +++  +  +H
Sbjct: 1209 TNIVQYLGFENKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLH 1266

Query: 437  DSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQM---GTPNYMAPETL 492
               I+H D+K  N +  V G  K+ DFGI+ K    + N+Y N+ M   GT  +MAPE +
Sbjct: 1267 SKKILHRDMKADNLLLDVDGICKISDFGISKK----SNNIYSNSDMTMRGTVFWMAPEMV 1322

Query: 493  -ISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
               Q YS              DIWS GC++ +M  G  P+S+      ++A M    +I 
Sbjct: 1323 DTKQGYSAKV-----------DIWSLGCVVLEMFAGKRPWSNL----EVVAAM---FKIG 1364

Query: 552  YPNESPCGKKVPQSLVA-----LIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFL 603
                +P   +  Q +++      +  C   +P+ R T DE+    F    I+ K F+
Sbjct: 1365 KFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELLSHPF---CIVDKEFV 1418

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 134/288 (46%), Gaps = 34/288 (11%)

Query: 317 TDEELSIVELLGKGGSSKVYKVQDRT--GKYYALKQILLEELDENLKTD-LEREIELLKR 373
           T +    ++ LG+G  S VY+  +R+  G+ YA+K    + +    K   +  E +LL  
Sbjct: 6   TPDSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNM 65

Query: 374 LAREER--VVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431
           LA+     +VKL     D   +  ++E  +      L +R+ R    +  R ++ ++++ 
Sbjct: 66  LAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGR-LTEDLSRHITAQLVDT 124

Query: 432 IKAVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQ--MGTPNYMA 488
           +  +H   ++H DLKP N +  + G + + DFG A   AD      + T   +GT  Y++
Sbjct: 125 VDYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVS 184

Query: 489 PETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNI 548
           PE L+             + G  SDIW+ GCI+YQ+  G PP   F G +  L      +
Sbjct: 185 PELLLHS-----------QCGFSSDIWALGCIIYQLNQGKPP---FRGENE-LQTFEKIV 229

Query: 549 QIDYP---NESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
            +DY    + SP        +V+++++ L  DP  R +  +++   +F
Sbjct: 230 ALDYKWLFSNSP-------QVVSIVQSILVTDPLKRPSAAQLKQNPWF 270

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 106/218 (48%), Gaps = 21/218 (9%)

Query: 322 SIVELLGKGGSSKVYKVQDRTGK-YYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           SI   +G+G    VYK  DRT +   A+K + LE  DE+++  L +EI  L  L +   +
Sbjct: 14  SIQSCIGRGNFGDVYKAMDRTTQEIVAIKVVNLEHSDEDIEL-LAQEIFFLAEL-KSPLI 71

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
              I   ++D  + ++ME CG    S +L            V  +  ++   +K +H+  
Sbjct: 72  TNYITTMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLHEQR 131

Query: 440 IVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQ--N 496
            +H D+K AN +   +G +KL DFG++  I      + R+T +GTP +MAPE +  +   
Sbjct: 132 KIHRDIKAANILLNEEGMVKLGDFGVSGHIRST---MKRDTFVGTPYWMAPEVVCCEVDG 188

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
           Y+           + +DIWS G   Y++  G PP S +
Sbjct: 189 YN-----------EKADIWSLGITTYELLKGLPPLSKY 215

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 116/237 (48%), Gaps = 28/237 (11%)

Query: 322 SIVELLGKGGSSKVYK-VQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERV 380
           ++ +++GKG    VYK V   T +  A+K I  E  +E    +   EI+LLK L R E +
Sbjct: 20  ALKQVIGKGAYGVVYKAVNKATDQVIAIKAI--EYQNEEELHEHMLEIDLLKNL-RHENI 76

Query: 381 VKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSD 439
           VK   +      + +L+E C    L  ++ +           ++  K+ +  ++ +HD  
Sbjct: 77  VKYHGFIQSSHELYILLEYCIRGSLRDLIKKEALSEAK---AKVYVKQTVRGLQYLHDQG 133

Query: 440 IVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYS 498
           ++H D+K AN +  + G +KL DFG++ ++ +  +     T  G+PN+MAPE ++ +  S
Sbjct: 134 VIHRDIKAANLLLTENGIVKLADFGVSTRVTNMAM-----TYAGSPNWMAPEVMLGKGAS 188

