Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C035503.161ON39239220210.0
Smik_4.2063.161ON39139119410.0
YDL029W (ARP2)3.161ON39139119410.0
Suva_4.2203.161ON39139119400.0
Skud_4.2223.161ON39139119360.0
NDAI0G029003.161ON39139119330.0
TDEL0D046103.161ON39139119070.0
CAGL0K01595g3.161ON39139119010.0
Kpol_479.253.161ON39139119010.0
KLLA0C03850g3.161ON39139118900.0
SAKL0C07370g3.161ON39139118900.0
TBLA0F008703.161ON39139118780.0
TPHA0A009203.161ON39139118680.0
KLTH0F06490g3.161ON39139118550.0
KNAG0K01130na 1ON39339318520.0
ADR316W3.161ON39139118410.0
ZYRO0B04928g3.161ON39139118290.0
Ecym_52373.161ON39139118140.0
KAFR0C01040na 1ON33733716190.0
Kwal_33.141773.161ON33733716040.0
NDAI0G030408.23ON3753778521e-111
Ecym_15208.23ON3763778511e-111
NCAS0C037008.23ON3753778491e-111
TDEL0C004708.23ON3753778481e-111
CAGL0K12694g8.23ON3753778481e-111
Suva_6.188.23ON3753778481e-111
Smik_6.398.23ON3753778481e-111
YFL039C (ACT1)8.23ON3753778481e-111
KNAG0L002508.23ON3753778481e-111
KAFR0D009408.23ON3753778481e-111
TPHA0D002508.23ON3753778471e-111
TBLA0C004408.23ON3753778471e-111
ABR222W8.23ON3763778461e-110
ZYRO0F02772g8.23ON3753778451e-110
Kpol_1058.158.23ON3753778441e-110
KLTH0G18832g8.23ON3753778431e-110
KLLA0D05357g8.23ON3753778421e-110
SAKL0B00968g8.23ON3753778421e-110
Skud_6.318.23ON3603678191e-107
Kwal_14.11098.23ON3603678141e-106
AFR051W2.117ON4053777003e-88
SAKL0E11814g2.117ON3793866957e-88
Ecym_63852.117ON3773866904e-87
Kpol_1023.188.23ON3192926715e-85
KLLA0E22925g2.117ON3803906689e-84
KLTH0B05940g2.117ON3833806611e-82
NCAS0B071302.117ON3813786453e-80
ZYRO0G05676g2.117ON3813976392e-79
KAFR0F005902.117ON3863786262e-77
Kwal_33.146422.117ON3833886227e-77
TBLA0B010702.117ON3833796228e-77
TPHA0I013002.117ON3793785957e-73
Suva_15.3262.117ON3843785862e-71
YHR129C (ARP1)2.117ON3843785835e-71
Smik_8.2102.117ON3843785835e-71
Skud_8.1902.117ON3843785774e-70
NDAI0B044602.117ON3813835722e-69
TDEL0B048102.117ON3733785704e-69
KNAG0H036502.117ON3873955331e-63
CAGL0H09042g2.117ON3873804712e-54
KNAG0B001701.514ON4534394386e-49
YJR065C (ARP3)1.514ON4494354361e-48
TPHA0O010401.514ON4584444361e-48
Kwal_27.99581.514ON4454384342e-48
SAKL0D12804g1.514ON4564424333e-48
KLLA0B13904g1.514ON4564424316e-48
Suva_12.1541.514ON4494354316e-48
CAGL0F00517g1.514ON4544404308e-48
KLTH0C02508g1.514ON4514374308e-48
Smik_10.3551.514ON4494354308e-48
Skud_10.2891.514ON4494344281e-47
KAFR0D037001.514ON4494354254e-47
TBLA0D036801.514ON4584524264e-47
Kpol_1056.161.514ON4604464256e-47
NCAS0A122701.514ON4544404238e-47
AFR419C1.514ON4554414212e-46
Ecym_31531.514ON4584504202e-46
TDEL0F004701.514ON4614474203e-46
NDAI0A039701.514ON4623504091e-44
ZYRO0G01936g1.514ON4613503951e-42
KLTH0G13772g8.258ON4203792154e-18
YJL081C (ARP4)1.287ON4892982093e-17
Suva_6.1541.287ON4893032093e-17
Skud_10.1321.287ON4882912066e-17
NDAI0G055801.287ON5152992041e-16
Smik_10.1611.287ON4892982041e-16
NCAS0B060601.287ON4972932004e-16
TDEL0F038508.258ON4193661951e-15
Kwal_56.238328.258ON4193781951e-15
SAKL0H17138g8.258ON4193711942e-15
KLLA0F19063g8.258ON4153591932e-15
KAFR0B027008.258ON4203721933e-15
ZYRO0C01738g8.258ON4143621898e-15
TPHA0A018308.258ON4213681889e-15
AGR091W8.258ON4103861871e-14
AFR105C1.287ON4792951871e-14
Ecym_43128.258ON4113681852e-14
Kpol_543.368.258ON4273761818e-14
Suva_14.2812.248ON7552341821e-13
KNAG0B019201.287ON5052061801e-13
Skud_14.2722.248ON7552341766e-13
KAFR0A015601.287ON4853001712e-12
Kpol_282.41.287ON5012781702e-12
KNAG0G020108.258ON4243831683e-12
Smik_12.1448.258ON4383871683e-12
KLTH0H09702g1.287ON4811981684e-12
Smik_14.2672.248ON7552411694e-12
NCAS0B049908.258ON4203701657e-12
KLLA0D02288g1.287ON5201941651e-11
TPHA0I010301.287ON5031161641e-11
KLTH0G09482g2.248ON7452331641e-11
CAGL0M03201g1.287ON4932031632e-11
CAGL0L12166g8.258ON4213711603e-11
TBLA0D053601.287ON5962361588e-11
TDEL0D015501.287ON4802921561e-10
YNL059C (ARP5)2.248ON7552341571e-10
ZYRO0G21428g1.287ON4831981552e-10
Kwal_14.23771.287ON4811851523e-10
Skud_12.1538.258ON4381821524e-10
NDAI0B019608.258ON4392431515e-10
SAKL0D05874g1.287ON4972821491e-09
Suva_10.1698.258ON4381821481e-09
Ecym_63301.287ON4801161471e-09
YLR085C (ARP6)8.258ON4381821425e-09
KAFR0J011602.248ON7512331445e-09
NDAI0D010602.248ON7532341428e-09
KLLA0F03421g2.248ON7472291411e-08
NCAS0G030502.248ON7432341401e-08
TBLA0H014608.258ON4421881363e-08
Kwal_23.48482.248ON7452321365e-08
SAKL0E08602g2.248ON7472301356e-08
TDEL0C041402.248ON7492331348e-08
TBLA0E038602.248ON7592381322e-07
ZYRO0A01584g2.248ON7482411312e-07
TPHA0C031602.248ON7552341259e-07
CAGL0J10054g2.248ON7542321187e-06
KNAG0I018602.248ON7532291142e-05
Kpol_1003.162.248ON7492341114e-05
ADL253C2.248ON751232960.003
Ecym_32852.248ON746243900.016
Kpol_520.117.448ON488353870.037
Kpol_543.105.477ON876217850.063
SAKL0H17358g8.251ON311241810.16
NCAS0A147207.448ON485129810.20
KLLA0F11913g8.251ON25398780.29
Ecym_35058.251ON305223790.29
SAKL0G03608g5.477ON794165780.46
NDAI0A013007.448ON565202760.70
KLTH0D08624g2.593ON432234731.6
TBLA0H028002.593ON484301722.2
KLLA0F26455g2.618ON863168713.6
KAFR0K021507.448ON490115695.0
ADL356C8.864ON464197695.1
KAFR0E025305.477ON842173687.9
SAKL0D00594g8.864ON464198677.9
Suva_16.3647.448ON480132679.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03550
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   783   0.0  
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   752   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   752   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   751   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   750   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   749   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   739   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   736   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   736   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   732   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   732   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   728   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   724   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   719   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   717   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   713   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   709   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   703   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   628   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   622   0.0  
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   332   e-111
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   332   e-111
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   331   e-111
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   331   e-111
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   331   e-111
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   331   e-111
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   331   e-111
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   331   e-111
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   331   e-111
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   331   e-111
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   330   e-111
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   330   e-111
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   330   e-110
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   330   e-110
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   329   e-110
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   329   e-110
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   328   e-110
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   328   e-110
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   320   e-107
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   318   e-106
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   274   3e-88
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   272   7e-88
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   270   4e-87
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   263   5e-85
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   261   9e-84
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   259   1e-82
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   253   3e-80
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   250   2e-79
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   245   2e-77
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   244   7e-77
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   244   8e-77
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   233   7e-73
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   230   2e-71
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   229   5e-71
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   229   5e-71
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   226   4e-70
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   224   2e-69
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   224   4e-69
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   209   1e-63
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   186   2e-54
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   173   6e-49
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   172   1e-48
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   172   1e-48
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   171   2e-48
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   171   3e-48
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   170   6e-48
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   170   6e-48
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   170   8e-48
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   170   8e-48
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   170   8e-48
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   169   1e-47
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   168   4e-47
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   168   4e-47
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   168   6e-47
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   167   8e-47
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   166   2e-46
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   166   2e-46
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   166   3e-46
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    162   1e-44
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   156   1e-42
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    87   4e-18
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    85   3e-17
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    85   3e-17
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    84   6e-17
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    83   1e-16
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    83   1e-16
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    82   4e-16
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    80   1e-15
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    80   1e-15
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    79   2e-15
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    79   2e-15
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    79   3e-15
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    77   8e-15
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    77   9e-15
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    77   1e-14
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    77   1e-14
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    76   2e-14
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    74   8e-14
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    75   1e-13
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    74   1e-13
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    72   6e-13
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    70   2e-12
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    70   2e-12
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    69   3e-12
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    69   3e-12
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    69   4e-12
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    70   4e-12
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    68   7e-12
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    68   1e-11
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    68   1e-11
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    68   1e-11
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    67   2e-11
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    66   3e-11
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    65   8e-11
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    65   1e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    65   1e-10
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    64   2e-10
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    63   3e-10
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    63   4e-10
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    63   5e-10
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    62   1e-09
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    62   1e-09
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    61   1e-09
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    59   5e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    60   5e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    59   8e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    59   1e-08
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    59   1e-08
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    57   3e-08
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    57   5e-08
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    57   6e-08
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    56   8e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    55   2e-07
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    55   2e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    53   9e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    50   7e-06
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    49   2e-05
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    47   4e-05
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    42   0.003
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    39   0.016
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    38   0.037
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    37   0.063
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    36   0.16 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    36   0.20 
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    35   0.29 
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    35   0.29 
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...    35   0.46 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    34   0.70 
KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} simila...    33   1.6  
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    32   2.2  
KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} simi...    32   3.6  
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    31   5.0  
ADL356C Chr4 complement(81526..82818,82950..83051) [1395 bp, 464...    31   5.1  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    31   7.9  
SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp...    30   7.9  
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    30   9.1  

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/392 (96%), Positives = 380/392 (96%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLGHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPRQ 392
           ASIMADKDHMWLSKQEWQESGAASMVKFGPRQ
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPRQ 392

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/391 (92%), Positives = 372/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++TTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP+TSNGKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+TVQSADVD+RS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEW ESG ASM KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/391 (92%), Positives = 372/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++ TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP+TSNGKILLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+TVQSADVD+RS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEWQESG ++M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/391 (92%), Positives = 373/391 (95%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++TTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKL +TSNGKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+TVQSADVD+RS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEWQESG A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/391 (91%), Positives = 371/391 (94%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++ TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP+TSNGKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+TVQSADVD+RS+LY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEWQESG A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/391 (92%), Positives = 369/391 (94%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPL+DIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFF QMKL  TS GKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+T+QSADVDVRSALYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TRVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEW E GAA+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/391 (89%), Positives = 370/391 (94%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERAN++TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFF+QMKLPTTSNGKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEK+CYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQ G+GELLF+T+Q+ADVD+RSALY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL ND +RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWLSKQEWQESG A+M KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 367/391 (93%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA I  PLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFF QM+LPTTS GKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQ G+GELLF+T+QSADVDVRS+LYKAI
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPTRLDKFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWL+KQEW+ESGAA+M KFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/391 (90%), Positives = 367/391 (93%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+I+TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           SEVRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLP+TS GK+LLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT+LARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E YELPDGR IKVGQERFEAPECLFQP LVDVE  G+GELLF+T+QSADVDVRS+LYKAI
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL  DP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWLSKQEWQESG A+M KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER + +TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           SEVRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLPTTS GK+LLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GELLF+T+Q+ADVD+R++LYKAI
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWLSKQEW E G A+M KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/391 (88%), Positives = 369/391 (94%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+ITTPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLP+TS GK+LLTEPPMNP +NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+TVQ+ADVDVR+ALY+A+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWL+KQEWQE G A+M KFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/391 (88%), Positives = 365/391 (93%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER  I+TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           SEVRSYLQISYPMENGIIKNWTDMELLWDYAFF QMKLPTTS GK+LLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFE+YDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGY+FNRTADFETVRQIKEK+CYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           + YELPDGR IKVGQERFEAPECLFQP LVDVE PG+GELLF+T+QSAD+DVRS+LYKAI
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLE+ELKQLWFTR+L+ D  RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWLSKQEWQE+GAA++ KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/391 (87%), Positives = 362/391 (92%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER N+  PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLP+TS GK+LLTEPP+NP KNRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  G+GELLF+T+QSAD+DVRS+LYKAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW+TRVL NDP RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADKDHMWLSKQEW ESG A+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 365/391 (93%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MD  +PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAN+ TPLKDIMIGDEA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLP+TS GK++LTEPPMNP +NRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETTTLV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+T+Q+ADVDVRSALY+AI
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP+RL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWLSKQEWQE G ++M KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/393 (87%), Positives = 367/393 (93%), Gaps = 2/393 (0%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA--NITTPLKDIMIGD 58
           MDPHSPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER+  +  TP+KDIM+G+
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKN 118
           EAS+VRSYLQISYPMENGIIK+WTDMELLWD+AFFE+MKLP+TS GKILLTEPPMNP KN
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLT 178
           RE MC+VMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTT 238
           RRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLD DTKLARETTT
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYK 298
           LVE+YELPDGR IKVGQERFEAPECLFQP LVDVEQPG+GELLF+T+QSADVD+RS+LYK
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           VLA+IMADKDHMWLSKQEW+ESGA +M KFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/391 (86%), Positives = 363/391 (92%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDP  PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA+ERAN++TPLKDIMIGDEA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGII++W DMELLWDYAF+EQMKLP+TS GK+LLTEPPMNP +NRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYV IQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRD+TR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDT+LA+ETTTLV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+T+QSADVD+ S LYKAI
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDPTRL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMADK+HMWL+KQEW+ESG ASM KFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/391 (86%), Positives = 360/391 (92%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER +I+TPLKDIMIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S+VRSYLQISYPMENGII+NW DME LWDYAF+ QMK P+TS GKILLTEPPMNP KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
            MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQPG+GELLF+T+QSADVD+RS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW+TR+LR D  RLDKFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           ASIMA+KDHMWL+K+EW ESG A+M KFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/391 (85%), Positives = 358/391 (91%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           MDP+ PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA ER+NI+TPLKDIMIGDEA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
           S VRSYLQISYPMENGIIKNW DME LWDYAF++QMK+P+T+  K+LLTEPPMNP KNRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240
           LDVAGRDVTR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDTKLA ETTTLV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQ G+GE+LF T+QSADVD+ SALY+AI
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFTRVL+NDP RLDKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           A+IMADKDHMWL+K+EW+E G A+M KFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/337 (89%), Positives = 313/337 (92%)

Query: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMN 114
           MIG EASEVRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLP TSNGKILLTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P KNREKMCEVMFEKY+FGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 GHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
            HLTRRLDVAGRDVTR+LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRS 294
           ETTTLVESYELPDGR IKVG ERFEAPECLFQP LVDVEQ G+GELLF+T+QSADVD+RS
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354
            L+KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDPTRLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEW+ESG A+M KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/337 (87%), Positives = 314/337 (93%)

Query: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMN 114
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LP+TS GK++LTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 GHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
            HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRS 294
           ETTTLVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LF+T+QSADVDVRS
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVF 354
           ALY+AIVLSGGSSMYPGLPSRLEKELKQLWFTRVL NDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWQESGAASMVKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEWQE G+A+M KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  332 bits (852), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           GS+M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GSTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  332 bits (851), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 163/377 (43%), Positives = 241/377 (63%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDCYVGDEAQSKR 63

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 122

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 123 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 182

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D D + + A +++ + +SYE
Sbjct: 183 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYE 242

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 243 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 302

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 303 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 351

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 352 TFQ-QMWISKQEYDESG 367

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  331 bits (848), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   D+DVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ ++   V+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  330 bits (846), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 241/377 (63%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 63

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 64  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 122

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 123 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 182

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYE
Sbjct: 183 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 242

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 243 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 302

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 303 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 351

