Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C035403.160ON51851827740.0
NDAI0G028903.160ON53653314380.0
Skud_4.2213.160ON53153613251e-179
Suva_4.2193.160ON53153513151e-177
Kpol_479.263.160ON51751813031e-175
YDL030W (PRP9)3.160ON53053312971e-174
TDEL0D046203.160ON51652712951e-174
Smik_4.2053.160ON53153312801e-172
ZYRO0B04950g3.160ON50651912311e-165
KAFR0C010503.160ON50651312171e-163
TPHA0A009103.160ON52752611081e-146
SAKL0C08800g3.160ON60153810921e-142
KLTH0C08888g3.160ON50651810641e-139
Ecym_35493.160ON53254110601e-139
CAGL0K01573g3.160ON51653210481e-137
Kwal_56.227993.160ON53151910451e-136
KNAG0K011203.160ON5275359811e-127
AEL085W3.160ON5275349531e-123
KLLA0F24662g3.160ON5305367475e-92
TBLA0B016003.160ON4863952132e-17
ABR234C8.11ON17552780.29
NCAS0E037507.310ON1276142780.69
SAKL0B00704g8.11ON16962740.84
Kwal_14.10648.11ON16255730.96
NDAI0C065808.11ON16988731.1
NCAS0E019307.185ON104782751.6
Ecym_15318.11ON17154721.8
TPHA0J007308.260ON304662751.8
KLTH0G19096g8.11ON15954702.4
Skud_2.2313.353ON36375705.4
NCAS0A101603.214ON33944696.7
Smik_12.1348.11ON16668676.9
AGL156W8.359ON91065697.3
YLR074C (BUD20)8.11ON16659677.5
CAGL0K12804g8.11ON17262677.7
KLTH0H15576g2.389ON486132697.7
KLTH0F10186g2.359ON18657677.8
TBLA0B084203.75ON14664659.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03540
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...  1073   0.0  
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   558   0.0  
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   514   e-179
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   511   e-177
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   506   e-175
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   504   e-174
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   503   e-174
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   497   e-172
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   478   e-165
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   473   e-163
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   431   e-146
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   425   e-142
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   414   e-139
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   412   e-139
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   408   e-137
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   407   e-136
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   382   e-127
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   371   e-123
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   292   5e-92
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    87   2e-17
ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON} Sy...    35   0.29 
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    35   0.69 
SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly si...    33   0.84 
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    33   0.96 
NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {...    33   1.1  
NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {...    33   1.6  
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    32   1.8  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...    33   1.8  
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    32   2.4  
Skud_2.231 Chr2 complement(419081..420172) [1092 bp, 363 aa] {ON...    32   5.4  
NCAS0A10160 Chr1 (2025950..2026969) [1020 bp, 339 aa] {ON} Anc_3...    31   6.7  
Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {O...    30   6.9  
AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic ho...    31   7.3  
YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}  ...    30   7.5  
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    30   7.7  
KLTH0H15576g Chr8 (1346402..1347862) [1461 bp, 486 aa] {ON} simi...    31   7.7  
KLTH0F10186g Chr6 complement(878318..878878) [561 bp, 186 aa] {O...    30   7.8  
TBLA0B08420 Chr2 complement(2013679..2014119) [441 bp, 146 aa] {...    30   9.2  

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MVPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNK 60
           MVPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNK
Sbjct: 1   MVPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNK 60

Query: 61  IYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNITLETFKTMIQDI 120
           IYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNITLETFKTMIQDI
Sbjct: 61  IYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNITLETFKTMIQDI 120

Query: 121 NAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDF 180
           NAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDF
Sbjct: 121 NAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDF 180

Query: 181 ENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVES 240
           ENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVES
Sbjct: 181 ENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVES 240

Query: 241 FFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKN 300
           FFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKN
Sbjct: 241 FFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKN 300

Query: 301 HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEK 360
           HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEK
Sbjct: 301 HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEK 360

Query: 361 PAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVEY 420
           PAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVEY
Sbjct: 361 PAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVEY 420

Query: 421 PCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQK 480
           PCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQK
Sbjct: 421 PCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQK 480

Query: 481 NSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGLH 518
           NSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGLH
Sbjct: 481 NSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGLH 518

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/533 (53%), Positives = 376/533 (70%), Gaps = 23/533 (4%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSIL--TNLSIDTPAESNKSNNKIY 62
           LEK+R+LLEDLE+IE+AI+ RFQRNPELYY N+ K+S L  +    + P  S  +NNKIY
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIY 65

Query: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKET---VKDDN----ITLETFKT 115
           K KKLKR+RKQ  LQQ EI++F+KDF  +++ L  L +E     K +     + +E FK 
Sbjct: 66  KTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFKD 125

Query: 116 MIQDINA----KKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSRE 171
           ++ +IN     +  +   L IN KI +Y+MFS S+++S P+ ILS R + LDIN  FS E
Sbjct: 126 ILSEINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRASDLDINSIFSLE 185

Query: 172 EQYGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFL 231
           EQYG+Y+    +Y EWLNVVK  D+T LQFLN+L++F D+++Y+  PPMDRKN  YMK+L
Sbjct: 186 EQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPYMKYL 245

Query: 232 ESLCSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESV 291
           +  CSY+ESFF RKY LI+    + +++ +F + I +P E+  KG +CK C KWFKT +V
Sbjct: 246 QRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIKPLENEKKGFFCKTCCKWFKTLTV 305

Query: 292 FVNHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEM 351
           F +H+ G+ HIK+  +R   L +EYK HR+  LL+EE + T EF+E KMA T +ER+ EM
Sbjct: 306 FESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITEM 365

Query: 352 KRLTENYEKPAYSSDEKEGDENNADLE-HDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWL 410
           KRL E  + PAY  +EKEGDENN +L   D  ++     +L GS +MPLGPDGLPMPFWL
Sbjct: 366 KRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPMPFWL 425

Query: 411 YKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQ 470
           YKLQGLDV YPCEICSNQIFKGRR F+KHFT  TH YHLRCLGIEP+  FKG+TKI+EAQ
Sbjct: 426 YKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKIEEAQ 485

Query: 471 KLWVDINSQKNSS----KPMVSSI--ELQVEVEDSVGNVMSKKLYDELKKQGL 517
           +LW   N+ KN +    K  + +I  ++ +EVED  GN+M++K+YDELKKQGL
Sbjct: 486 RLW---NNMKNDTIMGDKKFIETIPDKMAIEVEDKEGNIMTQKVYDELKKQGL 535

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  514 bits (1325), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 268/536 (50%), Positives = 351/536 (65%), Gaps = 30/536 (5%)