Query: 499 XXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNE 555
                        SDIWS G  + ++  G+PP+ + +      AI+N    + YP E
Sbjct: 189 TV-----------SDIWSLGATVVELLTGNPPFHNLVNEAACYAIVN---DVYYPPE 231

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 121/271 (44%), Gaps = 34/271 (12%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDEN------LKTDLEREIELLKRLAREER 379
           LGKG S +V   ++  TGK  A+K +    +  N      L   +EREI ++K L     
Sbjct: 70  LGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTSLPYGIEREIIIMK-LISHPN 128

Query: 380 VVKLIE-YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           V+ L E ++    +  VL      +L   L  R   P +   V    K++++ +   H  
Sbjct: 129 VMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLP-EQEAVHYF-KQIVQGVSYCHHF 186

Query: 439 DIVHSDLKPANFIFVKGTL--KLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQN 496
           +I H DLKP N +  K  L  K+ DFG+A   A  T +    T  G+P+Y +PE ++ Q 
Sbjct: 187 NICHRDLKPENLLLDKKNLSVKIADFGMA---ALETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 497 YSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNES 556
           Y           G PSD+WS G IL+ +  GH P++       LL + +   Q+      
Sbjct: 244 YH----------GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP----- 288

Query: 557 PCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              + +      LI   L  DP +R T DE+
Sbjct: 289 ---QNISNEAKDLIAKILIVDPAMRITIDEV 316

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 122/237 (51%), Gaps = 36/237 (15%)

Query: 304 SQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDR-TGKYYALKQILLEELDENLK- 361
           +QA + S ++S    ++  I+  LG G   +V+ ++ R  G+YYA+K +L +E+   LK 
Sbjct: 73  AQARVTSGKYSL---QDFQILRTLGTGSFGRVHLIRSRHNGRYYAMK-VLKKEIVVRLKQ 128

Query: 362 ---TDLEREIELLKRLAREERVVKLIEYKIDDRMVQVLM---ECGNFDLSHVLHERVNRP 415
              T+ ER   L+  +     ++++     D + + ++M   E G  +L  +L  R ++ 
Sbjct: 129 VEHTNDER---LMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGG--ELFSLL--RKSQR 181

Query: 416 FDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK-GTLKLIDFGIANKIADNTLN 474
           F     +  + E+   ++ +H  DI++ DLKP N +  K G +K+ DFG A  + D T  
Sbjct: 182 FPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY- 240

Query: 475 VYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
               T  GTP+Y+APE + ++ Y+           K  D WS+G ++Y+M  G+ P+
Sbjct: 241 ----TLCGTPDYIAPEVVSTKPYN-----------KSIDWWSFGILIYEMLAGYTPF 282

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 135/295 (45%), Gaps = 53/295 (17%)

Query: 314 SRITDEELSIVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIE 369
           SRI + +  IV+ LG+G   KV   Y V   TG+  ALK I  + L + +++  +EREI 
Sbjct: 37  SRIGNYQ--IVKTLGEGSFGKVKLAYHVT--TGQKVALKIINKKVLAKSDMQGRIEREIS 92

Query: 370 LLKRLAREERVVKLIEY-KIDDRMVQVLMECGNFDLSHVLH-----ERVNRPFDINFVRL 423
            L RL R   ++KL +  K  D ++ V+   GN    +++      E+  R F       
Sbjct: 93  YL-RLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEKEARRF------- 144

Query: 424 MSKEMIECIKAVHDSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMG 482
             +++I  ++  H   IVH DLKP N +  +   +K+ DFG++N + D     +  T  G
Sbjct: 145 -FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCG 200

Query: 483 TPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLA 542
           +PNY APE +  + Y+          G   D+WS G ILY M     P+           
Sbjct: 201 SPNYAAPEVISGKLYA----------GPEVDVWSSGVILYVMLCRRLPFD---------- 240

Query: 543 IMNPNIQIDYPNESPCGKKVPQSL----VALIKTCLNRDPQLRATTDEIQHCSFF 593
             + +I + + N S     +P+ L      LIK  L  +P  R +  EI    +F
Sbjct: 241 --DESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDEWF 293

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 128/276 (46%), Gaps = 31/276 (11%)

Query: 323 IVELLGKGGSSKV-YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREERV 380
           IV+ LG+G   KV       TG+  ALK I  + L + +++  +EREI  L RL R   +
Sbjct: 48  IVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHPHI 106