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 352 TFQ-QMWISKQEYDESG 367

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  330 bits (845), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 242/377 (64%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  329 bits (843), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 162/377 (42%), Positives = 241/377 (63%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYE
Sbjct: 182 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P L+ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/377 (42%), Positives = 241/377 (63%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKNNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +L+ RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYE
Sbjct: 182 GRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 161/377 (42%), Positives = 241/377 (63%), Gaps = 16/377 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           ++FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+A
Sbjct: 122 ILFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYE
Sbjct: 182 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SG
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSG 301

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           G++M+PG+  R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+ 
Sbjct: 302 GTTMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLT 350

Query: 365 ADKDHMWLSKQEWQESG 381
             +  MW+SKQE+ ESG
Sbjct: 351 TFQ-QMWISKQEYDESG 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  320 bits (819), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 234/367 (63%), Gaps = 16/367 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++MFE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIMFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELPDG+ I +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 236

Query: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314
            ERF APE LF P ++ +E  G+ +  ++++   DVDVR  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWQESG 381
           QE+ ESG
Sbjct: 345 QEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  318 bits (814), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 233/367 (63%), Gaps = 16/367 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +++FE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQILFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++ + +SYELPDG+ I +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIG 236

Query: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314
            ERF APE LF P L+ +E  G+ +  ++++   DVDVR  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         P+ +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWQESG 381
           QE+ ESG
Sbjct: 345 QEYDESG 351

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  274 bits (700), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 222/377 (58%), Gaps = 17/377 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G           +     D  IG++A E+
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEG---DTFIGNQAQEL 91

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+++GI+ NW DME +W Y F + ++L    +   L+TE P+NP KNREKMC
Sbjct: 92  RGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMC 151

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE ++   +YV++QAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 152 ELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDI 211

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK C+V+ D  L+ +      +    
Sbjct: 212 AGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SK 270

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVL 302
           ++LPDG+TI++GQER+ APE LFQP L+  E   + ++ + ++   D+D+RS LY  I+L
Sbjct: 271 FKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILL 330

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG+SM PG   RL KELK L  +R            K++I  PP RK+  +IGG++L+ 
Sbjct: 331 SGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSG 379

Query: 363 IMADKDHMWLSKQEWQE 379
           +   K  +W++K EW+E
Sbjct: 380 LSTFKK-LWVTKSEWEE 395

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  272 bits (695), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 149/386 (38%), Positives = 223/386 (57%), Gaps = 17/386 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G +GE  P     S++G P         +     +  IG++A E+
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQEL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+E+GI+KNW+DMEL+W++ F + ++L       +L TE P+NP KNRE MC
Sbjct: 66  RGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMC 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE ++   VYV+IQAVL+LYA G              H VPV++   L    RR+DV
Sbjct: 126 EMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDV 185

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRDVT  L  LL +  G +   +++ E VR IKEK CYV+ D  L  +     T     
Sbjct: 186 AGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQTYHLTPTSTI 244

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVL 302
           ++LPDG+ + +  E+F APE LFQP L+  E   + E+   ++   D+D+R AL   IVL
Sbjct: 245 FKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVL 304

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  +IGG++L+ 
Sbjct: 305 SGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSILSG 353

Query: 363 IMADKDHMWLSKQEWQESGAASMVKF 388
           +   K  +W++K EWQE+      +F
Sbjct: 354 LSTFKK-IWVTKSEWQENPDCVHSRF 378

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  270 bits (690), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 141/386 (36%), Positives = 226/386 (58%), Gaps = 17/386 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G +GE  P     S++G           +     D  IG++A E+
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEG---DTFIGNQAQEL 63

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +P+E+GI+KNW+DME +W Y F + ++L    +  IL+TE P+NP  NRE+MC
Sbjct: 64  RGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMC 123

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE ++   +YV+IQAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 124 ELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDI 183

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK CYV+ D  ++ +         + 
Sbjct: 184 AGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIEEQNFSINPNYTK- 242

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVL 302
           ++LPDG+TI +GQE+F APE LFQP L+  E   + ++ + +++  D+D+RS L+  ++L
Sbjct: 243 FKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLL 302

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG+S+ PG   RL  ELK L  ++            K++I  PP RK+  +IGG++L+ 
Sbjct: 303 SGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSILSG 351

Query: 363 IMADKDHMWLSKQEWQESGAASMVKF 388
           +   K  +W+++ EW+E+      +F
Sbjct: 352 LSTFK-KLWVTRAEWEEAADCIHSRF 376

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  263 bits (671), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 186/292 (63%), Gaps = 4/292 (1%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           + +V+D G+G  K G AG++ P   FPSIVGRP     +   +    KD  +GDEA   R
Sbjct: 6   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCE 124
             L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +
Sbjct: 63  GILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQ 121

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVA 184
           +MFE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+A
Sbjct: 122 IMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLA 181

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYE 244
           GRD+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYE
Sbjct: 182 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYE 241

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSAL 296
           LPDG+ I +G ERF APE LF P ++ +E  G+ +  ++++   DVDVR  L
Sbjct: 242 LPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  261 bits (668), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 141/390 (36%), Positives = 229/390 (58%), Gaps = 25/390 (6%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIVLD G+G +K G  GE+ P     S+VG P               +  +G++A E+
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDG---NTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +P+E+G++ +W  +E LW + F + ++L +  +  +L+TE P+NP KNRE+MC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE +    VYV+IQAVL+LYA G             +H VPVY+   L    RR+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL-- 239
           AGRD++  L+ +L R+  G +   +++ E VR IKEK CY++    LD K   +  T+  
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIA----LDPKEEEKNYTMHG 241

Query: 240 -VESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYK 298
               + LPDG+ I++  E+F APE LF P L+  E   + E+L++++Q  D+D+R++L+ 
Sbjct: 242 KQTMFRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
            IV SGG++M PG   R+ KELK       L  +P    + K++I  PP RK+  +IGG+
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGGS 350

Query: 359 VLASIMADKDHMWLSKQEWQESGAASMVKF 388
           +L+ +   K  +W++K+EW+E+      +F
Sbjct: 351 ILSGLSTFKK-IWVTKKEWEENPRCVHARF 379

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  259 bits (661), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 139/380 (36%), Positives = 221/380 (58%), Gaps = 17/380 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G P         + +  +  +IG+EA ++
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQ--LIGNEAQKM 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+E+G++++W  +E LW + F+  +KL       +L+TE P+NP KNR KMC
Sbjct: 67  RGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE +    VYV+IQAVLALYA G                VPVY+   L    +R+DV
Sbjct: 127 EMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDV 186

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKL--ARETTTLV 240
           AGRD+T  L  LL +  G   + +++ E VR IKEK C+V+ D+  + +      +  L 
Sbjct: 187 AGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELE 246

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
             ++LPDG+ + +G E+F APE LFQP L+  E   + E+   ++   D+D+RS+LY +I
Sbjct: 247 TRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+M+ G   RL  E+++           T     K++I  PP RK+  +IGG++L
Sbjct: 307 VLSGGSTMFSGFGDRLLSEIRK-----------TSEPNTKIKIFAPPERKYSTWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWQES 380
           A  ++  + +W+++ EWQE+
Sbjct: 356 AG-LSTFEKLWVTRAEWQEN 374

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  253 bits (645), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 132/378 (34%), Positives = 210/378 (55%), Gaps = 14/378 (3%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+VLD G+  +K G +G+N P     +++G P        N  +      IG+ A + 
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKS 67

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +PM  GI++NW DME LW + F + +K+       +L+TE P+NP KNR+KMC
Sbjct: 68  RGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRDKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           EV FEK+DF  VY+A  + L+LYA G                VP+YE   L    RR+DV
Sbjct: 128 EVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRRIDV 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
            GRDVT  L   +    G +   +++ E V+ +KEK CYVS D   D  ++      +  
Sbjct: 188 GGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRC 247

Query: 243 -YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
            ++LPDG+ + + + RF APE LF+P ++ +E   + ++ F+++   D+++R  L+ +I+
Sbjct: 248 QFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSII 307

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GGS+M+ G   RL KEL+       +R     L    ++I  PP RK+  +IGG++L 
Sbjct: 308 LNGGSTMFRGFGDRLLKELQ-------IRTGNKNL----IKIIAPPERKYTSWIGGSILT 356

Query: 362 SIMADKDHMWLSKQEWQE 379
            +   K  +W++K EWQE
Sbjct: 357 GLSTFK-QLWMTKAEWQE 373

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  250 bits (639), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 140/397 (35%), Positives = 225/397 (56%), Gaps = 25/397 (6%)

Query: 1   MDPHS-----PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKD-I 54
           +DP++     P+VLD G+  +K G +GE+ P +   SIVG P         +    KD  
Sbjct: 2   LDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP-----RHGYVNDSSKDDT 56

Query: 55  MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMN 114
            +G+ A E RS LQ+ +P+++G++KNW DMEL+WDY F +++KL       +L+TE P+N
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P  NR++MC+++FE +    +YVA  AVL+LYA G             +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 175 GHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKL 232
               +R+D+ GRD+T  L + L    G +   + + E VR IKEK CYV+ DLD+ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 233 ARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDV 292
             E   +   ++LPDG+ I + ++RF+ PE LFQP ++  E   + E+++ +V   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 293 RSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHM 352
           R  ++  I+LSGG++M  G  +RL +EL +L              + +V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYT 345

Query: 353 VFIGGAVLASIMADKDHMWLSKQEWQESGAASMVKFG 389
            +IGG++LA  ++    + ++K +WQE  +    K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  245 bits (626), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 208/378 (55%), Gaps = 16/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIV+D GT  +K G  GE  P     SIVG P      ++N      D  IG++A + 
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIE--SDSFIGNKAQKY 69

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +PM  G+++NW DME +W Y F + + L   +   IL+TEPP+N   NR+KMC
Sbjct: 70  RGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMC 129

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E +FE + F  VY+++  VL+LYA G                +PVY    L    +++D+
Sbjct: 130 EALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDI 189

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +L   G     +++ E VR IKEK+CY++ D +L+T K       +  
Sbjct: 190 GGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMAS 249

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
            ++LPDG+ + + Q ++ + E LF+P L+  E   + E+ + +++  D D+R  LY  IV
Sbjct: 250 QFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M PG  SRL KEL+ L          T  D  K+RI  PP RK+  +IGG++L+
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYTSWIGGSILS 358

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    +W++K  W+E
Sbjct: 359 G-LSTFSKIWVTKSMWEE 375

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  244 bits (622), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 139/388 (35%), Positives = 230/388 (59%), Gaps = 17/388 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+VLD G+G +K G +GE  P     S++G P         +++  +  ++G+EA + 
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQ 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+E+GI+++W+ +E LW + F+  +KL    +  +L+TE P+NP +NR+KMC
Sbjct: 67  RGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E+++E ++   VYV+IQAVLALYA G                VPVY+   +    RR+DV
Sbjct: 127 EMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDV 186

Query: 184 AGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTK--LARETTTLV 240
           AGRDVT  L  LL +  G     +++ E VR IKEK CYV+ ++  + +   +   +  +
Sbjct: 187 AGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEEL 246

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
             ++LPDG+ + +G E+F APE LFQP L+  E   + ++ F ++   D+D+RS+LY ++
Sbjct: 247 TKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSL 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+++ G   RL  EL+        R +P      K++I  PP RK+ V+IGG++L
Sbjct: 307 VLSGGSTLFAGFGDRLLNELRS-------RCEPN----VKIKIFAPPERKYSVWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWQESGAASMVKF 388
           A  ++  + +W+++ EWQE+      +F
Sbjct: 356 AG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  244 bits (622), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 134/379 (35%), Positives = 210/379 (55%), Gaps = 21/379 (5%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIVLD G+  +K G  G++ P     S++G P     ++  +    K   +G+ A E 
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTP---KYDKVMVGGVEKGKFVGNLAQEY 67

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YPM++GII+NW  ME +WD+ F + +K+       +++TE P+NP  NREKMC
Sbjct: 68  RGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E +FE ++   +Y+A  AVL+LYA G                VP+YE   L    RR+D+
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDI 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK---LARETTTL 239
            GRD+T+HL + L    G     +++ E VR IKE  CY+  +   + +   L +E  ++
Sbjct: 188 GGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI 247

Query: 240 VESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKA 299
             S++LPDG+ + +G  RF APE LF P L+  E   + +++  ++   D+D+RS L   
Sbjct: 248 --SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I LSGGS+M+ G   RL  EL           D +     KVRI  PP RK+  FIGG++
Sbjct: 306 ITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSI 354

Query: 360 LASIMADKDHMWLSKQEWQ 378
           LA++   ++ MW++K +W+
Sbjct: 355 LANLSTFRN-MWVTKDQWE 372

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  233 bits (595), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 211/378 (55%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+V+D GTG +K+G  G++ P     +IVG P     ++  I     ++ IG++A E 
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKF---DKVMIGGLDDNMYIGNKAQEN 64

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +PME+G +K+W +ME +W +     + +       IL+TE P+N +KNRE MC
Sbjct: 65  RGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHMC 124

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           E++FE ++   ++V   AVLALY+ G                VP+YE   L    RR+D+
Sbjct: 125 EILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDI 184

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            GR++T  L   +    G +   + + E VR IKE+ CYV+ D+  +  K   ++ +   
Sbjct: 185 GGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNSS 244

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
            ++LPDG+++ +G  RF A E LF P L+  E   + E++F T+   D+D+R  LYK++V
Sbjct: 245 KFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLV 304

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GG+++ PG  +R+ KEL+ L          T+ D  K+RI   P RK+  +IGG++LA
Sbjct: 305 LNGGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTTWIGGSILA 353

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    + ++K  W E
Sbjct: 354 G-LSTFQKILVTKSNWNE 370

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  230 bits (586), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 207/378 (54%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHA---KYDKVMLEGLQGDTFVGNKAQRL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+E+G++++W  MEL+W +   E ++L       +L+TE PMNP KNRE M 
Sbjct: 69  RGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           +V+FE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            GRD+T+ L   L    G +   +++ E VR IKEK+CY++ D+   +    +E+  L  
Sbjct: 189 GGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   ++   D+D+R+ L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+   FT+            K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  229 bits (583), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 204/378 (53%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+V+D G+G +K G +GE  P      +VG       ++  +     D  IG+ A ++
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YP+++G++++W  MEL+W Y   E ++L       +L+TE PMNP KNRE+M 
Sbjct: 69  RGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           +V+FE +D   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTTLVE 241
            G D+T  L   L    G +   +++ E VR +KEK+CY++ ++   + K  + T  L+ 
Sbjct: 189 GGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLIS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
           +++LPDGR I+VG +R+ APE LF P ++ +   G+ ++   ++   D+D+R  L  +I+
Sbjct: 249 TFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+      LW    L    +     K++I  P  RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  229 bits (583), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 204/378 (53%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A ++
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YPM++G++++W  MEL+W Y   E ++L       +L+TE PMNP KNRE + 
Sbjct: 69  RGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           +VMFE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            G D+T  L   +    G +   +++ E VR IKEK+CY++ D   +  K  + T  L+ 
Sbjct: 189 GGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLIS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
           +++LPDG++I+VG +R+ APE LF P ++     G+  +   ++   D+D+R  L  +++
Sbjct: 249 AFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVI 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRMLHDLEAL-----------TKGTSKIKIIAPPERKYTAWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  226 bits (577), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 203/378 (53%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + PIV+D G+G +K+G +GE  P     S+VG       E+  +     D  +G++A ++
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ YPM +G++++W  MEL+W Y   E ++L       +L+TE PMNP KNRE M 
Sbjct: 69  RGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           +V+FE ++   +Y++  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTTLVE 241
            GRD+T  L   L    G +   +++ E VR IKEK+CY++ ++  +  +  +    L  
Sbjct: 189 GGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   ++   D+D+R  L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWQE 379
             ++    +W  K +W E
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  224 bits (572), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 121/383 (31%), Positives = 208/383 (54%), Gaps = 19/383 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDI--MIGDEAS 61
           + PIV+D G+  +K G + ++ P     ++ G P     ++  IT  L+++   IG+ A 
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMP---KYDKIMITGQLENLDKYIGNRAQ 65

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
            +R  L++ +PM  G++ NW DMELLW + F + + +       +L+TE P+   K R  
Sbjct: 66  SIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
           MCE +FE ++   +YVA  +VL+LYA G                 P+YE  VL    R++
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKM 185

Query: 182 DVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD-LDTKLARETTTL 239
           +V GRD+T HL   +    G +   + + E VR IKEK+CY+S D +  +         +
Sbjct: 186 EVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFNKSEESYYLRQDEM 245

Query: 240 VESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKA 299
              ++LPDG+ + + +ERF +PE LF P L+ +E   +  + F+++   D+++R  L+  
Sbjct: 246 SCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I+L+GGS+++ G  SRL  +L++L   R            K++I  PP RK+  +IGG++
Sbjct: 306 ILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWIGGSI 354

Query: 360 LASIMADKDHMWLSKQEWQESGA 382
           L  +   K+ +W++K +W+ES  
Sbjct: 355 LTGLSTFKN-LWVTKSDWEESSG 376

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  224 bits (570), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 198/378 (52%), Gaps = 17/378 (4%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P+V+D G+  VK G  GE  P     S++G           +     D  +G++A  +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLEC---DSFVGNKAQRL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R  L++ +PME G++ +W DMELLW +  F+ ++L +     +L+TE P+NP  N+EKM 
Sbjct: 66  RGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKML 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           EV FE ++   + V+I  VL+LYA G                VPV E   L    +R+++
Sbjct: 126 EVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINL 185