Query: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYK 63
           +LE +R+LLEDLE+IE+AIA R QRNPELYY  I + S      +  P  S  + NKIYK
Sbjct: 3   VLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQE-SCKVFPDVKLPKPSLIAENKIYK 61

Query: 64  RKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK-ETVKDDNITLETFKTMIQDINA 122
            KK+KR+RKQ +LQQ EI++FL+D+ E+++   +    E V++D+  ++ F+  +Q++  
Sbjct: 62  LKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELEE 121

Query: 123 KKSSSE---VLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179
           +  + +    L IN   ++YA+FS+S   SK  NILS+R   LD+NK F+R+EQYG+YM+
Sbjct: 122 RLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYME 181

Query: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239
            + F+  WLNV++  D +LLQF N+L +F+D++K+L  PPMDRKN+RYM FL  L  Y+E
Sbjct: 182 LDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYLE 241

Query: 240 SFFFRKYALINKSAITSQIESQF-TEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPG 298
           +FFF+ Y L +K  + + IES F   Y K       KG YC  C+KWFKT  VF NH+ G
Sbjct: 242 TFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLSG 301

Query: 299 KNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENY 358
           KNH KNE +RKN + SEYKLHR+   L++EF  T  FIE K+A TA+ERM EM  LTE Y
Sbjct: 302 KNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKY 361

Query: 359 EKPAYSSDEKEGDEN-----NADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKL 413
           E PAY   E EGD         DL  ++Q  GK       SFDMPLGPDGLPMP+WLYKL
Sbjct: 362 EAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGK-------SFDMPLGPDGLPMPYWLYKL 414

Query: 414 QGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLW 473
            GLD EYPCEIC+N+++ GRR FE+HF    H YHLRCLGIEPS  FKGITKI E QKLW
Sbjct: 415 HGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLW 474

Query: 474 VDINSQKNSSKPMVSSIELQVEVEDSV------------GNVMSKKLYDELKKQGL 517
            DI +Q  S      ++  +   +  +            GNVMSKK+YDELKKQGL
Sbjct: 475 KDIQNQHRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGL 530

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  511 bits (1315), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 277/535 (51%), Positives = 360/535 (67%), Gaps = 28/535 (5%)

Query: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYK 63
            LE KR+LLEDLE+IE+AI +R QRNPELYY  I +   L    I  P  S  S NKIYK
Sbjct: 3   FLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFP-DIKQPRPSLVSENKIYK 61

Query: 64  RKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLG-KETVKDDNITLETFKTMIQDINA 122
            KK KR+RKQ +LQQ EI++FL+D++E++R++ ++   + V++D   L +F+  +Q++  
Sbjct: 62  LKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELEE 121

Query: 123 KKSSSEV---LPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179
           +  + +    L IN K  RYA+FS+S   SK  NILS+R   +D+N+ F+R+EQYG+YM+
Sbjct: 122 ELKNEQENYQLDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYME 181

Query: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239
            E F+  WLNV+K GD +LLQF + + +F+D++KYL  PPMDRKN+RYM FL  L  YVE
Sbjct: 182 LEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYVE 241

Query: 240 SFFFRKYALINKSAITSQIESQF-TEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPG 298
           SFF++ YAL  K  +   I+S F   Y +   +   KG YC  C KWFKT++VF NHIPG
Sbjct: 242 SFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIPG 301

Query: 299 KNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENY 358
           KNH KNE +RK  + SEYKLHR+  LL++E   T  F+E K+A TA+ERM EM  LT+ Y
Sbjct: 302 KNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKY 361

Query: 359 EKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDV 418
           E PAY + E+E D      + D++   K   L   SFDMPLGPDGLPMP+WLYKL GLD 
Sbjct: 362 EAPAYDATEREDDGKGGGEQKDDKLQEK--HLFGKSFDMPLGPDGLPMPYWLYKLHGLDR 419

Query: 419 EYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINS 478
           EYPCEIC+N+I+ GRR FE+HF   TH YHLRCLGIEPSS+FKGITKI EAQ+LW +  S
Sbjct: 420 EYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQS 479

Query: 479 QKNSSKPMVSSIE----------------LQVEVEDSVGNVMSKKLYDELKKQGL 517
           Q       VSSI                 +++E ED  GNVMSKK+YDELKKQGL
Sbjct: 480 QPQ----FVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGL 530

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  506 bits (1303), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/518 (49%), Positives = 356/518 (68%), Gaps = 10/518 (1%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDT-PAESNKSNNKIYK 63
           +E  R+LLED+EVIEDAI+KRFQRNPE+YY    +L+ +     +T    SN+S+N+IYK
Sbjct: 4   IENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNRIYK 63

Query: 64  RKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNITLETFKTMIQDINAK 123
            +K KR RKQ +LQQ E N F+KD   +   + ++   T + + I L+ +  ++  I+ K
Sbjct: 64  SRKHKRDRKQVILQQYETNEFIKDIRSKLNEIREINV-TKESNGIKLDRYVELMGSIDTK 122

Query: 124 K----SSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179
                S ++ LPIN+ I +Y+MF++S S++KPNNILS +C  L+IN YF+R+EQYG+Y++
Sbjct: 123 YEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYGEYLE 182

Query: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239
            E FY  WLNV+K+ + ++LQ+++++  F+D  +Y+  PPMDRKN RY+KFLE + +Y+ 
Sbjct: 183 LERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIETYLT 242

Query: 240 SFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGK 299
           SF  + Y LI+       ++  +     +      KG +C+ C KWFKTESVF NH+PGK
Sbjct: 243 SFIKKTYVLIDWEEEAEVLKYDYEIECTKSLMKQGKGNFCRLCGKWFKTESVFENHLPGK 302

Query: 300 NHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYE 359
           NH+KN K+  +    E+K+HR    L +EF+ET  F+E K+A T+DER++E+ R+TE YE
Sbjct: 303 NHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDRMTEVYE 362

Query: 360 KPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVE 419
           +PAYS  E E  + N   E+  + S     ++ GSFDMPLGPDGLPMP+WLYKLQGLD+ 
Sbjct: 363 RPAYSVGEPEEGKPN---ENSSKTSSNKNDIINGSFDMPLGPDGLPMPYWLYKLQGLDMT 419

Query: 420 YPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQ 479
           Y CEIC+N I+KGRR FEKHF+  TH YHLRCLGIEPSS FKGI  IKEA  LW  +N +
Sbjct: 420 YKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLWGTMNVK 479

Query: 480 KNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
             SSK   S+   ++EVED  GNV+SK++Y+ELKKQGL
Sbjct: 480 DKSSKHAESN-NYEIEVEDKEGNVLSKEIYEELKKQGL 516