Query: 381 VKLIEY-KIDDRMVQVLMECGNFDLSHVLH-ERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           +KL +  K  D ++ V+   GN    +++  ++++     +  R   +++I  ++  H  
Sbjct: 107 IKLYDVIKSKDEIIMVMEYAGNELFDYIVQRDKMSE----DEARRFFQQIISAVEYCHRH 162

Query: 439 DIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  + Y
Sbjct: 163 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 219

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP 557
           +          G   D+WS G ILY M     P+      D  + ++  NI         
Sbjct: 220 A----------GPEVDVWSCGVILYVMLCRRLPFD-----DESIPVLFKNIN---NGVYT 261

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFF 593
             K + Q    LIK  L  +P  R +  EI    +F
Sbjct: 262 IPKFLSQGASTLIKKMLIVNPLNRISIQEIMQDEWF 297

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 131/280 (46%), Gaps = 39/280 (13%)

Query: 323 IVELLGKGGSSKV-YKVQDRTGKYYALKQILLEELDE-NLKTDLEREIELLKRLAREERV 380
           IV+ LG+G   KV       TG+  ALK I  + L + +++  +EREI  L RL R   +
Sbjct: 56  IVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYL-RLLRHPHI 114

Query: 381 VKLIEY-KIDDRMVQVLMECGNFDLSHVLH-ERVNRPFDINFVRLMSKEMIECIKAVHDS 438
           +KL +  K  D ++ V+   GN    +++  ++++     +  R   +++I  ++  H  
Sbjct: 115 IKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSE----DEARRFFQQIISAVEYCHRH 170

Query: 439 DIVHSDLKPANFIFVKG-TLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNY 497
            IVH DLKP N +  +   +K+ DFG++N + D     +  T  G+PNY APE +  + Y
Sbjct: 171 KIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN---FLKTSCGSPNYAAPEVISGKLY 227

Query: 498 SXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP 557
           +          G   D+WS G ILY M     P+             + +I + + N S 
Sbjct: 228 A----------GPEVDVWSCGVILYVMLCRRLPFD------------DESIPVLFKNISN 265

Query: 558 CGKKVPQSL----VALIKTCLNRDPQLRATTDEIQHCSFF 593
               +P+ L     +LIK  L  +P  R +  EI    +F
Sbjct: 266 GVYSLPKFLSPGAASLIKRMLIVNPLNRISIHEIMQDDWF 305

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 111/227 (48%), Gaps = 22/227 (9%)

Query: 314 SRITDEEL-SIVELLGKGGSSKVYKVQDRTGK-YYALKQILLEELDENLKTDLEREIELL 371
           SRI   +L SI   +G+G    VYK  DRT +   A+K + LE  DE+++  L +EI  L
Sbjct: 5   SRIPPSKLYSIQSCIGRGNFGDVYKAMDRTTQEIVAIKVVNLEHSDEDIEL-LAQEIFFL 63

Query: 372 KRLAREERVVKLIEYKIDDRMVQVLME-CGNFDLSHVLHERVNRPFDINFVRLMSKEMIE 430
             L +   +   I   ++D  + ++ME CG    S +L            V  +  ++  
Sbjct: 64  AEL-KSPLITNYITTMLEDVSMWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTL 122

Query: 431 CIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAP 489
            +K +H+   +H D+K AN +   +G +KL DFG++  +      + R+T +GTP +MAP
Sbjct: 123 GLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHLRST---MKRDTFVGTPYWMAP 179

Query: 490 ETLISQ--NYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSF 534
           E +  +   Y+           + +DIWS G   Y++  G PP S +
Sbjct: 180 EVVCCEVDGYN-----------EKADIWSLGITTYELLKGLPPLSKY 215

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 95/349 (27%), Positives = 157/349 (44%), Gaps = 51/349 (14%)

Query: 304 SQANLMSKQWSRITDEELSIVELLGKGGSSKV---YKVQDRTGKYYALKQILLEELDE-N 359
           SQ NL++   S I + +  IV+ LG+G   KV   Y +   TG+  ALK I  + L + +
Sbjct: 37  SQQNLLADG-SHIGNYQ--IVKTLGEGSFGKVKLAYHIT--TGQKVALKIINKKVLAKSD 91

Query: 360 LKTDLEREIELLKRLAREERVVKLIEY-KIDDRMVQVLMECGNFDLSHVLH------ERV 412
           ++  +EREI  L RL R   ++KL +  K  D ++ V+   GN    +++       E  
Sbjct: 92  MQGRIEREISYL-RLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEEEA 150