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD-LDLDTKLARETTTLVE 241
            G DVT+ L   L    G     + + E VR +KEK CYVS + L  + K   E   +  
Sbjct: 186 GGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNT 245

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIV 301
           +++LPDG  + + + RF APE LFQP ++  E+P + E+   ++ S DV++R  L   I 
Sbjct: 246 NFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRIT 305

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M+ G   R  +EL+            +   K  +RI  PP RK+  +IGG++LA
Sbjct: 306 LSGGTTMFRGFGDRFLQELQI-----------STCKKSNIRILAPPERKYTAWIGGSMLA 354

Query: 362 SIMADKDHMWLSKQEWQE 379
            +   +  M  +K +W+E
Sbjct: 355 GLTTFR-KMLTTKSDWRE 371

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  209 bits (533), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/395 (31%), Positives = 212/395 (53%), Gaps = 29/395 (7%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKD-IMIGDEASE 62
           + P+VLD G+  +K G +G+  P     ++ G+P      +  +TT L+D   +G+EA  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKP----RYKKVMTTGLEDRTFVGNEAQR 66

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKL----PTTSNGKILLTEPPMNPTKN 118
           +R  L +  P+  G + NW DMELLW + F+ +++L        +  +L+TE P+N TKN
Sbjct: 67  LRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKN 126

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLT 178
           RE MCE+++E ++F  +YVA  AVL+LYA G             +   PVY+   L    
Sbjct: 127 RETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSSI 186

Query: 179 RRLDVAGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTK----LA 233
           RR+D+ GRD+T+ L   + +  G +    ++ E VR IKEK  YV+ D   + +      
Sbjct: 187 RRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIHE 246

Query: 234 RETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVR 293
           RE T+ V+   LPDG+ +  G+ ++   E LFQP L+  E   + E+L +++   D+D+R
Sbjct: 247 RENTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLR 303

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
           + L + IVLSGG++M  G   R   E K++                KV+I     R ++ 
Sbjct: 304 TQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHT-----------KVKIRSLAERSYIA 352

Query: 354 FIGGAVLASIMADKDHMWLSKQEWQESGAASMVKF 388
           +IGG++L+ +   ++ +WL+++ ++E  +    KF
Sbjct: 353 WIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  186 bits (471), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 187/380 (49%), Gaps = 20/380 (5%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
           + P++LD G+  +K G AG   PD    + +G P+    ER+ +T   K+  IG+ A E 
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYER 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           R+ L +  P     I +W  +E LWDY    ++++       ++LT       K  EKMC
Sbjct: 67  RATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           EV+FEK+    +Y +   +++LY  G               I  V + +++G  ++  + 
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNT 186

Query: 184 AGRDVTRHLIDLLSRRGYAF-NRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVES 242
            G  VT  ++DLL        N     E +R IKE+ C +S D   + +     T+   +
Sbjct: 187 GGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTSN 246

Query: 243 --YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300
             Y LPDG  I++G ERFEAPE +F P      +  + +++ +++  A +  RS L ++I
Sbjct: 247 NKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLD-KFKVRIEDPPRRKHMVFIGGAV 359
           VLSGGSS+  G   RL KE+++             +D   K+ +  P  R+ + +IGG+V
Sbjct: 307 VLSGGSSLIKGFGERLTKEIRK------------EIDGNQKIMLNAPHERRFLPWIGGSV 354

Query: 360 LASIMADKDHMWLSKQEWQE 379
           L+ +   K  +W SK  ++E
Sbjct: 355 LSGLSTMK-LLWKSKSAYRE 373

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  173 bits (438), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 130/439 (29%), Positives = 211/439 (48%), Gaps = 71/439 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANIT-------------- 48
           +V+D GTG  K+G AG + P + FP+ +    G      + +A  T              
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNPYFGN 68

Query: 49  -------------------------TPLKDIMIGDEA---SEVRSYLQISYPMENGIIKN 80
                                    T   D  IG+EA   S+  SY  +SYP+ +G ++N
Sbjct: 69  STSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASY-SLSYPIRHGQVEN 127

Query: 81  WTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 128 WDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAVQ 186

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+G   + + +AGRD+T+ +
Sbjct: 187 AVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFI 246

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D    +    +VE+ E   
Sbjct: 247 QTLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQ 303

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGG 305
            + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGG
Sbjct: 304 KKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGG 362

Query: 306 SSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL+++LK +   R+ +N+    T+     V +    ++++ V+ GG++LA 
Sbjct: 363 STMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 422

Query: 363 IMADKDHMWLSKQEWQESG 381
               K +   +K++++E G
Sbjct: 423 TAEFKSYCH-TKKDYEEYG 440

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/435 (30%), Positives = 213/435 (48%), Gaps = 67/435 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP--------------SIVGRPILRAEERA---NITT 49
           +V+D GTG  K+G AG + P + FP              S VG P   + E +   N T+
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTS 68

Query: 50  PLK----------------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDM 84
                                    D  IG+EA   S+  SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+G   + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQESG 381
           K +   +K++++E G
Sbjct: 423 KGYCH-TKKDYEEYG 436

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  172 bits (436), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 214/444 (48%), Gaps = 76/444 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGR------------PILRAEERANITTPLK-- 52
           IV+D GTG  K+G AG + P + FP+ +              P      +A ++ P    
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNPATSN 68

Query: 53  ----------------------------------DIMIGDEA---SEVRSYLQISYPMEN 75
                                             D  IG+EA   S+  +Y  +SYP+ +
Sbjct: 69  PYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAY-SLSYPIRH 127

Query: 76  GIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGV 135
           G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+
Sbjct: 128 GQVENWDHMERFWENSIFKYLRAEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGL 186

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+G   + + +AGRD
Sbjct: 187 YIAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRD 246

Query: 188 VTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVES 242
           +T  +  LL  RG A    +  +T  +IK++ CYV  D+       D +  +    ++E+
Sbjct: 247 ITLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN 303

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAI 300
            +    + I +G ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  I
Sbjct: 304 QDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNI 362

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL++++K +   R+ +N+    T+     V++    ++++ V+ GG
Sbjct: 363 VLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGG 422

Query: 358 AVLASIMADKDHMWLSKQEWQESG 381
           ++LA     K +   +K++++E G
Sbjct: 423 SLLAQTAEFKGYCH-TKKDYEEHG 445

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  171 bits (434), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 132/438 (30%), Positives = 211/438 (48%), Gaps = 63/438 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEERANIT---------------- 48
           IV+D GTG  K+G AG + P + FP+ +   +P    ++  +                  
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQGVGS 68

Query: 49  -----------------TPLKDIMIGDEA---SEVRSYLQISYPMENGIIKNWTDMELLW 88
                            T   D  IGDEA   S+  SY  +SYP+ +G ++NW  ME  W
Sbjct: 69  SSLSAALLSNNLAGKRGTEDLDFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHMERFW 127

Query: 89  DYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQ 148
           + + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL A 
Sbjct: 128 ENSIFKYLRTEPEDH-YFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAAS 186

Query: 149 GLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRG 200
                                 TH++PV E  V+G   + + +AGRD+T  +  LL  RG
Sbjct: 187 WTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG 246

Query: 201 YAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTIKVGQ 255
                     T  +IK++ CYV  D+       D    +    +VE+ E    + I VG 
Sbjct: 247 ---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVIDVGY 303

Query: 256 ERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLP 313
           ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+    
Sbjct: 304 ERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 362

Query: 314 SRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHM 370
            RL+++LK +   R+  ++    T+     V++    R+++ V+ GG++LA     + + 
Sbjct: 363 RRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFRGYC 422

Query: 371 WLSKQEWQESGAASMVKF 388
             SKQ+++E G   +  F
Sbjct: 423 H-SKQDYEEIGPEIVRNF 439

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  171 bits (433), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 130/442 (29%), Positives = 207/442 (46%), Gaps = 74/442 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV----------------------------GRPI 38
           +V+D GTG  K+G AG + P + FP+ +                            G P 
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSAGNPY 68

Query: 39  LRAEERANITTPLK------------------DIMIGDEA---SEVRSYLQISYPMENGI 77
                 A     L                   D  IG+EA   S   SY  +SYP+ +G 
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSY-SLSYPIRHGQ 127

Query: 78  IKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+G   + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYE 244
             +  LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E
Sbjct: 247 LFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSE 303

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVL 302
               + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVL
Sbjct: 304 STKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    T+     V++    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSL 422

Query: 360 LASIMADKDHMWLSKQEWQESG 381
           LA     K +   +KQ+++E G
Sbjct: 423 LAQTAEFKSYCH-TKQDYEEYG 443

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 213/442 (48%), Gaps = 74/442 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPIL-RAEERANITTPLK------------- 52
           +V+D GTG  K+G AG + P + FP+ +      +++  +N +T                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSSYLSG 68

Query: 53  --------------------------------DIMIGDEA---SEVRSYLQISYPMENGI 77
                                           D  IG+EA   S+  SY  +SYP+ +G 
Sbjct: 69  GGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQ 127

Query: 78  IKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYV 137
           ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NR+++ E+ FE ++  G+Y+
Sbjct: 128 VENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENRQQVAEIFFESFNCAGLYI 186

Query: 138 AIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVT 189
           A+QAVLAL A                       TH++PV E  V+G   + + +AGRD+T
Sbjct: 187 AVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDIT 246

Query: 190 RHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYE 244
             +  LL  RG    + A   T  +IK++ CYV  D+       D    +    +VE+ E
Sbjct: 247 LFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIVENKE 303

Query: 245 LPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVL 302
               + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +DVR  LY  IVL
Sbjct: 304 RTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVL 362

Query: 303 SGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAV 359
           SGGS+M+     RL+++LK +   R+ +++    TR     V +    R+++ V+ GG++
Sbjct: 363 SGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSL 422

Query: 360 LASIMADKDHMWLSKQEWQESG 381
           LA     K +   +KQ+++E G
Sbjct: 423 LAQTGEFKSYCH-TKQDYEEYG 443

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 127/435 (29%), Positives = 211/435 (48%), Gaps = 67/435 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----------------NITT 49
           +V+D GTG  K+G AG + P + FP+ +        ++A                 N T+
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFGNSTS 68

Query: 50  PLK----------------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDM 84
                                    D  IG+EA   S+  SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+G   + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAV 303

Query: 252 KVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQESG 381
           K +   +K++++E G
Sbjct: 423 KGYCH-TKKDYEEYG 436

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 123/440 (27%), Positives = 212/440 (48%), Gaps = 72/440 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLK-------------- 52
           +V+D GTG  K+G AG + P + FP+ +        +++ +                   
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSGYFGN 68

Query: 53  ------------------------------DIMIGDEA---SEVRSYLQISYPMENGIIK 79
                                         D  IG+EA   ++ +SY  +SYP+ +G ++
Sbjct: 69  STSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRHGQVE 127

Query: 80  NWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+G   + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELP 246
           +  LL  RG    +    +T  +IK++ CYV  D+       D   ++    +VES E  
Sbjct: 247 IQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQEKT 303

Query: 247 DGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
             + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +DVR  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL++++K +   R+ +++    T+     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLA 422

Query: 362 SIMADKDHMWLSKQEWQESG 381
                K +   +K+++ E G
Sbjct: 423 QTAEFKSYCH-TKKDYDEYG 441

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 131/437 (29%), Positives = 206/437 (47%), Gaps = 69/437 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG-----------------------RPILRAEE 43
           IV+D GTG  K+G AG + P + FP+ +                         P      
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYFGNST 68

Query: 44  RANITTPLK------------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWT 82
            A     L                   D  IG+EA   S+  SY  +SYP+ +G ++NW 
Sbjct: 69  SATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQVENWD 127

Query: 83  DMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAV 142
            ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAV
Sbjct: 128 HMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAV 186

Query: 143 LALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLID 194
           LAL A                       TH++PV E  V+G   + + +AGRD+T  +  
Sbjct: 187 LALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQS 246

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGR 249
           LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E    +
Sbjct: 247 LLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRK 303

Query: 250 TIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSS 307
            I VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+
Sbjct: 304 VIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGST 362

Query: 308 MYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFIGGAVLASIM 364
           M+     RL+++LK +   R+  ++    T+     V++    R+++ V+ GG++LA   
Sbjct: 363 MFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQTA 422

Query: 365 ADKDHMWLSKQEWQESG 381
             K +   +KQ+++E G
Sbjct: 423 EFKSYCH-TKQDYEEIG 438

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 127/435 (29%), Positives = 211/435 (48%), Gaps = 67/435 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----------------NITT 49
           +V+D GTG  K+G AG + P + FP+ +        ++A                 N T+
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFGNSTS 68

Query: 50  PLK----------------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDM 84
                                    D  IG+EA   S+  SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+G   + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309
            +G ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
                RL+++LK +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQESG 381
           K +   +K++++E G
Sbjct: 423 KGYCH-TKKDYEEYG 436

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  169 bits (428), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/434 (28%), Positives = 211/434 (48%), Gaps = 65/434 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----------------NITT 49
           +V+D GTG  K+G AG + P + FP+ +        +++                 N T+
Sbjct: 9   VVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFGNATS 68

Query: 50  PLK----------------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDM 84
                                    D  IG+EA   S+  SY  +SYP+ +G ++NW  M
Sbjct: 69  ATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+G   + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTI 251
             RG A        T  +IK++ CYV  D+       D   ++    +VE+ E    + +
Sbjct: 247 RERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVV 303

Query: 252 KVGQERFEAPECLFQPGLVDVEQPGMGELLFD-TVQSADVDVRSALYKAIVLSGGSSMYP 310
            +G ERF APE  F P +   +      ++ D T+Q+  +DVR  LY  IVLSGGS+M+ 
Sbjct: 304 DIGYERFLAPEIFFNPEIASSDFLTPLPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 363

Query: 311 GLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               RL+++LK +  +R+ +++    T+     V +    ++++ V+ GG++LA     K
Sbjct: 364 DFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFK 423

Query: 368 DHMWLSKQEWQESG 381
            +   +K++++E G
Sbjct: 424 GYCH-TKKDYEEYG 436

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  168 bits (425), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 127/435 (29%), Positives = 208/435 (47%), Gaps = 67/435 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG---------------------------RPIL 39
           IV+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   IVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQNHTKKTSSMSSTSNTTSSNQYFGNSTSA 68

Query: 40  RAEERANITTPLK------------DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDM 84
            +    N + PL             D  IG+EA   ++  SY  +SYP+ +G I+NW  M
Sbjct: 69  TSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQIENWDHM 127

Query: 85  ELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLA 144
           E  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLA
Sbjct: 128 ERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLA 186

Query: 145 LYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLL 196
           L A                       TH++PV E  V+G   + + +AGRD+T  +  LL
Sbjct: 187 LAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL 246

Query: 197 SRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELPDGRTI 251
             RG          T  +IK++ CYV  D+       D    +    +VE+ E    + +
Sbjct: 247 RERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIV 303

Query: 252 KVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309
            VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+
Sbjct: 304 DVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 310 PGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
                RL++++K +   R+ +++    T+     V +    ++++ V+ GG++LA     
Sbjct: 363 KDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQTAEF 422

Query: 367 KDHMWLSKQEWQESG 381
           K +   +K++++E G
Sbjct: 423 KSYCH-TKKDYEEYG 436

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  168 bits (426), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 127/452 (28%), Positives = 213/452 (47%), Gaps = 78/452 (17%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------- 34
           M+ +  +V+D GTG  K+G AG + P + FP+ +                          
Sbjct: 1   MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATASPSGNKKTGSSATSSSVSGSGTN 60

Query: 35  ------------------------GRPILRAEERANITTPLKDIMIGDEA---SEVRSYL 67
                                   G+ +L         T   D  IG+EA   ++  SY 
Sbjct: 61  GSNGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSY- 119

Query: 68  QISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMF 127
            +SYP+ +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ F
Sbjct: 120 SLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDH-YFLLTEPPLNPPENREQVAEIFF 178

Query: 128 EKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTR 179
           E ++  G+Y+A+QAVLAL A                       TH++PV E  V+G   +
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIK 238

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLAR 234
            + +AGRD+T  +  LL  RG A        T  +IK++ CYV  D+       D +  +
Sbjct: 239 NIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEK 295

Query: 235 ETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDV 292
               +VES E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DV
Sbjct: 296 FAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDV 354

Query: 293 RSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRR 349
           R  LY  IVLSGGS+M+     RL++++K +   R+ +N+     +     V++    ++
Sbjct: 355 RKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQ 414

Query: 350 KHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
           ++ V+ GG++LA     + +   +K++++E G
Sbjct: 415 RNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIG 445

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  168 bits (425), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 129/446 (28%), Positives = 213/446 (47%), Gaps = 78/446 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFP-SIVGRPILRAEERAN----------------ITT 49
           IV+D GTG  K+G AG + P + FP SI       A+  +N                I  
Sbjct: 9   IVMDNGTGLTKLGYAGNDSPSWIFPTSIATSQASGAKTSSNQSNTASGAASSGGSGQINN 68