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  504 bits (1297), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 276/533 (51%), Positives = 364/533 (68%), Gaps = 25/533 (4%)

Query: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLS-ILTNLSIDTPAESNKSNNKIY 62
           LLE +R+LLE++E+IE+AIA+R QRNPELYY  I + S +  +  +  P  S  + NKIY
Sbjct: 3   LLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKL--PRSSLIAENKIY 60

Query: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK-ETVKDDNITLETFKTMIQDIN 121
           K KK+KR RKQ +LQQ EINIFL+D++E+++    + + E  ++D+  L  F+  +Q + 
Sbjct: 61  KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120

Query: 122 AKKSSSEV---LPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYM 178
            +  + +    L IN K  +YA+FS+S   S+  NILS R   LD+N+ F+R+EQYG+YM
Sbjct: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180

Query: 179 DFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYV 238
           + E F+  WLNV+K GD +LLQFL++L +F+D+EKYL  PPMDRKN+RYM FL  L  YV
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV 240

Query: 239 ESFFFRKYALINKSAITSQIESQFTE-YIKEPTEHSVKGQYCKACAKWFKTESVFVNHIP 297
           E+FFF+ YAL++ +A+ + I+S F   Y +       KG YC  C++WFKT SVF +H+ 
Sbjct: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 298 GKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTEN 357
           GK H KNE +R+N + SEYKLHR+   L +EF  T  F+E K+A TA+ERM EM  LT+ 
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 358 YEKPAYSSDEKEGDENNADLEHDEQRSGKGQ--GLLEGSFDMPLGPDGLPMPFWLYKLQG 415
           YE PAY S EKEG    A+    EQR G+ Q   L   SFDMPLGPDGLPMP+WLYKL G
Sbjct: 361 YEAPAYDSTEKEG----AEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHG 416

Query: 416 LDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVD 475
           LD EY CEICSN+++ GRR FE+HF    H YHLRCLGIEPSS+FKGITKIKEAQ+LW +
Sbjct: 417 LDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKN 476

Query: 476 INSQKNSS-------KPMVSSIELQV----EVEDSVGNVMSKKLYDELKKQGL 517
           +  Q   +       KP  S +++      E ED  GNVMSKK+YDELKKQGL
Sbjct: 477 MQGQSQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGL 529

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  503 bits (1295), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 254/527 (48%), Positives = 352/527 (66%), Gaps = 29/527 (5%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYKR 64
           LE +R+ LEDLEVIE +IA RF+RNP LYY  + K +++ ++ + +   +  + N+IYK 
Sbjct: 4   LESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRALIDDIPLSSSITNAYNANRIYKA 63

Query: 65  KKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK-------ETVKDDNITLETFKTMI 117
           K+ KR+RKQFVLQQ EI++FL   +E  R L DLG         +++D+  T E FK  +
Sbjct: 64  KRSKRNRKQFVLQQHEIDLFL---QESMRKLRDLGSLKGPVNTHSLRDEEATFEIFKQNL 120

Query: 118 QDINAK----KSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQ 173
           ++I  K     S S    +N++I+++AMFSA  ++SKP  ILS+    L +N  FSREEQ
Sbjct: 121 EEIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSREEQ 180

Query: 174 YGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLES 233
           YG+Y+D + F+  WLNV+++ + TLLQF ++L  F+D+ +Y+  PPMDRKN RY +FL  
Sbjct: 181 YGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEFLVE 240

Query: 234 LCSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFV 293
           + +Y+E FF +   L+N + +  +I+S+F+  +  P     KG YC AC KWFK  +VF 
Sbjct: 241 ISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLATPLHTGGKGFYCIACCKWFKVPTVFD 300

Query: 294 NHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKR 353
           +H+ GK+H  N  +R   L +EYKLHR+  LL EEF+ T EF E K+A TA+ERM+EM R
Sbjct: 301 SHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEMAR 360

Query: 354 LTENYEKPAYSSDEKE---GDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWL 410
           L  +Y  P Y  DEKE    D N A+L+ +          L GSFD+PLG DGLP+P+WL
Sbjct: 361 LNHDYHAPDYGPDEKEQEDPDSNKAELDKN--------SALGGSFDLPLGADGLPIPYWL 412

Query: 411 YKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQ 470
           YKLQGLDVEY CEIC+NQ +KGRRAFEKHF  PTH +HL+CLGIEPS  FKGIT I+EAQ
Sbjct: 413 YKLQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQ 472

Query: 471 KLWVDINSQKNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
            LW   +S+   ++P     ++ +EVED  GNV+++K+Y ELKKQGL
Sbjct: 473 DLWRQTSSR---NRPQTQK-KIDLEVEDQEGNVLTQKVYQELKKQGL 515

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  497 bits (1280), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/533 (49%), Positives = 353/533 (66%), Gaps = 20/533 (3%)

Query: 2   VPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKI 61
           +  LE +R+LLED+E+IE+AI +R +RNPELYY  I + S +    +  P  S  + NK+
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFP-DVKLPKSSLIAENKL 59

Query: 62  YKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETV-KDDNITLETFKTMIQDI 120
           +K KK+KR+RKQ +LQQ EI++FL+D+ E+++   ++  +   ++D+  L +F   ++ +
Sbjct: 60  FKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQL 119

Query: 121 NAKKSSSE---VLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQY 177
             +  S E    L IN K  +YA+FS+SI  SK  NILS+R   LD+NK F+R+EQYG+Y
Sbjct: 120 EDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEY 179

Query: 178 MDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSY 237
           M+ E F+  WLNV K  D +LLQF +++ +F+D++KYL  PPMDRKN+RYM FL  LC Y
Sbjct: 180 MELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKY 239

Query: 238 VESFFFRKYALINKSAITSQIESQFTE-YIKEPTEHSVKGQYCKACAKWFKTESVFVNHI 296
           +E+FFF+ YAL +K  I S I   F + Y K       KG +C  C KWFKT  VF NH+
Sbjct: 240 LETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHL 299

Query: 297 PGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTE 356
            GK H KNE +RK+ + SEYKLHR+   L++EF  T  F+E K+  TA+ER+ EM  LT+
Sbjct: 300 TGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQ 359

Query: 357 NYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGL 416
            YE PAY   +K+GD+     + D+Q   K       SFDMPLGPDGLPMP WLYKL GL
Sbjct: 360 KYEAPAYDPTDKDGDQQKGSDQRDDQLQEK--HFFGKSFDMPLGPDGLPMPHWLYKLHGL 417