Query: 413 NRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKG-TLKLIDFGIANKIADN 471
            R F         +++I  ++  H   IVH DLKP N +  +   +K+ DFG++N + D 
Sbjct: 151 RRFF---------QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 201

Query: 472 TLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPY 531
               +  T  G+PNY APE +  + Y+          G   D+WS G ILY M     P+
Sbjct: 202 N---FLKTSCGSPNYAAPEVISGKLYA----------GPEVDVWSSGVILYVMLCRRLPF 248

Query: 532 SSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCS 591
                 D  + ++  NI           K + +    LIK  L  +P  R +  EI    
Sbjct: 249 D-----DESIPVLFKNIS---NGVYTLPKFLSEGAAGLIKRMLIVNPLNRISILEIMQDD 300

Query: 592 FFN---PMIISKPFLESLIDNAINYGIENQNITQDRIKLLSNEVVSKLS 637
           +F    P  +  P L+           ++ + T++  + + +E+V+ LS
Sbjct: 301 WFKVGLPTYLIPPELKQQEQEQQQQQEQHDDGTKNNSEEIDDELVTALS 349

>Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {ON}
           YMR104C (REAL)
          Length = 676

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 138/299 (46%), Gaps = 37/299 (12%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++G+G   KV +V+ + T K YALK +    +    E   T  ER +  L R+
Sbjct: 341 DDFDLLKVIGRGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTV--LARV 398

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDL-SHVLHERVNRPFDINFVRLMSKEMIECIK 433
                V     ++  +++  VL      +L  H+ HE     F +   R    E++  + 
Sbjct: 399 DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGR---FSLARSRFYIAELLCALD 455

Query: 434 AVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN-KIADNTLNVYRNTQMGTPNYMAPET 491
           ++H  D+++ DLKP N +   +G + L DFG+    + DN      +T  GTP Y+APE 
Sbjct: 456 SLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKT---DTFCGTPEYLAPEI 512

Query: 492 LISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQID 551
           L+ Q Y+           K  D W+ G +LY+M  G PPY     +D  + +M   I + 
Sbjct: 513 LLGQGYT-----------KTVDWWTLGILLYEMMTGLPPY-----YDENVPVMYKKI-LQ 555

Query: 552 YPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPFLESLI 607
            P   P G     +   L+   L+RDP  R     TDEI++  FF  +   K  ++  I
Sbjct: 556 QPLLFPDG--FDPAAKDLLIGLLSRDPNRRLGVNGTDEIRNHPFFKDISWKKLLMKGYI 612

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 140/303 (46%), Gaps = 53/303 (17%)

Query: 310 SKQWSRITDEELSIVELLGKGGSSKVYKVQD-RTGKYYALKQILLEEL------------ 356
           SK+ SR T     + + LGKG S +V   ++  TGK  A+K +  + +            
Sbjct: 50  SKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAA 109

Query: 357 DENLKTDLEREIELLKRLAREE--RVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNR 414
           + NL   +EREI ++K ++      + ++ E K +  +V   +E G      V   ++  
Sbjct: 110 NGNLPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPE 169

Query: 415 PFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVKGT--LKLIDFGIANKIADNT 472
              +++ R    ++I+ +   H+ +I H DLKP N +  K    +K+ DFG+A   A  T
Sbjct: 170 QEAVHYFR----QIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMA---ALET 222

Query: 473 LNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYS 532
            N    T  G+P+Y +PE ++ +NY           G PSD+WS G IL+ +  GH P++
Sbjct: 223 TNKLLETSCGSPHYASPEIVMGKNYH----------GSPSDVWSCGIILFALLTGHLPFN 272

Query: 533 SFLGHDRLLAIMNPNIQIDYPNESPCGK-KVPQSLVA----LIKTCLNRDPQLRATTDEI 587
                  LL +               GK  +PQ++ +    LI   L  DP+ R T +E+
Sbjct: 273 DDNIKKLLLKVQ-------------SGKYHMPQNISSEAQDLISKILIVDPRGRITINEV 319

Query: 588 -QH 589
            QH
Sbjct: 320 LQH 322

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 129/277 (46%), Gaps = 39/277 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + ++   +V  I+
Sbjct: 335 IGQGASGGVYTAYELGTNASVAIKQMNLEK--QPKKELIINEI-LVMKGSKHSNIVNFID 391