Query: 50  PL---------------------------------KDIMIGDEA---SEVRSYLQISYPM 73
           P                                   D  IG+EA   S+  SY  +SYP+
Sbjct: 69  PYFGNSTSATSFGNNLSSNNLLLSNNLAGKRGTEDLDFYIGNEALIASQGPSY-SLSYPI 127

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFG 133
            +G I+NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  
Sbjct: 128 RHGQIENWDHMERFWENSIFKYLR-AEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 186

Query: 134 GVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAG 185
           G+Y+A+QAVLAL A                       TH++PV E  V+G   + + +AG
Sbjct: 187 GLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAG 246

Query: 186 RDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLV 240
           RD+T  +  LL  RG A        T  +IK++ CYV  D+       D +  +    ++
Sbjct: 247 RDITLFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFII 303

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYK 298
           E+ +    + + +G ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY 
Sbjct: 304 ENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYN 362

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDP---TRLDKFKVRIEDPPRRKHMVFI 355
            IVLSGGS+M+     RL++++K +  +R+++N+     +     V++    ++++ V+ 
Sbjct: 363 NIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWF 422

Query: 356 GGAVLASIMADKDHMWLSKQEWQESG 381
           GG++LA     K +   +K++++E G
Sbjct: 423 GGSLLAQTAEFKSYCH-TKKDYEEYG 447

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  167 bits (423), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 130/440 (29%), Positives = 212/440 (48%), Gaps = 72/440 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------GRPILRA 41
           +V+D GTG  K+G AG + P + FP+ +                         G P    
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNPYYGN 68

Query: 42  EERA------NITTPLK-------------DIMIGDEA---SEVRSYLQISYPMENGIIK 79
              A      N+++ L              D  IG+EA   S+  SY  +SYP+ +G ++
Sbjct: 69  STSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVE 127

Query: 80  NWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAI 139
           NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+
Sbjct: 128 NWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGLYIAV 186

Query: 140 QAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTRH 191
           QAVLAL A                       TH++PV E  V+G   + + +AGRD+T  
Sbjct: 187 QAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLF 246

Query: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTLVESYELP 246
           +  LL  RG A        T  +IK++ CYV  D+       D    +    +VE+ E  
Sbjct: 247 IQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST 303

Query: 247 DGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSG 304
             + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLSG
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSG 362

Query: 305 GSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           GS+M+     RL+++LK +   R+ +++    T+     V++    ++++ V+ GG++LA
Sbjct: 363 GSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLA 422

Query: 362 SIMADKDHMWLSKQEWQESG 381
                K +   +K+++ E G
Sbjct: 423 QTAEFKGYCH-TKKDYDEYG 441

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  166 bits (421), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 215/441 (48%), Gaps = 73/441 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEER-------------------- 44
           +V+D GTG  K+G AG + P + FP+ +   +P   A+                      
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSKTAKSSSMSGMGQSGSGMGAGGSAFF 68

Query: 45  ANITTPLK-----------------------DIMIGDEA---SEVRSYLQISYPMENGII 78
            N T+                          D  IG+EA   ++  SY  +SYP+ +G +
Sbjct: 69  GNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQV 127

Query: 79  KNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVA 138
           ++W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A
Sbjct: 128 EDWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 186

Query: 139 IQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVAGRDVTR 190
           +QAVLAL A                       TH++PV E  V+G   + + +AGRD+T 
Sbjct: 187 VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITL 246

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD-TKLARETTT----LVESYEL 245
            +  LL  RG          T  +IK++ CYV  D+  +  K  R+ T     +VE+ E 
Sbjct: 247 FIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEK 303

Query: 246 PDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALYKAIVLS 303
              + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY  IVLS
Sbjct: 304 TQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 362

Query: 304 GGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     RL+++L+ +   R+ +++    T+    +V++    R+++ V+ GG++L
Sbjct: 363 GGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLL 422

Query: 361 ASIMADKDHMWLSKQEWQESG 381
           A     K +   +K++++E G
Sbjct: 423 AQTAEFKSYCH-TKKDYEEYG 442

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  166 bits (420), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/450 (27%), Positives = 220/450 (48%), Gaps = 77/450 (17%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------GRPILRAEERANI 47
           ++ H+ +V+D GTG  K+G AG + P + FP+ +             G     ++ +AN 
Sbjct: 4   LNNHA-VVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSNSSGKSTGGGNTSSQSQANT 62

Query: 48  TTPL-----------------------------------KDIMIGDEA---SEVRSYLQI 69
           ++ +                                    D  IG+EA   ++  +Y  +
Sbjct: 63  SSGVIGSYFGNSTSATSFNNFASSLLLSNNLAGKRGTEDLDFYIGNEALTAAQGPAY-SL 121

Query: 70  SYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEK 129
           SYP+++G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE 
Sbjct: 122 SYPIKHGQVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFES 180

Query: 130 YDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRL 181
           ++  G+Y+A+QAVLAL A                       TH++PV E  V+G   + +
Sbjct: 181 FNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNI 240

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARET 236
            +AGRD+T  +  LL  RG         +T  +IK++ CYV  D+       D  + + +
Sbjct: 241 PIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFS 297

Query: 237 TTLVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRS 294
             ++E+      + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR 
Sbjct: 298 QFIIENQGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRK 356

Query: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKH 351
            LY  IVLSGGS+M+     RL+++L+ +   R+ +++    T+     V++    R+++
Sbjct: 357 GLYSNIVLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRN 416

Query: 352 MVFIGGAVLASIMADKDHMWLSKQEWQESG 381
            V+ GG++LA     K +   +K++++E G
Sbjct: 417 AVWFGGSLLAQTAEFKSYCH-TKRDYEEYG 445

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  166 bits (420), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 128/447 (28%), Positives = 209/447 (46%), Gaps = 79/447 (17%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------------- 34
           +V+D GTG  K+G AG + P + FP+ +                                
Sbjct: 9   VVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNAKQTSSNAVSAGASSVANTGQSSGS 68

Query: 35  GRPILRAEERANITTPLK-------------------DIMIGDEA---SEVRSYLQISYP 72
           GR        A     L                    D  IG+EA   ++  SY  +SYP
Sbjct: 69  GRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSY-GLSYP 127

Query: 73  MENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDF 132
           + +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++ 
Sbjct: 128 IRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPLNPPENREQVAEIFFESFNC 186

Query: 133 GGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLGHLTRRLDVA 184
            G+Y+A+QAVLAL A                       TH++PV E  V+G   + + +A
Sbjct: 187 AGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIA 246

Query: 185 GRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTTL 239
           GRD+T  +  LL  RG          T  +IK++ CYV  D+       D    +    +
Sbjct: 247 GRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFV 303

Query: 240 VESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGMGELLFDTVQSADVDVRSALY 297
           VES E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +DVR  LY
Sbjct: 304 VESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 362

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND---PTRLDKFKVRIEDPPRRKHMVF 354
             IVLSGGS+M+     RL+++LK +   R+++++    T+     V++    ++++ V+
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQRNAVW 422

Query: 355 IGGAVLASIMADKDHMWLSKQEWQESG 381
            GG++LA     K +   +K++++E G
Sbjct: 423 FGGSLLAQTAEFKSYCH-TKKDYEEIG 448

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  162 bits (409), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 187/350 (53%), Gaps = 28/350 (8%)

Query: 53  DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLT 109
           D  IG+EA   S+  SY  +SYP+ +G ++NW  ME  W+ + F+ ++     +   LLT
Sbjct: 107 DFYIGNEALVASQGPSY-SLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDH-FFLLT 164

Query: 110 EPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 165 EPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDG 224

Query: 163 -THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            TH++PV E  V+G   + + +AGRD+T  +  LL  RG         +T  +IK++ CY
Sbjct: 225 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCY 281

Query: 222 VSYDL-----DLDTKLARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQ 274
           V  D+       D   ++    +VE+ E    + + VG ERF APE  F P +   D   
Sbjct: 282 VCPDIVKEFNKFDRDGSKFAQFIVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLT 341

Query: 275 PGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND-- 332
           P +  ++  T+Q+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+ +++  
Sbjct: 342 P-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERL 400

Query: 333 -PTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
             T+     V++    ++++ V+ GG++LA     K +   +K++++E G
Sbjct: 401 SGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYG 449

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          +V+D GTG  K+G AG + P + FP+ + 
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPTAIA 37

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  156 bits (395), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 183/350 (52%), Gaps = 28/350 (8%)

Query: 53  DIMIGDEA---SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLT 109
           D  IG+EA   S+  +Y  ++YP+ +G ++NW  ME  W+ + F+ ++     +   LLT
Sbjct: 106 DFYIGNEALTASQGANY-SLNYPIRHGQVENWDHMERFWENSIFKYLRTEPEDH-FFLLT 163

Query: 110 EPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 164 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDG 223

Query: 163 -THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            TH++PV E  V+G   + + +AGRD+T+ +  LL  RG          T  +IK++ CY
Sbjct: 224 VTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCY 280

Query: 222 VSYDL-----DLDTKLARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQ 274
           V  D+       D    +    +VE+ +    + + +G ERF APE  F P +   D   
Sbjct: 281 VCPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLT 340

Query: 275 PGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVL---RN 331
           P +  +L  T+Q+  +DVR  LY  IVLSGGS+M+     RL+++LK +   R+    R 
Sbjct: 341 P-LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERL 399

Query: 332 DPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
              R     V++    ++++ V+ GG++LA     K +   +K++++E G
Sbjct: 400 SGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYG 448

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 7  IVLDQGTGFVKIGRAGENFPDYTFPS 32
          +V+D GTG  K+G AG + P + FP+
Sbjct: 9  VVMDNGTGLTKLGFAGNDSPSWIFPT 34

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 152/379 (40%), Gaps = 70/379 (18%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +PIV+D G+  +K G A  N P +T  + + +        +N    +KDI          
Sbjct: 4   APIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNR 119
           S +  + P + G + +W     +WDY  F     +   L TT N  ++ +E  M   +  
Sbjct: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX----------------- 161
           + M +V+FE+Y++  ++ A +   +   A+G                             
Sbjct: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172

Query: 162 ---------XTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212
                     T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230

Query: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKV 253
             IKEK  ++S +   D+  +R  T   + Y LPD                    +TI +
Sbjct: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288

Query: 254 GQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLP 313
             E F  PE  F P +  +  PG+ E + +++      +R  L   +V++GG+   P   
Sbjct: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFA 348

Query: 314 SRLEKELKQL----WFTRV 328
           SRL  EL++     W  RV
Sbjct: 349 SRLATELQRQCPTDWSCRV 367

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 122/298 (40%), Gaps = 36/298 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+    A+E        + I I  +  
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGNKKIFSEQSIGIPRKDY 69

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
           E++  +      ENG++ +W   +  W +A   ++ L + S    LLTEP  N T+NR+K
Sbjct: 70  ELKPII------ENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L   TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +T D+E               ++ 
Sbjct: 184 FIAGKFI-NHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
           KE LC++     L+      ++T   S E P    I    E R+   E LF P   D+
Sbjct: 243 KETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDI 300

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 62/115 (53%), Gaps = 16/115 (13%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L++ ++ S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++            
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI------------ 431

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           L   K RI        R++  ++GG++L S +     +W+ K+E++E G   ++ 
Sbjct: 432 LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVGVERLLN 485

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 85.1 bits (209), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 119/303 (39%), Gaps = 46/303 (15%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----NITTPLKDIMI 56
           D  S +V+D G+    IG +G +FP    PS+ G+     + +      +I  P KD   
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPRKD--- 68

Query: 57  GDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPT 116
                      ++   +ENG++ +W   +  W +A   ++ L + S    LLTEP  N T
Sbjct: 69  ----------YELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNST 118

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGH 176
           +NR+K  EV+ E   F   Y+A  +    +A G               + P+ + + L  
Sbjct: 119 ENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSK 178

Query: 177 LTRRLDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET------------ 211
            TRR  +AG+ +  HLI              +  R+     +  D+E             
Sbjct: 179 STRRNFIAGKFI-NHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSLYEYANNRG 237

Query: 212 -VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPGL 269
             ++ KE LC++     L+   A    T   S E P    I    E R+   E LF P  
Sbjct: 238 FFQECKETLCHICPTKTLEEAKAELNATTKRSIETPWNEEIVFDNETRYGFAEELFLPKK 297

Query: 270 VDV 272
            D+
Sbjct: 298 DDI 300

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 63/112 (56%), Gaps = 16/112 (14%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFT---RVL 329
           E  G+ +L++ ++ S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++  +   R+L
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRIL 440

Query: 330 RNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
               TR             R++  ++GG++L S +     +W+ KQE++E G
Sbjct: 441 TTGHTR------------ERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 84.0 bits (206), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 36/291 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+  L A+E +      + I I  +  
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSKKMFSEQSIGIPRKDY 69

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
           E++  +      ENG++ +W   +  W +A   ++ L + S    LLTEP  N  +NR+K
Sbjct: 70  ELKPII------ENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L   TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +  D++               ++ 
Sbjct: 184 FIAGKFIN-HLIQKALEPKEIIPLFAIKQRKPELIKKVFDYKVDKSLYDYANSRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLF 265
           KE LC++     L+   A  +TT   S E P    I    E R+   E LF
Sbjct: 243 KETLCHICPTKPLEEAKAELSTTTKRSIESPWNEEIIFDNETRYGFAEELF 293

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 60/112 (53%), Gaps = 16/112 (14%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+  L++ ++ S+DVD+R+ L   +VL+GG+S  PGL  RL  EL ++         
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI--------- 430

Query: 333 PTRLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
              L   K RI        R++  ++GG++L S +     +W+ KQE++E G
Sbjct: 431 ---LPSLKFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 122/299 (40%), Gaps = 33/299 (11%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA-EERANITTPLKDIMIGDEA 60
           D  + IV+D G+    IG +G + P+   PS  G+    A EE    T    +  IG   
Sbjct: 10  DEITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIG--- 66

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
              R   +I   +ENG I +W   +  WD+    ++ L + S   +LLTEP  N  +NR+
Sbjct: 67  -LARPDYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           K  EV+ E  DF   Y++  +    +A G             T + PV + + L   + R
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTR 185

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQ 214
             +AGR +  HLI+             + SRR     RT +++               ++
Sbjct: 186 NFIAGRYI-NHLIETYLKPREIIPLFAIESRRPEFKRRTFNYQVDDSLFTYGNERGFYQE 244

Query: 215 IKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
            KE LC +  +  L+      +T    S E P    I    E R+   E LF P   D+
Sbjct: 245 CKETLCQIIPNSTLEKSQDELSTMTKRSIEAPWAEEIVFDNEARYGFAEQLFSPHREDI 303

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 61/114 (53%), Gaps = 16/114 (14%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+  ++  +DVD+R++L   +V++GG+S  P L  RL  EL +            R
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------R 457

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMV 386
           L   K RI        +++  ++GG++L S +     +W+ K+E++E GA  ++
Sbjct: 458 LPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVGADRLL 510

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/298 (25%), Positives = 125/298 (41%), Gaps = 36/298 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G +FP    PS+ G+     E + NI +  + I I  +  
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-YTADEGKKNIFSE-QSIGIPRKDY 69

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
           E++  ++      +G++ +W   +  W +A   ++ L + S    LLTEP  N T+NR+K
Sbjct: 70  ELKPIVK------DGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + L   TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFETVRQI------------- 215
            +AG+ +  HLI              +  R+     ++ ++E  + I             
Sbjct: 184 FLAGKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
           KE LC++     L+   A  +TT   S E P    I    E R+   E LF P   DV
Sbjct: 243 KETLCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 16/120 (13%)

Query: 271 DVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLR 330
           D E  G+  L++ ++ S+DVD+R+ L   +VL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPTRLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
                L   K RI        R++  ++GG++L S +     +W+ K+E++E G   ++ 
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVGVERLLN 485

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 115/293 (39%), Gaps = 27/293 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  + +++D G+    IG +G ++P    PS  G       E    TT  K I       
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGT-YKETTEGQESTTKRKRIFSESSIQ 70

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
             R   +I   +ENG I +W   +  W +A   Q+ L +TS    LLTEP  N  +NR+K
Sbjct: 71  IPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALLTEPIWNSVENRKK 130

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             E++ E  +F   Y++       +A G             T + PV + + L   + R 
Sbjct: 131 SLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRN 190

Query: 182 DVAGRDVT---------RHLIDLLS---RRGYAFNRTADF-------------ETVRQIK 216
            +AG+ +          R +I L S   RR     RT D+             E  ++ K
Sbjct: 191 FIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLYQYANEHEFFQECK 250

Query: 217 EKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPG 268
           E LC ++    L+    +  T    S E P    +    E RF   E LF P 
Sbjct: 251 ETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGEELFVPN 303

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 63/125 (50%), Gaps = 22/125 (17%)

Query: 271 DVEQP------GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
           D+ +P      G+ +L++  +  +DVD+R++L   +VL+GGSS  PGL  RL  EL +  
Sbjct: 381 DISEPTKNDIAGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR-- 438

Query: 325 FTRVLRNDPTRLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
                     RL   K RI        R++  ++GG++L S +     +W+ K E+ E G
Sbjct: 439 ----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEVG 487