Query: 417 DVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDI 476
           D EY CEIC+N+++ GRR FE+HF    H YHLRCLGIEPS  FKGITKI EAQKLW ++
Sbjct: 418 DREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENM 477

Query: 477 NSQKNSSKPMVSSI------------ELQVEVEDSVGNVMSKKLYDELKKQGL 517
             Q  S+  + SS+            EL++E ED  GNVMSKK++DELKKQGL
Sbjct: 478 QKQPQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGL 530

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  478 bits (1231), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 246/519 (47%), Positives = 336/519 (64%), Gaps = 23/519 (4%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYKR 64
           LE +R LLE LE+IEDAI++RF RNPELYY NITK  +L +  I+ P+ +  + N+IYK 
Sbjct: 4   LETRRQLLEGLEIIEDAISQRFGRNPELYYSNITK-QVLIDGGIELPSTTAMAVNRIYKS 62

Query: 65  KKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK----ETVKDDNITLETFKTMIQDI 120
           K+ KRSRKQ V QQ EIN+FL    ++++ L  +      E  +D+ I  + F+  +  I
Sbjct: 63  KRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDKFREAVDQI 122

Query: 121 NAKKSSSE--VLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYM 178
           N+K    E   L IN+ I  + MFSA+ S+S    ILS+    LD+N+ F+R+EQYG  +
Sbjct: 123 NSKYEDQEGLALDINENIVNHEMFSATFSKS---TILSESARDLDLNQIFTRDEQYGDLL 179

Query: 179 DFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYV 238
           D E F+ +WLNV+K  D + LQF ++L+ F+D  +YL  PPMDRKN RY +FL  L  YV
Sbjct: 180 DLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELFQYV 239

Query: 239 ESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPG 298
           E FF + Y L+N + ++ ++ES F EY++ P   S  G YC AC KWFKT +VF +H+ G
Sbjct: 240 EQFFAKVYVLVNSTILSQRMESDFEEYLRMPIYKSNHGLYCVACGKWFKTPTVFQSHLTG 299

Query: 299 KNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENY 358
           K+H  N  +R   L +EYKLHR+  +LQ + + T  F+E KMA T +ERMEEM RL   Y
Sbjct: 300 KHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRLARIY 359

Query: 359 EKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDV 418
           E P Y+ DEKE +E    ++   ++       + G  ++PLG DGLP+P WLYKLQGLDV
Sbjct: 360 EGPDYAPDEKEIEEKEDSVDTPSEKK------MNGGIELPLGLDGLPIPLWLYKLQGLDV 413

Query: 419 EYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINS 478
            Y CEIC NQ ++GRR FE+HFT PTH +HL+CLGIE S  F+ IT I+EAQ LW  I+ 
Sbjct: 414 TYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLWKRISG 473

Query: 479 QKNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
              +S          +EVED  GNVM++++Y+ELKKQGL
Sbjct: 474 NNTTSSR-------DIEVEDEEGNVMTQQVYEELKKQGL 505

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  473 bits (1217), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 255/513 (49%), Positives = 345/513 (67%), Gaps = 11/513 (2%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYKR 64
           LE+KR+L EDLEVIEDAIAKR QRNPELYY+ + KLS     S++ P+  +  NN++YK 
Sbjct: 4   LEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHSLEVPSSIDIKNNRVYKS 63

Query: 65  KKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNITLETFKTMIQDINAKK 124
           KK KRS+KQ V QQ EI +F++D+  +++ L  L K   KD           I  I   K
Sbjct: 64  KKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKR--KDTTQISSDIGDFITSITENK 121

Query: 125 SSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDFENFY 184
           S  +   +  KI  Y+MFSAS ++    +ILS+R A LDIN+ F+R+EQ+G+ MD E F+
Sbjct: 122 SHVKS-SLKDKIDYYSMFSASTTQK---SILSKRAADLDINQTFTRDEQFGECMDLERFH 177

Query: 185 LEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVESFFFR 244
             WL+VVK    +LL F  ++  F+D + YL  P MDRKN RY +F++++  YVESFFF+
Sbjct: 178 NVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISGYVESFFFK 237

Query: 245 KYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKNHIKN 304
           K+ LI+K  + ++++  F  Y+  P  +   G +C AC K FKT+SVF NH+PGK H +N
Sbjct: 238 KFCLIDKEYVNARLQQDFILYLDNPLNNQ-NGFFCVACNKSFKTKSVFDNHLPGKQHKRN 296

Query: 305 EKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEKPAYS 364
             +R+N+L+SEYKL+RF  LL+ EF  T EF E K++ TA+ER EE++RL   Y  P Y 
Sbjct: 297 VDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNNEYNAPVYG 356

Query: 365 SDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVEYPCEI 424
           S+E+E  +   D      ++G  + +L+G F+MPLGPDG+PMPFWLYKLQGLDV Y CEI
Sbjct: 357 SEEQEEGDEEHDEY--ASKNG-NRSILDGLFNMPLGPDGVPMPFWLYKLQGLDVSYYCEI 413

Query: 425 CSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQKNSSK 484
           CSN+ FKGRRAFE+HF   THQYHLRCLGI PS  F GIT I EAQ LW  I S +    
Sbjct: 414 CSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDHIQSTQKKKA 473

Query: 485 PMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
           P    I++ +EVED+ GNV+++K+YD+LK+QGL
Sbjct: 474 PS-GKIDMDIEVEDADGNVLTRKVYDDLKRQGL 505

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  431 bits (1108), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/526 (44%), Positives = 334/526 (63%), Gaps = 16/526 (3%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYKR 64
           +E++R+LLEDLEVIE +I KRFQRNPELYY     L  + +  ID P+++ ++ NKIYK 
Sbjct: 4   IEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPDIDLPSKTVRNTNKIYKT 63

Query: 65  KKLKRSRKQFVLQQQEINIFLKDFEERRRVLLD--LGKETVKDDNITLETFKTMIQDINA 122
           +K KR RKQ +LQQ EIN FL D+  + + L+   L     +D       F+ +++ IN 
Sbjct: 64  RKHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQKLDISEFRDKGADFVKFEELLESINN 123

Query: 123 KKSSSEV-LPINQKI----TRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQY 177
           + ++     P N K+     +YAMFS+SI+ + PNNILS+R   LD+N YFS+EEQYG+ 
Sbjct: 124 EYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQYGEI 183

Query: 178 MDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSY 237
           ++ E FY  WLNVVKT D ++L+++ +L VF+D+++++ + PMDRKN RY+ F+  L  Y
Sbjct: 184 LNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIRILSKY 243