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               K D  +V   ME G+  L+ V+   +     I  V    +E ++ ++ +H   ++H
Sbjct: 392 SYLLKGDLWVVMEYMEGGS--LTDVVTHCILTEGQIGAV---CRETLKGLQFLHSKGVIH 446

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y    
Sbjct: 447 RDIKSDNILLSMNGDIKLTDFGFCAQI--NEVNLKRTTMVGTPYWMAPEVVSRKEY---- 500

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAI----MNPNIQIDYPNESP 557
                  G   DIWS G ++ +M  G PPY   L    L A+     N   ++  P    
Sbjct: 501 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALYLIATNGTPKLKDP---- 546

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFN 594
             + +  +L   +  CL  DP+ RA   E+   +F +
Sbjct: 547 --ENLSDTLKEFLGWCLKVDPEDRANAAELLSGTFIS 581

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 125/286 (43%), Gaps = 59/286 (20%)

Query: 324 VELLGKGGSSKVYKVQDR-TGKYYALKQILLEEL--DENLKTDLEREIELLKRLAR---- 376
           V +LG+G   KV  V+D+ T K YA+KQ+   E+   E+ K++ E ++ L KR+ R    
Sbjct: 126 VRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKRIERTFAE 185

Query: 377 --------EERVVKLIEYKIDDRMVQVLME---CGNFDLSHVLHERVNRPFDINFVRLMS 425
                      +VKL     D+  + +L++    G        H +     D + V   +
Sbjct: 186 KSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGEL----FFHLKEQGTLDEDTVAFYA 241

Query: 426 KEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANK-IADNTLNVYRNTQM-- 481
            E+   +K +HD  IV+ DLKP N +   KG L L DFG++ K +  N+ N    T +  
Sbjct: 242 AEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSLNE 301

Query: 482 ------------GTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHP 529
                       GTP Y APE L    Y+           K  D +S GC++Y M  G P
Sbjct: 302 PSEDLSTLHSIIGTPEYCAPEILQGLPYN-----------KNCDWYSLGCLIYDMLSGKP 350

Query: 530 PYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLN 575
           PY+    H  +L  +  + Q         G K+P  L   +K  LN
Sbjct: 351 PYTG-ANHKVILNKIQKDKQ---------GPKIPYYLSEGMKDMLN 386

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 118/274 (43%), Gaps = 26/274 (9%)

Query: 323 IVELLGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVV 381
           I++ +G+G    VYK +   T +  A+K + LE+ DE +   L +EI  L  L       
Sbjct: 22  ILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEPIDL-LAQEIFFLSELRSPYITN 80

Query: 382 KLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
               + +D  M  V+  CG    + +L          +    +  E++  +  +H    +
Sbjct: 81  YKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLDYLHSQRKI 140

Query: 442 HSDLKPANFIFV-KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H D+K AN +    G +KL DFG++ ++    +   R+T +GTP +MAPE +I +N    
Sbjct: 141 HRDIKSANILLTDNGHVKLGDFGVSGQM---MVTRKRDTFVGTPFWMAPE-VIDRNKK-- 194

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESP--C 558
                    + +DIWS G  + ++  GHPP   +     L+AI         P   P   
Sbjct: 195 ------GYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAI---------PKRDPPKL 239

Query: 559 GKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSF 592
            K+        +  CL +DP  R T  E+    F
Sbjct: 240 DKRFSSHAKDFVAQCLIKDPSQRPTASELLKHRF 273

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 130/270 (48%), Gaps = 39/270 (14%)

Query: 327 LGKGGSSKVYKVQD-RTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIE 385
           +G+G S  VY   +  T    A+KQ+ LE+  +  K  +  EI L+ + ++ + +V  I+
Sbjct: 629 IGQGASGGVYTAYEVGTNASVAIKQMNLEK--QPKKELIINEI-LVMKGSKHQNIVNFID 685

Query: 386 ---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVH 442
               K D  +V   ME G+  L+ V+   +     I  V    +E +  ++ +H   ++H
Sbjct: 686 SYVLKGDLWVVMEYMEGGS--LTDVVTHCILTEAQIGAV---CRETLRGLQFLHSKGVIH 740

Query: 443 SDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXX 501
            D+K  N +  + G +KL DFG   +I  N +N+ R T +GTP +MAPE +  + Y    
Sbjct: 741 RDIKSDNILLSMNGEIKLTDFGFCAQI--NEINLKRTTMVGTPYWMAPEVVSRKEY---- 794