Query: 382 AASMV 386
              ++
Sbjct: 488 VERLL 492

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 145/366 (39%), Gaps = 64/366 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           P+V+D G+  VK G +  + P +   + + R    A   +N    +KDI          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNRE 120
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVA-----------IQAVLALYAQGLXXXXXXXXXX--------- 160
            M +V+FE+Y+F  +  A            +    +  +G                    
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 161 -----XXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
                  T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVGQE 256
           KEK  ++S     D+  A++  T VE Y LPD                    +T+ +  E
Sbjct: 232 KEKCLFMSPVSYFDS-FAKKDQTAVE-YVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRL 316
            F  PE  F P +  + +PG+ E + +++      +R  +   I+ +GG+   P  P RL
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKELKQ 322
             EL++
Sbjct: 350 ATELQR 355

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 86/378 (22%), Positives = 143/378 (37%), Gaps = 69/378 (18%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           SP+++D G+  +K G   E  P     SI  +        +N    +KDI          
Sbjct: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSI-AKDKYGNYHLSNQVRSIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPTTSNGKILLTEPPMNPTKNR 119
           S +  + P E G + +W     +WDY  F         + TT    ++ +E  M   +  
Sbjct: 53  SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------- 160
           + M +V+FE+Y+F  ++ A   V   +  G                              
Sbjct: 113 KNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQ 172

Query: 161 -------XXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213
                    + IVPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 173 LVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 230

Query: 214 QIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVG 254
            IKE   ++S +   ++  +R  T   + Y LPD                    +TI + 
Sbjct: 231 SIKENCLFMSPNAYFESFQSRSKT--AKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQ 288

Query: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314
            E F  PE  F P +  +   G+ E + +++      +R  +   IV++GG+   P   S
Sbjct: 289 DELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFAS 348

Query: 315 RLEKELKQL----WFTRV 328
           RL  EL++     W  RV
Sbjct: 349 RLATELQRQCPTDWSCRV 366

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 145/371 (39%), Gaps = 72/371 (19%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERANITTPLKDIMIGDEA 60
           +PI++D G+  VK G A  + P     ++     G P L     +N  + LKDI      
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------ 52

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPTTSNGKILLTEPPMNPT 116
               S +Q   P E G + +W     +WDY  +       ++  T    ++L+E  M+  
Sbjct: 53  ----SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMP 108

Query: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
           +  +   +V+FE+Y+FG  +   +   +    Q L                         
Sbjct: 109 ELSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYN 168

Query: 162 -----------XTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFE 210
                       T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +  
Sbjct: 169 DFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETI 226

Query: 211 TVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTI 251
            V  IKEK  ++S     ++   +E TT    Y LPD                    +TI
Sbjct: 227 LVNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTI 284

Query: 252 KVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPG 311
           K+  E F  PE  F P +  + +PG+ E + +++      +R  +    V++GG+     
Sbjct: 285 KLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRN 344

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 345 FARRLATELQR 355

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/359 (22%), Positives = 140/359 (38%), Gaps = 56/359 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRSY 66
           +V+D G+  +K G +G + P      +      R    +N T  ++DI          S 
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKL-------PTTSNGKILLTEPPMNPTKNR 119
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------X 161
           + M +V+FE+YDF  ++    A    + QG                              
Sbjct: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 162 XTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232

Query: 222 V---SYDLDLDTKLARETTTLVESYELP---------------DGRTIKVGQERFEAPEC 263
           V   SY      K+  +   ++  ++                 D +T+ +  E F  PE 
Sbjct: 233 VPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPET 292

Query: 264 LFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQ 322
            F P +  + +PG+ E + + +      VR  L   IV +GG+   P    RL+ EL++
Sbjct: 293 FFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 86/372 (23%), Positives = 145/372 (38%), Gaps = 72/372 (19%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +P+V+D G+  VK G A    P Y   + +      A   +N    +KDI          
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAP-YCALNAIANDKYDASYLSNQIKSIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119
           S + I  P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  
Sbjct: 53  SSVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELG 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX---------------------- 157
           + M +V+FE+Y+FG +   +++ +A Y   L                             
Sbjct: 113 KNMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDF 169

Query: 158 -----XXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212
                     T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 170 QLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILV 227

Query: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT---------------------- 250
             IKEK  +VS     D+   ++ T+    Y LPD +T                      
Sbjct: 228 NNIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQS 285

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYP 310
           I +  E F  PE  F P +  + +PG+ E + +++      +R  +   I+  GG+   P
Sbjct: 286 ITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLP 345

Query: 311 GLPSRLEKELKQ 322
              SR+ KEL++
Sbjct: 346 HFASRVAKELQR 357

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G      P   F + + R    +   +N    +KDI          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPTTSNGKILLTEPPMNPTKNRE 120
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX---------------------XXXXX 159
            M +V+FE+Y+F  ++ +  A  A + +                                
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 XXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 CYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIKVGQERFEA 260
            +VS     ++   +E T +   Y LPD                    +T+++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E + +++      +R  +   IV +GG+   P   +RL  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 147/368 (39%), Gaps = 65/368 (17%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +P+++D G+  +K G + +  P +   + + +        +N    +KDI          
Sbjct: 4   APLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119
           S + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +  
Sbjct: 53  SSVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH--------------- 164
               +V+FE+Y F  +Y A  A    + +              T+               
Sbjct: 113 RNTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLV 172

Query: 165 ---------IVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
                    I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  I
Sbjct: 173 IDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNI 230

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG--------------------- 254
           KE   ++S  +       ++  T VE Y LPD +T  +G                     
Sbjct: 231 KENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILE 288

Query: 255 QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPS 314
            E F  PE  F P + +V +PG+ E + +++      +RS +   IV +GG+   P   S
Sbjct: 289 DELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGS 348

Query: 315 RLEKELKQ 322
           R+  EL++
Sbjct: 349 RIYTELQK 356

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           P++++ G+  +K G A    P Y   + + R        +N    ++DI          S
Sbjct: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPTTSNGKILLTEPPMNPTKNREK 121
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------XXXXXXXXXXXX 162
           M +V+FE+Y+FG +     A    + +                                 
Sbjct: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY- 221
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+ 
Sbjct: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230

Query: 222 --VSYDLDLDTKLARETTTLVESYELPDGRTIKVG-------------------QERFEA 260
             VSY    D+   R+  T VE Y LPD +T  +G                    E F  
Sbjct: 231 PPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTV 285

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P + ++ +PG+ E + + V      +R  L   IV  GG+       +RL  EL
Sbjct: 286 PETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345

Query: 321 KQLWFTRVLRNDPTRLDKFKVRIEDP 346
           +        R  PT    +KVR+  P
Sbjct: 346 Q--------RQCPT---DWKVRVHQP 360

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 117/295 (39%), Gaps = 38/295 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+           T   KD +  +++ 
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK----------YTEGEKDELFSEQSI 61

Query: 62  EV-RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120
            + R   +I   ++NG + +W   E  WD+A   +++  T S    LLTEP  N  +NR+
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           K  EV+ E  DF   Y+   A    +A G             T + PV + + L   + R
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 181 LDVAG---RDVTRH---------LIDLLSRRGYAFNRTADFET-------------VRQI 215
             +AG    ++ R          L  +  RR     R  D+E               ++ 
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF 241

Query: 216 KEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQ-ERFEAPECLFQPGL 269
           KE +  V+       K   ETT+   S E P G  +     +R E  E LF P L
Sbjct: 242 KETMLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 66/116 (56%), Gaps = 12/116 (10%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L++ ++ S DVD+R+ L   +V++GG+S  PGL  R+  EL         R+ 
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELN--------RSL 422

Query: 333 PTRLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           P    KF++      R R++  ++GG++LAS +     +W+ KQE+ E GA  ++K
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 475

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 88/368 (23%), Positives = 154/368 (41%), Gaps = 58/368 (15%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PI++D G+  +K G +    P Y   + + R       R +++  +K I       EV S
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQI------REV-S 52

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPTTSNGKILLTEPPMNPTKNREK 121
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 53  NCHVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112

Query: 122 MCEVMFEKYDFGGV-------YVAIQ--AVLALY-AQGLXXXXXXXXXX----------X 161
           M +V+FE+Y+FG +       Y+     A   +Y + GL                     
Sbjct: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172

Query: 162 XTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C+
Sbjct: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCCF 230

Query: 222 ---VSY--------DLDLDTKLARETTTLVESYELP------DGRTIKVGQERFEAPECL 264
              VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE  
Sbjct: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290

Query: 265 FQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQL- 323
           F P + ++ +PG+ E + +++      +R  +   I + GG+       SRL  EL++  
Sbjct: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQC 350

Query: 324 ---WFTRV 328
              W  RV
Sbjct: 351 PTDWSVRV 358

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 148/376 (39%), Gaps = 72/376 (19%)

Query: 4   HSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEV 63
            +PIV+D G+  VK G +    P+    ++  +    A   +N    +KDI         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPT-----TSNGKILLTEPPMNPTKN 118
            S + I  P E G + +W     +WDY FF   + P      T    ++++E  M   + 
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLXX 152
              M +VMFE+Y+F  ++ +  A                          +  + +Q +  
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----XXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207
                          T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVG------------- 254
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287

Query: 255 --------QERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGS 306
                    E F  PE +F P +  + +PG+ E + +++      +R  L   IV  GG+
Sbjct: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347

Query: 307 SMYPGLPSRLEKELKQ 322
              P   SRL  EL++
Sbjct: 348 FNMPNFGSRLATELQR 363

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 100/234 (42%), Gaps = 10/234 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R   + N T    D ++ D+A 
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNK-NFTFVGNDTLL-DQA- 91

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNRE 120
            VRS  Q   P +   + NW   E + DY F      P       ILLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
              ++MFE Y+  GV   I ++   Y Q   G             T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  GR    +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 66/153 (43%), Gaps = 28/153 (18%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGEL----LFDTVQSADVDVRSA- 295
           +S  + +   + +  ER   PE +FQP L   +Q G+ EL    L     S    + S  
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTS 661

Query: 296 --LYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPR 348
             +   + ++GG+S  PGL  R+ +E  +       F+  + +DP+ LD +K        
Sbjct: 662 LDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
                  G A LA    +     +SK+E++E G
Sbjct: 713 -------GMAALAQNKEEYKKTVISKKEYEEYG 738

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 91/206 (44%), Gaps = 20/206 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G + P    PS  G     + ++ N  +  +D    DE++
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPHSILPSRYG-----SFKKTNKDSGDEDTK-SDESA 65

Query: 62  EVRSYL-------------QISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILL 108
             R+++             +I   +ENG + +W   +  W++A   ++ L +T     LL
Sbjct: 66  TKRAHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALL 125

Query: 109 TEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPV 168
           TEP  N  KNR+K  E + E  +F   Y+A  +    +A G               + PV
Sbjct: 126 TEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPV 185

Query: 169 YESVVLGHLTRRLDVAGRDVTRHLID 194
            + + L   TRR   AG+ +  HLI+
Sbjct: 186 VDGMTLSKSTRRSFFAGKYIN-HLIE 210

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 16/115 (13%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+  ++ ++DVD+R++L   + L+GG+S+ PGL  RL  EL              R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           L   K RI        R++  ++GG+VL S +     +W+ +QE++E GA  ++ 
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVGADRLLN 501

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 100/234 (42%), Gaps = 10/234 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R   + N T    D ++ D+A 
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNK-NFTFVGNDTLL-DQA- 91

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNRE 120
            VRS  Q   P +   + NW   E + DY F     LP    +  ILLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
              +++FE Y+  GV   I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  G     +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGEL-------LFDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL        F + +       
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTS 661

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             +   I+++GG++  PGL  R+ KE     FT  L   P   +   V I   P      
Sbjct: 662 LDMVNNILITGGNAKVPGLRERIVKE-----FTEFL---PVGTN-VAVNISSNPSLD--A 710

Query: 354 FIGGAVLASIMADKDHMWLSKQEWQESG 381
           + G A LA   A+     +SK+E++E G
Sbjct: 711 WRGMAALARNKAEYKKTVISKEEYEEYG 738

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 110/300 (36%), Gaps = 36/300 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTP---LKDIMIGD 58
           D  S +V+D G+    IG +G + P    PS  G       +  N   P    K +    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYG-------DYTNTDDPEGKKKKVFSEQ 64

Query: 59  EASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKN 118
                R   +I   +ENG++ +W   +  W +A   Q+ L + S    LLTEP  N  +N
Sbjct: 65  SICIPRKDYEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPIWNTVEN 124

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLT 178
           R+K  E++ E  DF   Y+A       +  G               + PV + + L   T
Sbjct: 125 RKKSLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGMTLSKST 184

Query: 179 RRLDVAGRDVTRHLIDLLS------------RRGYAFNRTADFET-------------VR 213
           +R   AG  +   + + +S            RR     +  +F                +
Sbjct: 185 KRNFFAGGYLNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYANDRGIFQ 244

Query: 214 QIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
           + KE LC V+    LD   +   T    S E P    I    E R+   E LF P   DV
Sbjct: 245 ECKETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFLPRKEDV 304

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 16/109 (14%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+  ++ ++DVD+R+ L   +VL+GG+S  PGL  RL  EL             +R
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
           L   K R+        R++  ++GG+VL S +     +W+ K+E+Q+ G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 108/278 (38%), Gaps = 36/278 (12%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA---------EERANITTPLK 52
           D  S +V+D G+    IG +G + P    PS  G   L+          EE +      K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPP 112
            I      +  R+  +I   ++NG + +W   +  WD+A    + L + S     LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 MNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N  +NR+K  EV+ E   F   Y++       +A G               + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLGHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE---------- 210
            L   + R  ++GR +   + + L             R+     +T DF           
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYAN 251

Query: 211 ---TVRQIKEKLCYVSYDLDLDTKLARETTTLVE-SYE 244
                ++ KE LC ++    LD K+A E  +L + SYE
Sbjct: 252 DHGIFQECKETLCQIAPTAALD-KMAPELESLAKRSYE 288

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 18/117 (15%)

Query: 275 PGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +L+  ++ + DVD+R++L   IVL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 331 NDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
              TR             R++  ++GG++L+S +     +W+ KQE++ESGA  ++K
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESGADRLLK 497

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/383 (21%), Positives = 143/383 (37%), Gaps = 75/383 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           P V+D G+  +K G A    P +   + + +    A   +N    ++DI          S
Sbjct: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------TTSNGKILLTEPPMNPTKNR 119
              I  P E G + +W     +WDY  +   +         T    ++LTE      +  
Sbjct: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-------------------- 159
           +   +V+FE+Y+F  ++ +  +    +A  +                             
Sbjct: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRD 171

Query: 160 --------XXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211
                      T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229

Query: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRT--------------------- 250
           +  IKEK  +VS     D+   ++   +   Y LPD +T                     
Sbjct: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 251 -IKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMY 309
            I +  ERF  PE  F P + ++ +PG+ E + + +      +R  L   IV  GG+   
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 310 PGLPSRLEKEL-KQL---WFTRV 328
           P + SRL  EL +QL   W  RV
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRV 370

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/387 (21%), Positives = 139/387 (35%), Gaps = 84/387 (21%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +PIV+D G+  +K G +    P +   + + +        +N    +KDI          
Sbjct: 4   APIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMK-----LPTTSNGKILLTEPPMNPTKNR 119
           S +    P E G +  W     +WDY FF  ++     L       ++ +E  M   +  
Sbjct: 53  SSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------- 160
           +   +V+FE+Y+F  ++ +  A    + +                               
Sbjct: 113 KHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSN 172

Query: 161 -----------------------XXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLS 197
                                    T I+PV + +      ++LDV GR +T  L + LS
Sbjct: 173 NPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLS 232

Query: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247
            R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD          
Sbjct: 233 FRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVR 288

Query: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSA 295
                        +TI +  E F  PE  F P +  + +PG+ E + +++      VR  
Sbjct: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348

Query: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322
           +   IV +GG+   P    RL  EL++
Sbjct: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 82/198 (41%), Gaps = 7/198 (3%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G + P    PS  G+     +E          IM      
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIM------ 65

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
             R   +I   +ENG + +W   +  W +A  +++K  +       LTE   NP +NR+K
Sbjct: 66  -PRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + L   + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGRDVTRHLIDLLSRR 199
            +AG+ + + + + L  R
Sbjct: 185 FLAGKLLNKLIENHLKPR 202

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 16/115 (13%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+ +L+   + + DVD+R+ L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           L   K RI        R+   ++GG++L+S +     +W+ +QE++E GA  ++K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 103/241 (42%), Gaps = 12/241 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DP  PI +D G+  ++ G   ++ P + FP+++ +   R   + N T    D ++ D+A 
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNK-NFTFVGNDTLL-DQA- 91

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNRE 120
            VRS  Q   P +   + NW   E + DY F     +P    +  ILLTE        R 
Sbjct: 92  -VRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
              +++FE Y+  GV   I ++   Y     G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLARE 235
            +R++  G     +L DL++ +   F     +     + +  CYVS  YD D+D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 236 T 236
            
Sbjct: 269 N 269

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 38/87 (43%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTS 661