Query: 238 VESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIP 297
            ES+  ++Y L N     ++++  F +Y  +P     KG  C +C KWFK  +V+  H+ 
Sbjct: 244 FESYLEKRYILNNWINFKTELKKSFEKYSIKPIVKEKKGYLCISCGKWFKNSNVYDGHLK 303

Query: 298 GKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTEN 357
           GK H K+   RK  L +EYKLHR    L+ EF E+  ++E K+A T  ER  E+K LT+ 
Sbjct: 304 GKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELKLLTKK 363

Query: 358 YEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLD 417
           YE+PAY+ DE    EN    E D+            SF+MPLGPDG+P+P WLYKLQGLD
Sbjct: 364 YEEPAYNKDEP---ENTDKYEEDDNSMSNAAEDRNKSFNMPLGPDGMPIPLWLYKLQGLD 420

Query: 418 VEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDIN 477
           ++Y CEIC N+ ++GR+A+E HF+  TH  HL  LGI+ S  FKGIT I EA+ LW  ++
Sbjct: 421 IKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSLWSSMH 480

Query: 478 SQKNSSKPMVS------SIELQVEVEDSVGNVMSKKLYDELKKQGL 517
           +   S+    +      ++   +EVEDS GNVMSKK+YDELKKQ L
Sbjct: 481 ASNGSAASFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNL 526

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  425 bits (1092), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/538 (43%), Positives = 336/538 (62%), Gaps = 37/538 (6%)

Query: 4   LLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILT----NLSIDTPAESNKSNN 59
           +LE KR++LE LEVIE+AI++R +RNPELYY    +  ++      L    PA S+ S N
Sbjct: 76  ILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPA-SDISAN 134

Query: 60  KIYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETVKDDNIT----LETFKT 115
           +I+  KK +RSRKQ VLQQ EI+ FL++++  R V    G +  KDD+ +     E  + 
Sbjct: 135 RIHSVKKSRRSRKQIVLQQHEIDRFLEEYQ--REVARLHGIKLDKDDSESAAPDFEQLEK 192

Query: 116 MIQDINAKKS--SSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQ 173
            ++D  ++ +  S  +  ++ +   ++MFS+S S  K  +ILS R   LD+N+ F+R+E 
Sbjct: 193 AVKDAKSRYADESRTLAGVDVESVEHSMFSSSTSTHK--DILSTRGRDLDMNRLFARDEH 250

Query: 174 YGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLES 233
           YG+++  E F+ EWLN+VK G VT LQF+N++ +F+ +  YL  P ++R + +Y  F+ S
Sbjct: 251 YGEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSD-AYLVAPAVNRGSKKYQDFVGS 309

Query: 234 LCSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFV 293
           L  Y+  FF + Y L+N S +  ++ + F EY++ P     KG +C  C +WFK E+V+ 
Sbjct: 310 LLGYMSEFFRKTYPLVNHSTLGRRLAALFDEYLRAPVADETKGLFCIPCGRWFKLETVYK 369

Query: 294 NHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKR 353
           +H+ GK H KN  +    LL+EYKLH++  LL +    T  F+E   ALTADER +E++R
Sbjct: 370 SHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELER 429

Query: 354 LTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGS--FDMPLGPDGLPMPFWLY 411
           L + YE PAYS  E E    +A  E  ++R  +     EG   F++PLGPDG P+P+WLY
Sbjct: 430 LAKEYEAPAYSQHETE----DAAREKQQKREPETD---EGGNPFNLPLGPDGYPIPYWLY 482

Query: 412 KLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQK 471
           KLQGLD+EY CEICSN  +KGRR FEKHF+   H + LRCLGIEPS+ FKGITKI+EA+ 
Sbjct: 483 KLQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEAKD 542

Query: 472 LWVDINSQKNSS------------KPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
           LW  I +   +                 S+ +L++EVED  GNVMS+KLY ELK+QGL
Sbjct: 543 LWARIQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGL 600

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  414 bits (1064), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 222/518 (42%), Positives = 325/518 (62%), Gaps = 23/518 (4%)

Query: 6   EKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLS-IDTPAESNKSNNKIYKR 64
           E  R  LE+LE+IE+A+  R +RNPE++Y NI ++ ++ +    D    S KS NK+Y  
Sbjct: 5   EDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANKVYTV 64

Query: 65  KKLKRSRKQFVLQQQEINIFL----KDFEERRRVLLDLGKETVKDDNITLETFKTMIQDI 120
           KK +RSRKQ + Q+ EI  FL    KD +   RV  D+ +  V  DN ++      I+ I
Sbjct: 65  KKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEFDMSEYRV--DNGSVNKLLEHIERI 122

Query: 121 NAKKSSSEVLPINQKIT-RYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMD 179
                  E+ P + +   +YAMFS+S   +K  NI+S++   LDIN YF+R+EQYG+Y+D
Sbjct: 123 K------EIHPKDDEFGDQYAMFSSSTPSNK--NIISRKAQNLDINSYFTRDEQYGEYLD 174

Query: 180 FENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVE 239
            E F+ +WL+VVK GDVTLLQFL+ +  F D+ +YL  P ++R ++RY +F+ SL  Y+ 
Sbjct: 175 LEPFHQKWLSVVKNGDVTLLQFLSEVEKFTDQ-RYLLQPAVNRNSSRYREFVASLHHYLS 233

Query: 240 SFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGK 299
            +  R Y L++   I ++ +  +   + +P      G +C  C K FKT++V+  H+PGK
Sbjct: 234 DYAARAYPLLSWDLIHAKAQELYHTNVAKPIPSGESGVFCIPCDKRFKTDTVYNAHLPGK 293

Query: 300 NHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYE 359
            H+ N  +  + L  E+ LH F   L  E   T EF+E K+A T +ER +E++RLT+ Y+
Sbjct: 294 RHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERLTDIYD 353

Query: 360 KPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGLDVE 419
            P Y   E+E    +A  + +++   K   +L+ S ++PLGPDG P+P+WLYKLQGLD+E
Sbjct: 354 SPVYGRQEQE----DAQEDENKETEDKEDSVLDSSMNLPLGPDGFPIPYWLYKLQGLDIE 409

Query: 420 YPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINSQ 479
           YPCE+C N ++ GRR F+KHF    H + LR LGIEPS+ FKG+TKI +A++LW  + S 
Sbjct: 410 YPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSHLRS- 468

Query: 480 KNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
             SS  + S  +L+VEVED  GNVMSKK+YDELKKQGL
Sbjct: 469 -TSSGRVSSEGKLEVEVEDEDGNVMSKKVYDELKKQGL 505