Query: 502 XXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKK 561
                  G   DIWS G ++ +M  G PPY   L    L A+      +   N +P  K+
Sbjct: 795 -------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIATNGTPKLKE 839

Query: 562 VPQSLVALIKT----CLNRDPQLRATTDEI 587
            P+ L   +K+    CLN +P  RA+  E+
Sbjct: 840 -PEVLSPELKSFLAWCLNVNPDTRASATEL 868

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 131/285 (45%), Gaps = 57/285 (20%)

Query: 334 KVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMV 393
           K Y ++ +  KY  +++I L++L+ ++       I+L      E  +  L+EY  +  ++
Sbjct: 292 KKYLIKQKKVKYVNIEKIALQKLNNSI----NGIIKLYCTFQDEANLYFLLEYASNGDLL 347

Query: 394 QVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV 453
            +L + G+FD +  ++               + ++I+ I  +H   I+H D+KP N +  
Sbjct: 348 TLLKKYGSFDETSTIY--------------FTAQIIDSIHYIHSMGIIHRDIKPENILLT 393

Query: 454 KG-TLKLIDFGIANKIADNT----------LNVYRNTQ--MGTPNYMAPETLISQNYSXX 500
           K   +KL DFG A KI D +           N+   ++  +GT  Y++PE L++ +Y+  
Sbjct: 394 KDFKIKLTDFGTA-KILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPE-LLTDSYTDS 451

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSS---FLGHDRLLAIMNPNIQIDYPNESP 557
                       DIW++GCIL+Q+  G PP+ +   +L   ++       I++ Y     
Sbjct: 452 R----------CDIWAFGCILFQLIAGKPPFKATNEYLTFQKI-------IKLQY----A 490

Query: 558 CGKKVPQSLVALIKTCLNRDPQLRATTDEIQHCSFFNPMIISKPF 602
                P  L  LIK  L ++P  R T  +I+   F+     S P+
Sbjct: 491 FTAGFPTILRDLIKKILIKNPNNRLTIHQIKSHLFYRSKDFSNPW 535

>Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104C
           (REAL)
          Length = 680

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 82/287 (28%), Positives = 132/287 (45%), Gaps = 39/287 (13%)

Query: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374
           ++  +++++GKG   KV +V+ + T K YALK I    +    E   T  ER +  L R+
Sbjct: 345 DDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTV--LARV 402

Query: 375 AREERVVKLIEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKA 434
                V     ++  +++  VL      +L +  H +    FD++  R  + E++  +  
Sbjct: 403 DCPFIVPLKFSFQSPEKLYFVLAFINGGELFY--HLQKEGRFDLSRARFYTAELLCALDN 460

Query: 435 VHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYMAPE 490
           +H  D+++ DLKP N +   +G + L DFG+     K  D T     +T  GTP Y+APE
Sbjct: 461 LHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKT-----DTFCGTPEYLAPE 515

Query: 491 TLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQI 550
            L+   YS           K  D W+ G +LY+M  G PPY     +D  +  M   I +
Sbjct: 516 LLLGLGYS-----------KAVDWWTLGVLLYEMLTGLPPY-----YDEDVPKMYKKI-L 558

Query: 551 DYPNESPCGKKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFN 594
             P   P G    +    L+   L+RDP  R      DEI++  FF+
Sbjct: 559 QEPLVFPDG--FDRDAKDLLIGLLSRDPTRRLGYNGADEIRNHPFFS 603

>TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa]
           {ON} Anc_1.182 YJL164C
          Length = 426

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 119/250 (47%), Gaps = 48/250 (19%)

Query: 296 APVPQSVPSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQ-DRTGKYYALKQILLE 354
            PVPQ +     +  K   + T ++  I+  LG G   +V+ V+ +  G++YA+K     
Sbjct: 96  TPVPQVM-----VGKKTSGKYTLQDFQIMRTLGTGSFGRVHLVRSNHNGRFYAMKV---- 146

Query: 355 ELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMV-------QVLM-----ECGNF 402
                LK     +++ ++    E R++ L+ +    RM        QV M     E G  
Sbjct: 147 -----LKKHTVVKLKQVEHTNDERRMLSLVTHPFLVRMWGTFQDSQQVFMIMDYIEGG-- 199