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
             +   + ++GG++  PGL  R+ KE 
Sbjct: 662 IDMANNVFITGGNAKVPGLKERIVKEF 688

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 139/370 (37%), Gaps = 68/370 (18%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           SPI +D G+  +K G    + P Y   +            +N    +KDI          
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP-YRAINAFAIDKYHTTYLSNQIKNIKDI---------- 52

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP----TTSNGKILL-TEPPMNPTKNR 119
           + +    P E G + +W     +WDYA F   + P        GK L+ +E  M   +  
Sbjct: 53  TSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------- 160
           + M +V+FE+Y+F   Y +  A    +A                                
Sbjct: 113 KNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDY 172

Query: 161 --------XXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADFET 211
                     T I+PV + V      ++LD+ GR +   L + LS R Y   + T     
Sbjct: 173 QLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI---L 229

Query: 212 VRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD-------------------GRTIK 252
           V  IKE   +VS     D+    +  T VE Y LP+                    +TIK
Sbjct: 230 VNNIKENCLFVSPTSYFDS-FKNKNETAVE-YVLPNFQTTFLGHVRDKTKPLPENTQTIK 287

Query: 253 VGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGL 312
           +  E F  PE  F P +  + +PG+ E + +++      +R  L   +V +GG+   P  
Sbjct: 288 LYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHF 347

Query: 313 PSRLEKELKQ 322
            +RL  EL++
Sbjct: 348 ATRLTSELQR 357

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 13/194 (6%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  + IV+D G+    IG +G + P    PS  G          N+ T      I +E  
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYG----------NVETDGDTKRIFNEQP 61

Query: 62  EV--RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNR 119
            +  R+ ++I   +EN  I +W   +  W+YA    +K  +     +LLTEP  N   +R
Sbjct: 62  LLFPRAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASR 121

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTR 179
           +K  E++ E  +F   Y+A  +    +A G             + + PV + + L   + 
Sbjct: 122 KKSLEILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSST 181

Query: 180 RLDVAGRDVTRHLI 193
           R  VAG+ +  HLI
Sbjct: 182 RNYVAGKYLN-HLI 194

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 64/119 (53%), Gaps = 18/119 (15%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRV 328
           E  G+ +L+  ++  ADVD+R+ L   +VL+GG+S  PGL  R    L K L  L F R+
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKF-RM 470

Query: 329 LRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           L +   R             R++  ++GG++LAS +     +W+ ++E++E G   ++K
Sbjct: 471 LSSGHLR------------ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 67/116 (57%), Gaps = 18/116 (15%)

Query: 275 PGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSR----LEKELKQLWFTRVLR 330
           PG+ +L+  ++ +ADVD+R++L   +VL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 331 NDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMV 386
           N  TR             R++  ++GG++L+S +     +W+ KQE++E GA  ++
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIGADRLL 498

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/268 (22%), Positives = 105/268 (39%), Gaps = 40/268 (14%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDE-A 60
           D    +V+D G+    IG +G ++P    PS  G      +++A+   P +      E A
Sbjct: 12  DEICAVVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENA 71

Query: 61  SEVR-----SYLQISYP---------MENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKI 106
           S+++     +   + YP         ++NG + +W   +  W +A   ++ L +      
Sbjct: 72  SKIKIRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPA 131

Query: 107 LLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIV 166
           LLTEP  N  +NR+K  EV+ E   F   Y++       +A G               + 
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVS 191

Query: 167 PVYESVVLGHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE---- 210
           PV + +     TRR  ++G+ +   + D L             R+     +T DF     
Sbjct: 192 PVVDGMTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDS 251

Query: 211 ---------TVRQIKEKLCYVSYDLDLD 229
                      ++IKE LC VS +  L+
Sbjct: 252 LKTYANDRGIYQEIKEALCRVSPNSSLE 279

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 97/233 (41%), Gaps = 21/233 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + F + + R   R + R N+T       IG++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNR-NLT------FIGNDTN 86

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSN----GKILLTEPPMN 114
               VRS  Q   P +  I+ NW   E + +Y F     L    N      IL+TE    
Sbjct: 87  LDLSVRS--QAKSPYDGAIVSNWDYTEEIMEYTFHH---LGVNGNDGVSNPILMTEKLAT 141

Query: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESV 172
               RE   +++FE +    V   I ++ + YA                 TH++PV    
Sbjct: 142 LQSQRENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGK 201

Query: 173 VLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
            +    +R++  GR    +L +LL+ +   F         + + E  CYVS D
Sbjct: 202 GVLSEAKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +  ++Q G+ E+        F + +S   +  
Sbjct: 594 DSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGS 653

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
             L   + L+GG+   PG+  R+ +E 
Sbjct: 654 KKLAANVFLTGGNMRLPGVRERIVREF 680

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 6/203 (2%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA---NITTPLKDIMIGD 58
           D  + +++D G+    IG AG + P    PS  G  I  AEE     N     K   +  
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 59  EASEV--RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPT 116
           E S    R   ++   +ENG + +W      W +A   ++ + +      +LTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGH 176
           +NR K  E++ E  +F   Y+   +    +A G               + PV + + L  
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTRRLDVAGRDVTRHLIDLLSRR 199
            TR    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 66/115 (57%), Gaps = 12/115 (10%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E PG+ +L+  ++ S DVD+R++L   +V++GGSS  PGL  R+  EL  + F  +    
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNEL-NMKFPAL---- 439

Query: 333 PTRLDKFKVRIEDPP-RRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMV 386
                KF+V        R++  ++GG++L+S +     +W+ K+E++E G+  ++
Sbjct: 440 -----KFRVLATGQSIERQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVGSERLL 488

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 136/371 (36%), Gaps = 62/371 (16%)

Query: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60
           M     IV+D G+  VK G A E  P     ++  +        +N    +KDI      
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-AKDKYGVTHLSNQVQNIKDI------ 53

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPTTSNGKILLTEPPMNPT 116
               S +    P E G + +W     +WDY  +      +   +  N  ++L+E  M   
Sbjct: 54  ----SSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLP 109

Query: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXX---------------- 159
           +  +   +V+FE+Y+   +Y A   A +  Y                             
Sbjct: 110 ELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKE 169

Query: 160 -----------XXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTAD 208
                         T ++P+ + V      ++LDV GR +   L + +S R Y  N   +
Sbjct: 170 YNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVMDE 227

Query: 209 FETVRQIKEKLCYV---SYDLDLDTKLARETTTLVESYE-------------LPDGRTI- 251
              V  IKE+  YV   SY      K   +   ++  ++             LPD   I 
Sbjct: 228 SILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQIL 287

Query: 252 KVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPG 311
            +  ERF  PE  F P +    +PG+ E + +++      +R  +   IV  GG+   PG
Sbjct: 288 TLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPG 347

Query: 312 LPSRLEKELKQ 322
              RL  EL++
Sbjct: 348 FTDRLVSELQR 358

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 93/236 (39%), Gaps = 27/236 (11%)

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           RS  Q+   +ENG++ +W   E  W +A  E++ + +      LLTEP  N  +NR+K  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDV 183
           EV+ EK +F   Y+        +A G               + PV + + L    RR   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLL------------------SRRGYAFN-------RTADFETVRQIKEK 218
           AGR + R L + +                   R+ + FN          D +  ++ KE 
Sbjct: 276 AGRYLNRLLENYIKPREIIPLFMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKET 335

Query: 219 LCYVSYDLDLDTKLARE-TTTLVESYELPDGRTIKVGQ-ERFEAPECLFQPGLVDV 272
           LC +  +      +  E  ++   S E P G  I+     RF   E LF P   ++
Sbjct: 336 LCQIYPNNSFLANVKDELESSAKRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNI 391

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 64/116 (55%), Gaps = 16/116 (13%)

Query: 275 PGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPT 334
           PG+ +L+  TV S+DVD+R+ L   ++L+GG+S+ PGL  RL  EL +            
Sbjct: 490 PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNK------------ 537

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           +L   K RI        RK+  ++GG++L S +     +W+ K+E++E G   ++K
Sbjct: 538 KLPALKFRILSSGHRRERKYQAWLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 110/292 (37%), Gaps = 32/292 (10%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G      E+ A      K I       
Sbjct: 12  DEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAP-----KKIFAEQSIG 66

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
             R   +I   ++N ++ +W   E  W +A  + + L + S    LLTEP  N  +N+ K
Sbjct: 67  IPRPDYEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTK 126

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             E++ E   F   Y++       +A G             T + PV + + L   T R 
Sbjct: 127 SLEILLESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRN 186

Query: 182 DVAGRDVTR------------HLIDLLSRRGYAFNRTADFET-------------VRQIK 216
            +AG  +               L ++  R+     +T D++              +++ K
Sbjct: 187 FLAGNCINELIKKPLKGKDLVPLFEIAQRKPEFKKKTFDYQIHPSLYNYANSRGFLQECK 246

Query: 217 EKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKV-GQERFEAPECLFQP 267
           E LC V+    LD   ++  +    S E P    +    + RF   E LF P
Sbjct: 247 ETLCQVAPS-PLDKMDSQLESMAKRSIEAPWAEELVFDNKTRFGFAEQLFAP 297

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G  +L+  ++ ++DVD+R+ L   IVL+GG+S  PG   RL  EL +            +
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------K 422

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
           L   K RI        R++  ++GG++L S +     +W+ KQE++E G
Sbjct: 423 LPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVG 470

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 99/234 (42%), Gaps = 14/234 (5%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           +P SPI +D G+  ++ G      P + FP+ + +   R   + N T    D ++ D+A 
Sbjct: 35  NPQSPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNK-NFTFVGNDTLL-DQA- 91

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNG---KILLTEPPMNPTKN 118
            VRS  Q   P +   + NW   E + DY F     +P   NG    ILLTE        
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVP--DNGIPNPILLTERLATVQSQ 146

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLG 175
           R    +++FE Y+  GV   I ++ + Y     G             T+++PV +   + 
Sbjct: 147 RTNWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGIL 206

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
              +R++  G     +L DL++ +   F     +     + +  CYVS + D D
Sbjct: 207 TDAKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDED 260

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 62/153 (40%), Gaps = 28/153 (18%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGEL-------LFDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTS 661

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPR 348
             +   ++++GG++  PGL  R+ KE           T  + +DP+ LD +K        
Sbjct: 662 IDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381
                  G A LA          +SK+E++E G
Sbjct: 713 -------GMAALARNEEQYRKTVISKKEYEEYG 738

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 77/198 (38%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G          +       +      +
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLT 71

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
             R   +I   +ENG++ +W   +  WD+A    + L +      L+TE   N  +N+ K
Sbjct: 72  FPRPDYEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTK 131

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E  DF   Y++       +A G                 PV + + L   TRR 
Sbjct: 132 SLEVLLETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRN 191

Query: 182 DVAGRDVTRHLIDLLSRR 199
            ++G+ V + +   L  R
Sbjct: 192 FISGKFVDQLIGKYLQPR 209

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 22/153 (14%)

Query: 244 ELPDGRTIKVGQERFEAPECLFQPGLVDVEQP------GMGELLFDTVQSADVDVRSALY 297
           E P+G     G+++    E   + G   +E        G+ +L+  ++ SADVD+R+ L 
Sbjct: 340 EKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDLVHSSITSADVDLRATLA 399

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPR---RKHMVF 354
             IVL+GGSS  PG   RL  EL +            +L   K R+        R++  +
Sbjct: 400 HNIVLTGGSSSVPGFSDRLMNELTK------------KLPALKFRVLTTGHLRERQYQSW 447

Query: 355 IGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           +GG++L S +     +W+ K+E++E GA  ++ 
Sbjct: 448 LGGSILTS-LGSFHQLWVGKREYEEVGAERLLN 479

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 7/185 (3%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D  S +V+D G+    IG +G + P    PS  G+     +E         D  +G    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKK---SFNDQFMG---- 64

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNREK 121
             R   +I   +E+G + +W   +  W +A  +++K  +       LTE   N  +NR+K
Sbjct: 65  MARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + L   + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGR 186
            +AG+
Sbjct: 185 FLAGK 189

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 16/115 (13%)

Query: 276 GMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTR 335
           G+  L+   +   DVD+R+ L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
           L   K RI        R+   ++GG++L+S +     +W+ +QE++E GA  ++K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  +KEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNVKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLVESYELPD----------------------GRTIKVGQERFEA 260
           S     D+  A++   L   Y LPD                       +TI +  E F  
Sbjct: 256 SPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E + +++      VR  +   IV +GG+   P    RL  EL
Sbjct: 314 PETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 103/243 (42%), Gaps = 31/243 (12%)

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+P+ + V      ++LD+ GR +T  L + LS R Y  +   +   V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY--DLMDETLLVNNIKEKCLFV 258

Query: 223 SYDLDLDTKLARETTTL-----------------VESYELPDG-RTIKVGQERFEAPECL 264
           S     D+  A+E T++                  +S  LP+G + +K+  E F  PE  
Sbjct: 259 SPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETF 318

Query: 265 FQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
           F P +  + +PG+ E + +++      +R  L   IV +GG+   P   +RL  EL+   
Sbjct: 319 FHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQ--- 375

Query: 325 FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAAS 384
                R  PT    +  RI  P +   +         +         +SK+E+ E G   
Sbjct: 376 -----RQLPT---DWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDW 427

Query: 385 MVK 387
           + K
Sbjct: 428 LTK 430

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 16/142 (11%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E SEV 
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGS-AYLSNQMKKIQ---EVSEV- 55

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNR 119
               +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  
Sbjct: 56  ---TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELS 112

Query: 120 EKMCEVMFEKYDFGGVYVAIQA 141
           + M +V+FE+Y+F  ++ A  A
Sbjct: 113 KNMDQVIFEEYEFDSLFKAPTA 134

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/282 (22%), Positives = 108/282 (38%), Gaps = 32/282 (11%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITT-----PLKDIMI 56
           D  S +V+D G+    IG +G + P  T PS  G+ I   EE+           LK  + 
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 57  GDEASEV-RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNP 115
            +++  + R+  QI   + NG + +W   +  W +A   ++   +T      LTEP  N 
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNT 131

Query: 116 TKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLG 175
            +NR+K  EV+ E  +F   +++       +A G               + PV + + L 
Sbjct: 132 EENRKKSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLS 191

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARE 235
             +    +AG      L++ L  +     +T     + Q         +D ++D  L   
Sbjct: 192 KSSTSNFIAG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL--- 243

Query: 236 TTTLVESYELPDGRTIKVGQERF---EAPECLFQPGLVDVEQ 274
                           K G ER+   E  E LFQ     +E+
Sbjct: 244 ---------------FKFGNERWFFQECKETLFQVAPATLEK 270

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 65/118 (55%), Gaps = 16/118 (13%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L++ ++ + DVD+R+ L   +V++GG+S  PGL  R+  EL +          
Sbjct: 389 EIAGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK---------- 438

Query: 333 PTRLDKFKVRIEDP---PRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
              L   K R+        R++  ++GG++L+S +     +W+ KQE++E GA+ ++K
Sbjct: 439 --SLPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 223 SYDLDLDTKLARETTTLVESYELPDGRTIKVG----------------------QERFEA 260
           S     D+  ++    L   Y LPD +T  +G                       E F  
Sbjct: 256 SPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E + +++      VR  +   IV +GG+   P    RL +EL
Sbjct: 314 PETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLAREL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 62/116 (53%), Gaps = 12/116 (10%)

Query: 273 EQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRND 332
           E  G+ +L+  ++ S DVD+R+ L   +V++GGSS  PGL  R+  EL          N 
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAEL----------NK 421

Query: 333 PTRLDKFKVRIEDPPRRK-HMVFIGGAVLASIMADKDHMWLSKQEWQESGAASMVK 387
                KF++      R K +  ++GG++LAS +     +W+ KQE+ E GA  ++K
Sbjct: 422 SLPALKFRMLTSGQAREKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 476

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 75/189 (39%), Gaps = 18/189 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEE-----RANITTPLKDIMI 56
           D  + I++D G+    IG +G + P    PS  G+ I   E+       +I  P KD   
Sbjct: 12  DEITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYINDEEKPSLFNEQSIGLPRKD--- 68

Query: 57  GDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPT 116
                      +I   + +G + +W   +  W++A    +   +      LLTEP  N  
Sbjct: 69  ----------YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSE 118

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGH 176
            NR+K  EV+ E  DF   Y+   A    +A G             T + PV + + L  
Sbjct: 119 DNRKKSLEVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSK 178

Query: 177 LTRRLDVAG 185
            + R  +AG
Sbjct: 179 SSMRSFIAG 187

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 78/182 (42%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 223 SYDLDLDTKLARETTTLVESYELPDGRT----------------------IKVGQERFEA 260
           S     D+   ++   L   Y LPD +T                      I +  E F  
Sbjct: 256 SPVSYFDSFKTKDKHAL--EYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E + +++      VR  +   IV +GG+   P    RL  EL
Sbjct: 314 PETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 59/149 (39%), Gaps = 16/149 (10%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNRE 120
            +    P E G +  W     +WDY       F+   L       ++ +E  M   +  +
Sbjct: 54  SITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG 149
              +V+FE+Y+F  ++ +  AV   + + 
Sbjct: 114 HADQVIFEEYEFDSLFKSPVAVFVPFTKS 142