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  412 bits (1060), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/541 (42%), Positives = 326/541 (60%), Gaps = 35/541 (6%)

Query: 2   VPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSN--- 58
           + LLE+KR +LE+LE+IEDAI+ R  RNPE++Y  I +LSI+ +   D    SN  N   
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNS---DEKVLSNIPNVDI 57

Query: 59  --NKIYKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETV---KDDNITLETF 113
             N++Y  KK KRSRKQ +LQQ EI+ FL  + +  + L     + V   KD N   E F
Sbjct: 58  TANRVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELF 117

Query: 114 KTMIQDIN---AKKSSSEVL--PINQKITRYAMFSASISESKPNNILSQRCAGLDINKYF 168
           +  IQ I    A++S+SE     +  +  +Y MFS S  + K  +ILS     +DINK F
Sbjct: 118 RDQIQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKK--DILSLEGQSIDINKKF 175

Query: 169 SREEQYGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYM 228
           S EE YG+Y+  + ++ E+LN+VK  +V+LLQF+  L+ F D   +L +PP+DR +  Y 
Sbjct: 176 SWEEHYGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCDH-GHLKNPPVDRNSKIYH 234

Query: 229 KFLESLCSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKT 288
            FLE L  YV SFF   + LIN      +I++ F EY   P E S +G  C AC KWFK 
Sbjct: 235 GFLERLLKYVNSFFESAFPLINHVQFQKRIKNSFVEYTSTPIEDSSRGCLCVACGKWFKA 294

Query: 289 ESVFVNHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERM 348
            +V+ +H+ G+ H+ N K R+ +L+ EY L   F  L +E   T  F+E K A T +ER+
Sbjct: 295 ITVYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERI 354

Query: 349 EEMKRLTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPF 408
           +E+ +L + Y   AY   E+E  + +  +   ++        L    ++PLGPDG P+P+
Sbjct: 355 QELAKLRDAYNANAYGDHEREDSQEDLSVSSSKETPPDDNNPL----NLPLGPDGYPIPY 410

Query: 409 WLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKE 468
           WLYKLQGLD+EY CEIC N ++KGRR FE+HF    H Y LRCLGIEP+S FKGI+KI +
Sbjct: 411 WLYKLQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISD 470

Query: 469 AQKLWVDI--NSQKN----------SSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQG 516
           AQ LW  +  NS  N          SS+ +V++ +L++E+ED  GNVMS ++Y++LKKQG
Sbjct: 471 AQILWSRLKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQG 530

Query: 517 L 517
           L
Sbjct: 531 L 531

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  408 bits (1048), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 226/532 (42%), Positives = 320/532 (60%), Gaps = 38/532 (7%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKIYKR 64
           L+  R+LLED+EVIEDAI+ RFQRNPELYYD    L  + +       + ++  NKIYK 
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDDIPKLGLDDDRMVNKIYKA 62

Query: 65  KKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKE------TVKDDNITLETFKTMIQ 118
           +K KR+ KQ   QQ EIN FL D  ++ + +L +  +        KD     E  K ++ 
Sbjct: 63  RKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDGLKYKDSECKFELLKKLLG 122

Query: 119 DIN----------AKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYF 168
           D            +K +SS +L I++ I RY M   +        ++S+RC+ LDIN  F
Sbjct: 123 DEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGN------GKLVSERCSLLDINTIF 176

Query: 169 SREEQYGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYM 228
            ++EQ G  +DFE  Y  WLN+VK G +T  +F++ L  F+D++KYL  P MDRK   Y 
Sbjct: 177 QKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKTKGYC 236

Query: 229 KFLESLCSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKT 288
           +F+   C +VE+ +F++  L+N+  I  ++   F  ++ +         YC  C K F +
Sbjct: 237 EFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAIITESGIYYCLYCDKMFNS 296

Query: 289 ESVFVNHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERM 348
             ++ +H  GK H K+     ++  +E+KLH +   ++EEF+ T E+++ KMA T  ER+
Sbjct: 297 AHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERL 356

Query: 349 EEMKRLTENYEKPAYSSDEKEGD---ENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLP 405
           EEM++LT+ Y +P Y   EKEGD   +N+     DE +   G G      DMPLGPDGLP
Sbjct: 357 EEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGLGE-----DMPLGPDGLP 411

Query: 406 MPFWLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITK 465
           +P+WLYKLQGLDV   CEIC NQ++KG + F+KHF+ PTH YHL+CLGIEPSS F+GITK
Sbjct: 412 IPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITK 471

Query: 466 IKEAQKLWVDINSQKNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
           IKEAQ LW  +  Q+N+++      EL  EVED  GNVMSK +Y+ELKKQGL
Sbjct: 472 IKEAQALWKQM--QRNTTQ------ELAEEVEDKEGNVMSKDIYEELKKQGL 515

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  407 bits (1045), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 218/519 (42%), Positives = 322/519 (62%), Gaps = 24/519 (4%)

Query: 6   EKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILT-NLSIDTPAESNKSNNKIYKR 64
           E  R+ LE+LE+IE AIA R +RNPE++Y N+ +L ++T +  +D  AE  K++NKIY  
Sbjct: 29  ESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKIYSV 88

Query: 65  KKLKRSRKQFVLQQQEINIFLKDF----EERRRVLLDLGKETVKDDNITLETFKTMIQDI 120
           +K KR+RKQ + Q+ EI +FL+++    E  R V  DL +  V D ++  + F   I+ I
Sbjct: 89  RKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRYQVTDGSV--DGFLEHIETI 146

Query: 121 NAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQYMDF 180
           N++        I+  +  Y MFS S +  +  +ILS++   LDIN  F+REEQYG+++D 
Sbjct: 147 NSEVPDD----IDDSMENYTMFSNSTAARR--DILSKKARALDINAKFTREEQYGEFLDL 200

Query: 181 ENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVES 240
           E F+ +WL+VVK G V+LLQFL  +  F  + ++L  P ++R + RY  F+++L  Y++ 
Sbjct: 201 EPFHQQWLSVVKDGSVSLLQFLGEIEKFTTK-RFLLTPAVNRGSARYQDFVKALLCYLQD 259

Query: 241 FFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKN 300
           +  R Y L +   I ++I++ + +Y   P E    G +C  C K FK E+V++ H+ GK 
Sbjct: 260 YLMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLAHLTGKK 319

Query: 301 HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTENYEK 360
           HI N  ++   L  EYKLH     L +E   T EF+E K+A T +ER +EM+RLT  YE 
Sbjct: 320 HINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERLTTVYES 379