Query: 403 DLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFVK-GTLKLID 461
           +L  +L  R ++ F     +  + E+   ++ +H +DI++ DLKP N +  K G +K+ D
Sbjct: 200 ELFSLL--RKSQRFPNPVAKFYAAEVCLALEYLHSNDIIYRDLKPENILLDKNGHIKITD 257

Query: 462 FGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCIL 521
           FG A  + D T      T  GTP+Y+APE + ++ Y+           K  D WS+G ++
Sbjct: 258 FGFAKYVPDVTY-----TLCGTPDYIAPEVISTKPYN-----------KSVDWWSFGILI 301

Query: 522 YQMTYGHPPY 531
           Y+M  G+ P+
Sbjct: 302 YEMLAGYTPF 311

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 141/300 (47%), Gaps = 46/300 (15%)

Query: 303  PSQANLMSKQWSRITDEELSIVELLGKGGSSKVYKVQDRTGKYYALKQILLEEL------ 356
            P Q     K+  +I+D    I++ +G+G   KV     +  KY  + +++ +E       
Sbjct: 1021 PEQQIGAQKRTKKISD--FVILQKMGEGAYGKVNLCLHKKKKYIVVIKMIFKERILVDTW 1078

Query: 357  --DENLKTDLEREIELLKRLARE--ERVVKLIEYKIDDRMVQVLM----ECGNFDLSHVL 408
              D  L T L  EI+++  L +   + +++L+++  DD    +      E G  DL  ++
Sbjct: 1079 VRDRQLGTILS-EIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLI 1137

Query: 409  HERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIANK 467
              + N   ++   +L+  +++  IK +HD  IVH D+K  N I   +G +KLIDFG A  
Sbjct: 1138 EFKTNMS-EVE-TKLIFMQVVSSIKFLHDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAY 1195

Query: 468  IADNTLNVYRNTQMGTPNYMAPETLISQNYSXXXXXXXWKIGKPSDIWSYGCILYQMTYG 527
            +     +V+    +GT +Y APE L  + Y          +GKP DIW+ G +LY + + 
Sbjct: 1196 VKSGPFDVF----VGTIDYAAPEVLGGEPY----------VGKPQDIWAIGILLYTIIFK 1241

Query: 528  HPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVALIKTCLNRDPQLRATTDEI 587
              P+ +      +  I+   ++ +  +   C     +  V LIK  L R+P  R T DEI
Sbjct: 1242 ENPFYN------IDEILEAELKFN-TSTGAC-----EDCVDLIKRILTRNPTKRPTIDEI 1289

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 136/295 (46%), Gaps = 50/295 (16%)

Query: 327 LGKGGSSKVYKVQDR--TGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLI 384
           +G+G S  V+   D     +  A+KQ+ L++  +  K  +  EI ++K  +R E +V  I
Sbjct: 683 IGQGASGGVFTAHDSRDENRLVAIKQMNLQKQPK--KELIINEIIVMKG-SRHENIVNFI 739

Query: 385 E---YKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIV 441
           +    K D  +V   ME G+  L+ V+   +     I  V    KE +  +  +H   ++
Sbjct: 740 DSYLMKGDLWVVMEYMEGGS--LTDVVTHCILTEGQIGTV---CKETLGGLAFLHSKGVI 794

Query: 442 HSDLKPANFIF-VKGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSXX 500
           H D+K  N +  + G +KL DFG   +I  N +++ R T +GTP +MAPE +  + Y   
Sbjct: 795 HRDIKSDNILLSMNGDIKLTDFGFCAQI--NEVHLKRTTMVGTPYWMAPEVVSRKEY--- 849

Query: 501 XXXXXWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGK 560
                   G   DIWS G ++ +M  G PPY   L    L A+      +   N +P  K
Sbjct: 850 --------GPKVDIWSLGIMIIEMIEGEPPY---LNETPLRALY-----LIATNGTPQLK 893

Query: 561 KVPQSLVALIKT----CLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAI 611
             P++L  ++K     CL  +P+ RAT  E          ++S PF+    D  I
Sbjct: 894 D-PENLGEILKKFLDWCLTVNPEERATALE----------LLSHPFITDHADEKI 937

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,463,529
Number of extensions: 2940645
Number of successful extensions: 17196
Number of sequences better than 10.0: 2084
Number of HSP's gapped: 14853
Number of HSP's successfully gapped: 2220
Length of query: 641
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 525
Effective length of database: 40,180,143
Effective search space: 21094575075
Effective search space used: 21094575075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)