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 99/233 (42%), Gaps = 11/233 (4%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +PI +D G+  V+ G    + P + FP+ + R   R  + +   T + + ++ D+   VR
Sbjct: 37  TPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRH--RDRKLSKTFTFIGNDVLLDQT--VR 92

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNREKMC 123
           S  Q   P +   I NW  +E +  Y F     +   S    +++ EP  +    R+   
Sbjct: 93  S--QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWY 150

Query: 124 EVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRL 181
           E++FE +    V   I  +   YA  +G             T ++PV +   +    +R+
Sbjct: 151 ELLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRI 210

Query: 182 DVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL--DLDTKL 232
           +  GR    +L DL+S +   F         +Q+    CYVS D   D+DT L
Sbjct: 211 NWGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE LFQP +   +Q G+ EL        F +      +  
Sbjct: 599 DSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETS 658

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             + K I L+GG S  PGL  R+ KE     FT  L   P    K  V++   P      
Sbjct: 659 LGMAKNIWLTGGHSKLPGLRERIVKE-----FTGFL---PVGT-KLGVKMSKNPSLD--A 707

Query: 354 FIGGAVLASIMADKDHMWLSKQEWQESGA 382
           + G   LA   AD     +SK++++E GA
Sbjct: 708 WYGMRKLAQNEADYKDSIISKKDYEEYGA 736

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 93/234 (39%), Gaps = 17/234 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           +P  PI +D G+  V+ G   E  P + FP+ + R     + + N T        G++ S
Sbjct: 34  NPEIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTR---YRDRKINKTF----TFTGNDCS 86

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTK 117
               +RS  Q+  P +  +I NW  +E +  Y F     +P       I++TE       
Sbjct: 87  LDQTIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVV 173
            R    +++FE Y+       I ++ A Y                +H    I+P+ +   
Sbjct: 145 QRSNWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQG 204

Query: 174 LGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +    +R++  GR    +L +LL+ +   F           + +  CYVS D D
Sbjct: 205 ILTDAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGEL-------LFDTVQSADVDVR 293
           +S ++     I +  ER   PE +FQP +  ++Q G+ EL        F +      ++ 
Sbjct: 601 DSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELS 660

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             +   I L+GG+S  PGL  R+ KE ++               +F V +   P      
Sbjct: 661 LTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDA 709

Query: 354 FIGGAVLASIMADKDHMWLSKQEWQESG 381
           + G A LA    D     +SK+E++E G
Sbjct: 710 WNGMAKLAQNETDYKKTIISKKEYEEYG 737

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 99/229 (43%), Gaps = 17/229 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           +P++PI LD G+  V+ G   ++ P + FP+     I+R +ER  I   L    IG++ S
Sbjct: 37  NPNTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKERK-IQKAL--TFIGNDCS 89

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTK 117
               VRS+ +   P +  +I NW  ME +  Y F      P    +  ++LTE       
Sbjct: 90  LDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQA 147

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLG 175
            R    +++FE Y    V   I  + + YA                 T+I+PV +   + 
Sbjct: 148 QRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGIL 207

Query: 176 HLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVS 223
              +R+D  G     +L  LLS +  Y  ++  D+   + + +  CY +
Sbjct: 208 SEAKRIDWGGNQSIDYLKSLLSLKYPYFPSKLTDYH-FQSMYQNHCYFA 255

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVRSALYKAIVLSGGSSM 308
           ER  APE +FQP +  ++Q G+ EL        F +  S        +   I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRLEKEL 320
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 19/234 (8%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D   PI +D G+  ++ G   ++ P + FP+ + R   R   + N T       IG++ S
Sbjct: 34  DSTIPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDR---KINKTF----TFIGNDVS 86

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTK 117
               +R+  Q   P +  II NW  +E +  Y F     +     +  ILLTE       
Sbjct: 87  LDQAIRT--QSKSPFDGSIITNWDYVEDIMQYIFNHLGVVGHNGVSNPILLTEKLATLQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVV 173
            R    +++FE +D   V + I ++ A Y  GL                T ++PV E   
Sbjct: 145 QRSNWYQLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDVIPVVEGAG 202

Query: 174 LGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +    +R++  GR    +L DLL+ +   F         +++ +  CYV+ D D
Sbjct: 203 MLTDAKRINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYD 256

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S ++     + +  ER   PE LFQP +   +Q G+ EL        F + Q       
Sbjct: 599 DSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTA 658

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
            A+   + ++GG+S  PG+  R+ KE 
Sbjct: 659 LAMANNLWITGGNSKLPGMKERIVKEF 685

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 84/188 (44%), Gaps = 24/188 (12%)

Query: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      +++D+ GR +T  L + LS R Y  N T +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 223 ---SY--DLDLDTKLARE------TTTLV------ESYELPD-GRTIKVGQERFEAPECL 264
              SY     L  K A E       TT +         +LPD  + I +  E F   E +
Sbjct: 262 APKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTETI 321

Query: 265 FQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL-KQL 323
           F P +  + +PG+ E + +++      +R  +   IV  GG+   P    RL  EL +QL
Sbjct: 322 FHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQRQL 381

Query: 324 ---WFTRV 328
              W T V
Sbjct: 382 PTDWTTHV 389

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 61/136 (44%), Gaps = 16/136 (11%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIP-FRAINAIAKDKYNTVYLSNQIKGIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPTTSNGKILLTEPPMNPTKNRE 120
            +    P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  +   
Sbjct: 54  SVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSR 113

Query: 121 KMCEVMFEKYDFGGVY 136
            +  ++FE+Y++G +Y
Sbjct: 114 NIDHIIFEEYNYGSIY 129

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 100/232 (43%), Gaps = 19/232 (8%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           +P + I +D G+  V+ G   +  P + FP+ + R   R   R N+T       IG++ +
Sbjct: 34  NPETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNR-NLT------FIGNDTN 86

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSN--GKILLTEPPMNPT 116
               VRS  Q   P +  ++ NW   E + +Y F   + +  T      I++TE      
Sbjct: 87  LDLSVRS--QSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALH 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESV-V 173
             R+   +++FE +    V   + ++ + YA                 THI+PV +   V
Sbjct: 144 SQRDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGV 203

Query: 174 LGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
           LG   +R++  GR    +L +LL+ +   F         + + ++ CYVS D
Sbjct: 204 LGE-AKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD 254

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S ++     + +  ER   PE +FQP +  ++Q G+ E+        F + +S    + 
Sbjct: 594 DSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSIS 653

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQL 323
            +L   + L+GG+   PG+  R+ +E + L
Sbjct: 654 RSLASNVFLTGGNMRLPGMRERVVREFRGL 683

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 94/230 (40%), Gaps = 11/230 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + FP+ + R     + + N T       +G++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTR---HRDRKINKTF----TFVGNDTN 86

Query: 62  -EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNR 119
            E     Q   P +  +I NW  +E + +Y F     +     +  ILLTE        R
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYTFNHLGVVGHDGISNPILLTEKMATLQSQR 146

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
               ++MFE +    +   I ++ + +A  Q              T+++PV     +   
Sbjct: 147 SNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILSE 206

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
            +R++  GR    +  +LLS +   F         + I    CYVS D D
Sbjct: 207 AKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 18/133 (13%)

Query: 256 ERFEAPECLFQPGLVDVEQPGMGEL-------LFDTVQSADVDVRSALYKAIVLSGGSSM 308
           ER   PE +FQP +  ++Q G+ EL        F + +     V   +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  R+ +E     FT  L   P    K+ +++   P      + G A  A    D  
Sbjct: 670 VPGLRDRIVRE-----FTEFL---PVGT-KYNIKVASDPAID--AWKGMAKFAQSSTDYK 718

Query: 369 HMWLSKQEWQESG 381
             +++K+E++E G
Sbjct: 719 GSYVTKKEYEEYG 731

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 99/233 (42%), Gaps = 11/233 (4%)

Query: 3   PHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASE 62
           P  PI +D G+  ++ G      P + F + + R   R  +     T + + +  D+A  
Sbjct: 35  PDVPIAVDFGSNQLRAGLINRATPSHVFTNRITR--FRDRKLMKTMTFIGNDVNLDQA-- 90

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNREK 121
           VR+  Q   P +  ++ NW  +E + +Y F      P    +  IL+TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLGHLTR 179
             +V+FE ++  GV   I ++ A Y                  T+I+PV +   +    +
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
           R++  G     +L +L++ +  Y   + ++F   R + E  CYVS D D + K
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFH-YRTMYEDYCYVSQDYDEELK 260

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 57/133 (42%), Gaps = 18/133 (13%)

Query: 256 ERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVRSALYKAIVLSGGSSM 308
           ER   PE  FQP +   +Q G+ EL        F         + S + K + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  R+ KE     FT  L  + +    F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 369 HMWLSKQEWQESG 381
             ++SK+E++E G
Sbjct: 721 KSFISKKEYEEYG 733

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 18/238 (7%)

Query: 3   PHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS- 61
           P  PI +D G+  VK G   ++ P + F + + R   R  + A   T      IG++ + 
Sbjct: 35  PDIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMT-----FIGNDTNL 87

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS---NGKILLTEPPMNPTKN 118
           +    +Q   P +   I NW   E ++DY     + + TT+   +  I+LTE        
Sbjct: 88  DQPLRIQAKRPYDGLFIANWEYAEEIFDYTL-HHLGVQTTNGSISNPIILTEKMACLQSQ 146

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVL 174
           R    +++FE +D       + ++ A Y                    T+IVP+ +   +
Sbjct: 147 RANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPIVQGKGI 206

Query: 175 GHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
               +R++  GR  T +L  LL+ +  Y   + ++F+  + + E  CYVS + + D K
Sbjct: 207 LTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYNEDIK 263

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 64/151 (42%), Gaps = 28/151 (18%)

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGMGEL-------LFDTVQSADVDVRSALYKAIVLS 303
           I +  ER   PE +FQP +   +Q G+ EL        F++       +   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG +  PGL  R+ KE  +        +  + NDP+ LD +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 359 VLASIMADKDHMWLSKQEWQESGAASMVKFG 389
            LAS       + ++K++++E G   M++  
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYMMEHN 751

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 105/241 (43%), Gaps = 19/241 (7%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           +P+ PI +D G+  ++ G   +  P + FP+ + R   R  + A   T + +    D+A 
Sbjct: 34  NPNVPIAIDFGSSKLRAGYVNDPNPSHIFPNRLTR--YRDRKLAKTMTFIGNDTSLDQAV 91

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKI----LLTEPPMNPTK 117
            V++      P+    + NW  +E   +Y F     L   +NG I    ++ E       
Sbjct: 92  RVQAKSAFDGPL----VTNWDYVEDTLEYTF---NHLGVAANGGISNPLVINERLATIQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLG 175
            R    +++FE +D  GV   I ++   Y                  T+++PV +   + 
Sbjct: 145 QRANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVL 204

Query: 176 HLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYV--SYDLDLDTKL 232
             ++R++  G   T +L +L+S +  Y   + + F+  + + E  CYV  SYD +L+  L
Sbjct: 205 TESKRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQ-YKTMYEDYCYVSQSYDEELEKYL 263

Query: 233 A 233
           +
Sbjct: 264 S 264

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 28/138 (20%)

Query: 256 ERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVRSALYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F + Q    DV +++ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  R+ KE  +       F+     DP+ LD ++               G A LA  
Sbjct: 671 LPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWR---------------GMAKLAQN 714

Query: 364 MADKDHMWLSKQEWQESG 381
             D  H +++KQE+ E G
Sbjct: 715 TEDFKHGYITKQEYLEYG 732

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 97/234 (41%), Gaps = 23/234 (9%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           D   PI +D GT  VK G   +  P + FP+ + R   R  + +   T      IG++ +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTR--FRDRKMSRTMT-----FIGNDTN 87

Query: 62  ---EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKI----LLTEPPMN 114
               VRS  Q   P +   + NW   E + +Y F     L  T+N  I    ++TE    
Sbjct: 88  LDYAVRS--QSKTPFDGPFVTNWEYAEDILEYTF---KHLGVTANHGISNPLIMTEKLAT 142

Query: 115 PTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESV 172
               R    +++FE ++   V   I  V A YA                 T+++P+ +  
Sbjct: 143 LQSQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGK 202

Query: 173 VLGHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYD 225
            +   T+R++  G     +L DL++ +  Y   +  +F+     K+  CYVS D
Sbjct: 203 PVLTDTKRINWGGSQSVGYLSDLMTLKYPYFPTKLTEFQYETLYKD-YCYVSPD 255

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 62/133 (46%), Gaps = 18/133 (13%)

Query: 256 ERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVRSALYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F +  S   D   A+ K + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL +R+ KE     FT  L ND     KF V I   P      + G A  +S  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLSKQEWQESG 381
              +SK+E++E G
Sbjct: 727 SSLISKKEYEEYG 739

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 92/232 (39%), Gaps = 11/232 (4%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIG-DEA 60
           DP+ PI +D G+  ++ G    + P + FP+   +     + + N   P     IG D  
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSK---YRDRKTNKYLPC----IGYDTW 90

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNR 119
            +  +  Q   P +  ++ NW  +E +  Y F      P       I++ E        R
Sbjct: 91  LDQTTRSQARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQR 150

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
               + +FE +    V +A++ +LA Y    G             T+++P+ E   +   
Sbjct: 151 SNWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLD 210

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
            +R++  G     +L +LL  +   F     +    ++ +  CYVS D + D
Sbjct: 211 AKRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP L   +Q G+ E+        F +         
Sbjct: 602 DSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQS 661

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMV 353
             + K + L GG++  PGL SR+ KE     FT  L +D     K  V I + P     V
Sbjct: 662 LDMAKNVWLVGGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--V 710

Query: 354 FIGGAVLASIMADKDHMWLSKQEWQESG 381
           + G   LA+   D     ++ +E+ E G
Sbjct: 711 WNGMYRLANTEEDYQRTIVTSEEYDECG 738

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 90/229 (39%), Gaps = 14/229 (6%)

Query: 2   DPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEAS 61
           DP++ I +D G+  ++ G   +N P Y FP+ + +   R  ++   T    D ++     
Sbjct: 34  DPNARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKT-FTFIGNDTLLD---Q 89

Query: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKI----LLTEPPMNPTK 117
            +RS  Q   P +  ++ NW  +E + +Y F     L  + N  +    ++ E       
Sbjct: 90  TIRS--QSKSPFDGTLLTNWDYVEDMLEYTFHH---LGVSGNNGVSNPLIINERLACLQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXX-XXXXXXXXXTHIVPVYESVVLGH 176
            R    +++FE +D   V   I ++ + Y                 T ++P+     +  
Sbjct: 145 QRNSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGILS 204

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
             +R++  G   T  L  LL+ +   F          Q+ E  CY S D
Sbjct: 205 ECKRINWGGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 62/143 (43%), Gaps = 28/143 (19%)

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVRSALYKAIVLS 303
           + +  ER   PE LF+P +   +Q G+ EL        F +         S +   + ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PG+ +R+ KE  +        +  +  DP+ LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 359 VLASIMADKDHMWLSKQEWQESG 381
            LA+   D  +  ++++E++E G
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYG 734

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 97/234 (41%), Gaps = 13/234 (5%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PI +D G+  +K G   ++ P   FP+ + R   R   R  +T    DI + D+A  VR+
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDRRLNRT-MTFIGNDISL-DQA--VRA 94

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTS-NGKILLTEPPMNPTKNREKMCE 124
             Q   P +  ++ NW  ++ + +Y F     L     +  ++ +E        R +  +
Sbjct: 95  --QSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQWYQ 152

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLGHLTRRLD 182
           ++FE ++       I    A +A                 T+++P+   V      +R++
Sbjct: 153 LLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECKRIN 212

Query: 183 VAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLA 233
             G     ++ +LLS +  Y   +  D +  +++    CYVS  Y  D+D  L 
Sbjct: 213 WGGNHAVSYMNNLLSLKYPYFPTKLTDLQ-YQKLYHDYCYVSPDYSADIDKYLT 265

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S ++ +   + +  ER   PE LFQP +   +Q G+ EL        F +  +      
Sbjct: 598 DSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTA 657

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
             +   I LSGG++  PGL +R+ KE 
Sbjct: 658 EDMANNIWLSGGNAKVPGLKNRIVKEF 684

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 91/232 (39%), Gaps = 23/232 (9%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65
           PI +D G+  V+ G      P   FP+ + R   R   +A+ T        G +AS +R+
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDR---KASRTYTFVGRDTGLDAS-IRT 97

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNG----KILLTEPPMNPTKNREK 121
             Q   P +  ++ NW  ++ +  Y F     L     G     ++LTE        R  
Sbjct: 98  --QSRSPFDGPMVTNWDYVDDMLAYTFHH---LGVRGGGGVPNAVVLTERLATLQSQRAN 152

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVLG 175
             E+++E Y+   V   I ++ + Y +      GL            T +VPV +   + 
Sbjct: 153 WYELLYEAYNLQEVTFGIDSLFSFYGERGPGSTGL----VVSSGNEDTCVVPVVDGRGVV 208