Query: 361 PAYSSDEKEGDENNADLEHDEQRSGKGQ--GLLEGSFDMPLGPDGLPMPFWLYKLQGLDV 418
           P Y   E+E      D+   +Q+    Q     E SFD+PLGPDG P+P+WLYKLQGLD+
Sbjct: 380 PVYGEQEQE------DIAEADQKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDI 433

Query: 419 EYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDINS 478
           EYPCE+C N I+KGRR F+KHFT   H + L+ LG++PS  FKG+T I + ++LW  + S
Sbjct: 434 EYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLRS 493

Query: 479 QKNSSKPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
              +S    +  + + E+ED  GNVMSKK+Y+ELKKQGL
Sbjct: 494 SSKASN--AAGPKFEEEIEDEEGNVMSKKVYEELKKQGL 530

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/535 (40%), Positives = 322/535 (60%), Gaps = 33/535 (6%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSID--TPAESNKSNNKIY 62
           L+++ +L+  LE++EDAIA RFQRNP LYY+++  L  LT  +     P + + + NK+Y
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKVCPPQDHVTKNKVY 62

Query: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVL--LDLGKETVKDDNI--TLETFKTMIQ 118
           + +K  R  KQ   QQ EI +FL+D   R  +L  L   +E+   ++    L+ FKT I 
Sbjct: 63  RVEKSARKVKQVATQQHEIKLFLQD---RTDILNKLSRAQESGPGESQYKNLDEFKTAIN 119

Query: 119 DI---NAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYG 175
            +   N  K S     +  +  +YAMFS+SI E  P NILS R   LDIN  F+REEQYG
Sbjct: 120 GLTESNIPKRSG----LQSEKDQYAMFSSSI-EKPPTNILSARALELDINAIFNREEQYG 174

Query: 176 QYMDFENFYLEWLNVVKTGDVTLLQFL-NLLRVFM---DEEKYLTHPPMDRKNNRYMKFL 231
            Y+  EN++  WL ++K   VT+LQ+L +L R+F+   D+  YLT PP+DR N +Y++FL
Sbjct: 175 TYIQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFL 234

Query: 232 ESLCSYVESFFFRKYALINKSAITSQIESQF-TEYIKEPTEHSVKGQYCKACAKWFKTES 290
           E L  Y++++  +K+ LI++  +   +   F   Y+ +P       Q+C  C K ++   
Sbjct: 235 ERLGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGMQ 294

Query: 291 VFVNHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEE 350
           +F +H+  K H +   +R   L +E+++  +   L +EFK++  F+E K+A T  ER EE
Sbjct: 295 LFNDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEE 354

Query: 351 MKRLTENYEKPAYS------SDEKEGDENNADLEHDEQRSGKGQGLLEGSF-DMPLGPDG 403
           ++RLT  YE P Y+       +  E D+N     H E    K    LE  F +MPLGPDG
Sbjct: 355 LQRLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSE---NKQTAELESMFTNMPLGPDG 411

Query: 404 LPMPFWLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGI 463
           +P+P WLYKLQGLDV+Y CEIC N  FKGRRA++KHF  P H+Y L+CLGI  S  F GI
Sbjct: 412 MPIPLWLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGI 471

Query: 464 TKIKEAQKLWVDINSQKNSSKPMV-SSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
             I+EAQ+LW  I+ +  S++     S++L++EVED  GNVMS+ +Y +LK+QGL
Sbjct: 472 ALIEEAQELWAKISGKSTSARAGSDDSLKLEIEVEDEDGNVMSQTVYQDLKRQGL 526

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  371 bits (953), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/534 (39%), Positives = 304/534 (56%), Gaps = 32/534 (5%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILT--NLSIDTPAESNKSNNKIY 62
           LE+KR +LE+LEVIE AI+ R +RNPE+YY  + +L ++      +D  ++ + ++N+IY
Sbjct: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63

Query: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK---ETVKDDNITLETFKTMIQD 119
             KK +RSRKQ +LQQ EI  FL+ + ++ + L        E+++D N+  ETF+  I++
Sbjct: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEADIKE 123

Query: 120 INAKK-----SSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQY 174
           +  ++     S S +  + +K   Y+MFSAS    +   ILS     +D+NK F  EE Y
Sbjct: 124 LQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWEEHY 181

Query: 175 GQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESL 234
           G+Y+  E  + +WLNVVK G VTLLQF+  L  F     YLT PP+DR + RY  F++ L
Sbjct: 182 GEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVFIQKL 240

Query: 235 CSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVN 294
            +Y+E  F   Y L+N   + ++I   F  YI  P E   +G  C AC K FK  +VF  
Sbjct: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300

Query: 295 HIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRL 354
           H+ GK H ++   +   L +E+ LH     L    + T   +E K A T+ ER  EM  +
Sbjct: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360

Query: 355 TENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQ 414
            + Y+ PAYSS E E      D+    Q+            ++PLGP G P+P+WLYKLQ
Sbjct: 361 RDAYDAPAYSSGEPE------DVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQ 414

Query: 415 GLDVEYPCEICSNQIFKGRRAFEKHF-TAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLW 473
           GLD+EY CEIC+N ++KGRR     F TAP   Y LRCLGIEPS  FK I  I EAQ+L+
Sbjct: 415 GLDIEYACEICANHVYKGRRISNAIFRTAPC--YGLRCLGIEPSPAFKDIYNIAEAQQLF 472

Query: 474 VDINSQKNSS----------KPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517
             + S    +              ++ +L+VEVED  GNVM+ ++Y++LKKQGL
Sbjct: 473 QSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGL 526

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  292 bits (747), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 198/536 (36%), Positives = 305/536 (56%), Gaps = 38/536 (7%)

Query: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPA--ESNKSNNKIY 62
            E++R +LE+LEVIEDAI+ R +RNPE++Y     L    NL ++  A  + + S N+IY
Sbjct: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALH---NLGVEAWAVPKLDVSANRIY 65

Query: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK--------ETVKDDNITLETFK 114
           + KK KRSRKQ   Q+ EI +FL  +   RR+L  L K        E  +D N + E F+
Sbjct: 66  RSKKSKRSRKQIKAQEYEIALFLGRY---RRLLKSLQKHKLSEEHLEYFRDTNASFEQFE 122

Query: 115 TMIQDINAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQY 174
           T+  ++   + +S  L   +  + Y MFS   + SK  NI+S     +D+++ F+R+E +
Sbjct: 123 TVTTEVLEGQVNSRSLV--EVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENF 178

Query: 175 GQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESL 234
           G Y+D    + +WLN++K  D+T+L FL +L  F +   YL +P +DR    Y + +  L
Sbjct: 179 GTYLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTEL 237