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
              +R++  G+    +L  LL+ +   F           I  + CYV+ D +
Sbjct: 209 SEAKRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +  ++Q G+ EL        FD+ + A     
Sbjct: 599 DSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATC 658

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
             + K + ++GG++  PG+  R+ +E 
Sbjct: 659 EKMAKNVFITGGNTKLPGIRERIVREF 685

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 51/243 (20%), Positives = 89/243 (36%), Gaps = 23/243 (9%)

Query: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64
           +PI +D G+  V+ G   +  P   F + + R   R   R           +G++ +  +
Sbjct: 37  TPIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYT-------FVGNDTNLDQ 89

Query: 65  SY-LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKI----LLTEPPMNPTKNR 119
           S   Q   P +  +I NW  ++ +  Y F     L    NG +    L+TE        R
Sbjct: 90  SIRTQSKSPFDGSMITNWDYVDDILAYTFHH---LDVRGNGGVPNPVLITERMAALQSQR 146

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLGHL 177
               E++FE Y+   V   I ++ + Y +                T ++PV     +   
Sbjct: 147 SNWYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTE 206

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT 237
            +R++  G+    +L  LLS +   F           +    CY S      T    E +
Sbjct: 207 AKRINWGGQQSVGYLNGLLSLKYPYFPTKLVNNQFESMYRDFCYFS------TNFEEEIS 260

Query: 238 TLV 240
           TL+
Sbjct: 261 TLL 263

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELL-------FDTVQSADVDVR 293
           +S  + +   + +  ER   PE +FQP +  ++Q G+ EL        F + +    ++ 
Sbjct: 594 DSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEIS 653

Query: 294 SALYKAIVLSGGSSMYPGLPSRLEKEL 320
             + K I ++GG++  PG+  R+ +E 
Sbjct: 654 KMMAKNIFITGGNAKLPGIRERVVREF 680

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 67/353 (18%), Positives = 138/353 (39%), Gaps = 52/353 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIM--IGDEASEVR 64
           +V+  GT     G +    P    PS      L+ ++ + +     D+M  + DE +E  
Sbjct: 9   VVIHNGTSTTIAGFSNSEIPKCIIPS----SYLKKKDGSFVFGTF-DMMDSLEDEGAESD 63

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNR----- 119
            +  +   +  G+  NW  +E  W+Y F +Q+K   T     +L   P + +KN      
Sbjct: 64  IFTIVDSQL--GVPYNWEALEKQWEYIFEKQLKCDPTE--LPVLITIPSSISKNEDIENK 119

Query: 120 --EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGH- 176
             E+ C++ FEK+    + +  +++      G             + + P+ + V++ + 
Sbjct: 120 VIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVDGVIIKNG 179

Query: 177 --------------LTRRLDVAGRDVTRHLID----LLSRRGY--AFNRTADFETVRQIK 216
                         + ++      D+   + +     +S   +   F +T    T ++++
Sbjct: 180 IVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQ 239

Query: 217 EKLCYVSYDLDLDTKLARETT---------TLVESYELPDGRTIKV-GQERFEAPECLFQ 266
           +   Y    L L  +L  + +         ++ + Y     +T+    +E ++  E LFQ
Sbjct: 240 DVEKYYEEQLRLQAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQ 299

Query: 267 PGLVDVE---QPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRL 316
           P L   +     G+GEL++ ++ SA +    A   A    GGSS   G  S +
Sbjct: 300 PQLASEQYNRDDGLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 86/217 (39%), Gaps = 22/217 (10%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFF---EQMKLPTTSNGKILLTEPPMNPTKNREKMC 123
           L +  P  + + +  +D+  L++YA     E +        K++L  P +    + E + 
Sbjct: 406 LNLDSPYYSSLPELLSDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLY 465

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLGHLTRRLD 182
            ++ ++  F  V +  +++ A Y  G+             T I  V E  VL +   +LD
Sbjct: 466 RILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLD 525

Query: 183 VAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL---- 232
             G D+TR     L    + F     + T  +    Q+K+   Y ++ D ++  +L    
Sbjct: 526 YGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFV 583

Query: 233 ARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGL 269
            R    + E YE       KV  E   AP  LF P +
Sbjct: 584 KRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/241 (16%), Positives = 97/241 (40%), Gaps = 24/241 (9%)

Query: 83  DMELLWD--YAFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQ 140
           D E LW   Y  +    +   S+ K+++ E  + P   +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRG 200
            ++  ++ G+              +VP+ +  +L + +   + AG+ +  +L ++L    
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPG- 155

Query: 201 YAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQERFEA 260
                                   D+ +   +A E     +  E+   + ++ G  +   
Sbjct: 156 ---------------------TDLDILVPQIMACEGDKDFQYREISITKEVRNGFLKKTI 194

Query: 261 PECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
                 P   D ++  + +++  T++   VDV+  ++  ++++G +S  PG   +L KE+
Sbjct: 195 GHFDEDPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPGFKMKLLKEV 254

Query: 321 K 321
           K
Sbjct: 255 K 255

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/129 (17%), Positives = 55/129 (42%), Gaps = 4/129 (3%)

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNR---EKMCEVMFEKYD 131
           NG+  NW  ++  W+Y + E +K   +    +++T P  N   +    +K  E+ FE ++
Sbjct: 78  NGLPYNWDALKEQWEYIYREVLKC-NSDEYPLVITIPSANKDVDEIILKKYFELAFETFN 136

Query: 132 FGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTRH 191
              + + I+ +    + G              ++ P+ +  V+ H   +    G  +   
Sbjct: 137 VPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFLDFQ 196

Query: 192 LIDLLSRRG 200
           ++++L  +G
Sbjct: 197 IVNILQEKG 205

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/98 (15%), Positives = 42/98 (42%)

Query: 91  AFFEQMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL 150
           ++F  + +  +   KI+++EP       ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 XXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDV 188
                       T ++P+++  +L   +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/223 (18%), Positives = 89/223 (39%), Gaps = 40/223 (17%)

Query: 105 KILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH 164
           KI++ E  +     ++++C V+ ++     V      ++A  A G+            T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 165 IVPVYESVVLGHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRTADFET-----VRQIKEK 218
           + P+ +               R + +H+ I  +  +      ++ FE      VR IK  
Sbjct: 121 VAPIMDM--------------RILEQHMGISKIGAKWIGSKLSSTFEIDGEKIVRMIK-- 164

Query: 219 LCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMG 278
                    LDT +       +E  ++ D   I     + + PEC       D+++  + 
Sbjct: 165 ---------LDTDINCNGVQ-IEWRDIEDCMEILWNINK-QDPEC-------DIDEFPII 206

Query: 279 ELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELK 321
            L+ ++++   +DV+S + + +++ GG S   GL  RL + L+
Sbjct: 207 SLVLESIKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENLR 249

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 65/165 (39%), Gaps = 18/165 (10%)

Query: 57  GDEASE-VRSYLQISYPMENGIIKNWT-----------DMELLWDYAFFEQMKLPTT--- 101
           G+EA+  + S+  + YP   G     +           D++ L +Y   +Q K+  T   
Sbjct: 297 GEEATRCLPSHFTLRYPFARGSFNVESPYYMSFQELLGDVQSLLEYCL-KQEKIDVTKQQ 355

Query: 102 -SNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX- 159
            +N KI+L  P +      E    ++  +  F  V +  +++   Y  G+          
Sbjct: 356 FANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAGISNSTCVVDIG 415

Query: 160 XXXTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 204
              T I  V E  VLG+    LD  G D+TR     L +  + ++
Sbjct: 416 ATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYD 460

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 78/202 (38%), Gaps = 19/202 (9%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIV------GRPILRAEERANITTPLKDIMIGDEA 60
           IV+ QGT     G    + P    PS         + I    +  +I T L+D     + 
Sbjct: 13  IVIQQGTNTTIAGFNNSDLPQCVIPSTYIYDKQEDKMIFGLYDMLDIATSLEDA----DR 68

Query: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNR- 119
            EV + L      +NGI  NW  +E  W+Y F + ++  +     +++T P M    +  
Sbjct: 69  YEVFTILD-----KNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGE 122

Query: 120 --EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHL 177
             EK   ++FE++ F    + ++ +    + G               + P+ +  V+ + 
Sbjct: 123 VLEKYFSLVFERFKFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNA 182

Query: 178 TRRLDVAGRDVTRHLIDLLSRR 199
                  G  +   +I+ L ++
Sbjct: 183 VLSSKYGGAFLDYQIIETLQKK 204

>KLTH0D08624g Chr4 (722066..723364) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q05123 Saccharomyces cerevisiae YMR033W ARP9
           Actin-related protein
          Length = 432

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 97/234 (41%), Gaps = 41/234 (17%)

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG-LXXXXXXXXXXXXTHIVPVYESVVLGHLT 178
           E + + +FE+           A+ + YA G L            T ++P+ + + LGHL 
Sbjct: 98  ETIAQFVFEQLQINNFMFLPSALASSYALGSLQNCVVIDIHTNGTDVIPILDYIQLGHLA 157

Query: 179 RRLDVAGRDVTRHLIDLLSR----RGYAFNRTADFETVRQIKEKLCYVSYD-------LD 227
            +++  G  + + L  LL +    +     +++ FE + +  +K   +++        LD
Sbjct: 158 VKVEHGGSQIDQELAKLLPQWTPEQIEDLKKSSIFEVLSEDAKKSSSLNFKHGEDEGALD 217

Query: 228 LDTKLA--RETTTLVESYELP-------------------DGRTIKVGQERFEAPECLFQ 266
           +   +   R+T  ++E  E                      G+ I VG++RF+  E L  
Sbjct: 218 VAALVTSDRDTREILEEREKNKDKHNVENSEQENNVFVDRHGKQIIVGKQRFKGCESL-- 275

Query: 267 PGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKEL 320
             + ++ +  +G +L    Q  D     A+++ I++ GG++   G    L ++L
Sbjct: 276 --VAEISKT-VGRVL---SQIDDFHKLRAMWENILVVGGTTSISGFKEALLQKL 323

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 57/301 (18%), Positives = 106/301 (35%), Gaps = 60/301 (19%)

Query: 72  PMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKIL---LTEPPMNPTKNR-------EK 121
           P+ENG+I N    +    Y +   +K     N        T  P+    N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLGHLTRR 180
           +   +FEK    G+ +   ++ A Y+   L            T IVP+ +   + HL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL----SRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKL---- 232
           L+  G  +   L  LL     ++     ++  FE + + ++      ++  + T      
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 233 --------------ARETTTLVESYE-------LP------------DGRTIKVGQERFE 259
                          ++T  ++   E       LP            +G  IK+G++RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 260 APECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKE 319
             + L Q     V             Q  D+  + A+++ IV+ G +S+  G    L  +
Sbjct: 306 GCDELIQKISTRVGHT--------INQLEDLSKQRAIWENIVIVGNTSLITGFKEALLNQ 357

Query: 320 L 320
           L
Sbjct: 358 L 358

>KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} similar
           to uniprot|P36016 Saccharomyces cerevisiae YKL073W LHS1
           Molecular chaperone of the endoplasmic reticulum lumen
           involved in polypeptide translocation and folding member
           of the Hsp70 family localizes to the lumen of the ER
           regulated by the unfolded protein response pathway
          Length = 863

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 73/168 (43%), Gaps = 19/168 (11%)

Query: 183 VAGRDVTRHLIDLLSRRGYAFN---RTADFETVRQIKEKLCYVSYDLDLDTKLARETTTL 239
           ++G  ++  ++DLL       N   RT  FE+    K KL   +    L      + +  
Sbjct: 264 LSGSVLSLAIVDLLENDFLESNPNIRTEQFESDASAKAKLVQAAEKAKLVLSANSDASIS 323

Query: 240 VES--YELPDGRTIKVGQ-ERF--EAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRS 294
           +ES  ++L    TI   + E F  E    + +P L  +E P  G+ L       D+D   
Sbjct: 324 IESLYHDLDFKTTITRAKFEEFVAELQSVVIEPILSTLESPLNGKAL----NVKDLD--- 376

Query: 295 ALYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVR 342
               +++L+GGS+  P +  +LE  L     ++ + +D + ++   +R
Sbjct: 377 ----SVILTGGSTRVPFVKKQLENHLGASLISKNVNSDESAVNGAAIR 420

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 47/115 (40%), Gaps = 4/115 (3%)

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPT---KNREKMCEVMFEKY 130
           ENG+  NW  +E  W Y F  ++K   +    +++T P M      +  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCK-SDEFPLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 131 DFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAG 185
           +   + V I+ +    + G              ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

>ADL356C Chr4 complement(81526..82818,82950..83051) [1395 bp, 464
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YML126C (ERG13); 1-intron
          Length = 464

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 74/197 (37%), Gaps = 12/197 (6%)

Query: 83  DMELLWDYAFFE--QMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQ 140
           ++   +DY  F     KL T S G++L  +   NP    E   ++    Y+       I+
Sbjct: 258 NVATFFDYNVFHVPTCKLVTKSYGRLLYNDFRANPELYPEVSADLATLDYEASLADKNIE 317

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTR-HLIDLLSRR 199
                 A+ L            T+   +Y   V   L   L   G D  +   I L S  
Sbjct: 318 KTFVGLAKPLHKARVEPSLVVPTNTGNMYTGSVYAALASLLYYVGNDALQGKRIGLFS-- 375

Query: 200 GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQERFE 259
            Y     A   +VR + + + +++++L LDTKL    T   E YE           ++  
Sbjct: 376 -YGSGLAASLFSVRVLGD-IKHITHNLALDTKLQNRKTETPEDYEKALALREAAHLQKAY 433

Query: 260 APECLFQPGLVDVEQPG 276
            P+     G +D+ QPG
Sbjct: 434 TPQ-----GSLDLLQPG 445

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 65/173 (37%), Gaps = 17/173 (9%)

Query: 105 KILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 163
           K +L  P +    + E+M  ++  +  F  V +  +++   Y  G+             T
Sbjct: 382 KAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASET 441

Query: 164 HIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFN-----RTADFETVRQIKEK 218
            +  + E VVL +    L+  G D+TR    LL    + +        A +     +K++
Sbjct: 442 SVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVESIAGWNIAETLKKQ 501

Query: 219 LCYVSYDLDLDTKLA----RETTTLVESYELPDGRTIKVGQERFEAPECLFQP 267
           +  +  D D+  +L+    R      E YE       K   E   AP  LF P
Sbjct: 502 IVTLQ-DADVTVQLSNFMKRVFNEPTEKYEF------KTFDEVMLAPLALFAP 547

>SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp,
           464 aa] {ON} highly similar to uniprot|P54839
           Saccharomyces cerevisiae YML126C ERG13
           3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase,
           catalyzes the formation of HMG-CoA from acetyl-CoA and
           acetoacetyl-CoA; involved in the second step in
           mevalonate biosynthesis
          Length = 464

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 77/198 (38%), Gaps = 14/198 (7%)

Query: 83  DMELLWDYAFFE--QMKLPTTSNGKILLTEPPMNPTKNREKMCEVMFEKYDFGGVYVAIQ 140
           D+   +DY  F     KL T S G++L  +   NP    E   E+   +Y+       I+
Sbjct: 258 DVAKFFDYNVFHVPTCKLVTKSYGRLLYNDFRANPQLYPEVDAELAKAEYNASLTDKNIE 317

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLGHLTRRLDVAGRDVTR-HLIDLLSRR 199
                 A+ L            T+   +Y   V   L   L   G D  +   I L S  
Sbjct: 318 KTFVGVAKPLHKDRVAPSLIVPTNTGNMYTGSVYSSLASLLFFVGSDALQGKRIGLFS-- 375

Query: 200 GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPDGRTIKVGQERFE 259
            Y     A   + + + + + Y++  LDLD KL    T   E YE    + I++ ++   
Sbjct: 376 -YGSGLAASLFSCKVVGD-IKYITDVLDLDNKLNGRKTETPEDYE----KAIQLREDAHL 429

Query: 260 APECLFQP-GLVDVEQPG 276
             +  F P G +++ QPG
Sbjct: 430 QKQ--FAPKGSIELLQPG 445

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/132 (20%), Positives = 56/132 (42%), Gaps = 5/132 (3%)

Query: 58  DEASEVRSYLQISYPMEN-GIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPT 116
           D  +E RS  ++   M++ G+  NW  +EL W Y +  Q+K+ +     +++T P  N  
Sbjct: 56  DATAEKRSDDEVYTLMDSQGLPYNWEALELQWRYMYETQLKV-SPEELPLVITMPATNGK 114

Query: 117 KNR---EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVV 173
            +    E+  E+ F+K       + I+ +    + G              ++ P+ + +V
Sbjct: 115 PDMSILERYYELAFDKLKVPVFQIVIEPLAIALSMGKSSAFVIDMGASGCNVTPIIDGIV 174

Query: 174 LGHLTRRLDVAG 185
           + +   R    G
Sbjct: 175 VKNAVVRSKFGG 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,296,177
Number of extensions: 1654967
Number of successful extensions: 3964
Number of sequences better than 10.0: 167
Number of HSP's gapped: 3618
Number of HSP's successfully gapped: 248
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)