Query: 235 CSYVESFFFRKYALINKSAITSQIESQFTEYIK-----EPTEHSVKGQYCKACAKWFKTE 289
             Y ++++ + Y L++K  ++  I + F +Y++      P++ S K  Y     +WF ++
Sbjct: 238 LKYYKAYYSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGK-MYSVVFNRWFDSQ 296

Query: 290 SVFVNHIPGKN-HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERM 348
           S F  H+  +  +I   + RK  L+ EY  H F   L +  + T  F E K+A T +E  
Sbjct: 297 SEFNTHVQTEQFNIALSRNRKR-LMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFT 355

Query: 349 EEMKRLTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPF 408
           EE+++L E YE P Y+ DE E   +  D  + E  + K        +++PLGPDG P+P 
Sbjct: 356 EELEKLQEQYESPIYAKDESEDKPSYID--NAEDTAQKESMDPTNPYNLPLGPDGFPIPR 413

Query: 409 WLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKE 468
           WL K+QGLDV+Y CEIC NQI+ GRR FEKHF    H   L+ LGI PS  FK +T I E
Sbjct: 414 WLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVE 473

Query: 469 AQKLWVDINSQKN--SSKPM--VSSI---ELQVEVEDSVGNVMSKKLYDELKKQGL 517
             +LW  + ++    S +P   +S++   E+ +E ED+ GNVMS ++Y+ELKKQGL
Sbjct: 474 VTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGL 529

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/395 (23%), Positives = 158/395 (40%), Gaps = 43/395 (10%)

Query: 134 QKITRYAMFSASISESKPNNILSQRCAGLDINK-YFSREEQYGQYMDFENFYLEWLNVV- 191
           ++++  ++F+  I E  P  I S     +DIN  Y   EE+YG  +  + FY  W+  + 
Sbjct: 89  EEVSVASLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYGTSISLDRFYNLWIGHLT 143

Query: 192 --KTGDV--TLLQFLN------LLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVESF 241
             KT +   TL++F        L   ++DE  +   PP     +     LE L  + E  
Sbjct: 144 KRKTSESPPTLVEFYGQVTKQFLHDRWIDETAF---PP-----SLIAGMLEYLTGFQERV 195

Query: 242 FFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQY-------CKACA-KWFKTESVFV 293
              K    + +AIT ++           +  S            C  C  K F TE VF 
Sbjct: 196 DIVK-PQDSSAAITRRLRRHIALSSSSCSSSSSSASSPSPWPLTCIVCGPKKFATEQVFH 254

Query: 294 NHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKR 353
           +H+    H+K E  R   ++    +      L  E       +E ++ +T  ER  E   
Sbjct: 255 HHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHA- 313

Query: 354 LTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKL 413
                ++   +   + G +  A        +         S    +  DG  +P WLY+L
Sbjct: 314 ---AQQRIRTAVQGRGGGDTTATPSATPSATPAATTPASAST---VEVDGRHVPRWLYRL 367

Query: 414 QGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGI--EPSSMFKGITKIKEAQK 471
           QGL   + CE+C  + F GR  +E+HFT+  H+  L CLG+  E    F+G+ K+    +
Sbjct: 368 QGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAVLE 427

Query: 472 LWVDINSQKNSSKPMVSSIELQVEVEDSVGNVMSK 506
           L  +   +    +P  S++     V  + G  + K
Sbjct: 428 LRGEKLGRLEEQEPSRSTVGRAKAVGKAGGKAVGK 462

>ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR074C
           (BUD20)
          Length = 175

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 259 ESQFTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQ 307
           E +    +K+P + +  G    YC  CAK+F+T +    H+ GK H +  K+
Sbjct: 43  EQRVNALLKQPLDETKPGLGQHYCIHCAKYFETPAALKTHLKGKVHKRRVKE 94

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 60/142 (42%), Gaps = 32/142 (22%)

Query: 173 QYGQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLE 232
           ++G+  D    YL   ++ K   + L +F       ++E+  LTH       + Y   LE
Sbjct: 632 EHGERQDALIIYLAASSLDKVASIWLKEF-----PVLEEKLKLTH------KSLYEAHLE 680

Query: 233 SLCSYVESF-----FFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFK 287
            +  +VE F     F    A+IN  A+ ++    F E++              A    F+
Sbjct: 681 CITEFVERFTVFSNFVGGNAMINNDALIAK----FLEFVS-----------LTAATGNFE 725

Query: 288 TESVFVNHIPGKN-HIKNEKQR 308
             S F++H+PG N  +  EK+R
Sbjct: 726 LASSFLDHLPGDNEQVNTEKER 747

>SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly
           similar to gnl|GLV|KLLA0D05621g Kluyveromyces lactis
           KLLA0D05621g and similar to YLR074C uniprot|Q08004
           Saccharomyces cerevisiae YLR074C BUD20 Protein involved
           in bud-site selection diploid mutants display a random
           budding pattern instead of the wild-type bipolar pattern
          Length = 169

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 254 ITSQIESQ--FTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQR 308
           I +++ SQ    E + +P + +  G    YC  CAK+F+T      H+ GK H +  K+ 
Sbjct: 21  IYNELSSQDKIQELLNQPLDETKPGLGQHYCIHCAKYFETAMALKTHLKGKVHKRRVKEL 80

Query: 309 KN 310
           K 
Sbjct: 81  KG 82

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 259 ESQFTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQRKN 310
           + Q  + + +P + +  G    YC  CAK+F+T      H+ GK H +  K+ K 
Sbjct: 28  QEQIQKLLNQPIDETKPGLGQHYCIHCAKYFETRIALKTHLKGKVHKRRVKELKG 82

>NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {ON}
           Anc_8.11 YLR074C
          Length = 169

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 13/88 (14%)

Query: 248 LINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVNHIPGKNHIKNEKQ 307
           L +KS I + +  Q  E     T+  +   YC  CAK+F+T      H+  K H +  K+
Sbjct: 25  LTSKSTIQTLLNQQLDE-----TKPGLGQHYCIHCAKYFETAIALKTHLKTKVHKRRVKE 79

Query: 308 RKNALLSE--------YKLHRFFFLLQE 327
            K    ++        Y L++F   +QE
Sbjct: 80  LKGVPYTQEVADAAAGYNLNKFLNRVQE 107

>NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {ON}
           Anc_7.185
          Length = 1047

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 194 GDVTLLQFLNLLRVFMDEEKYLTHPPMD-------RKNNRYMKFLESLCSYVESFFFR-- 244
           G+V LL+ LN+L    D    +   P D       +  N Y+K L    S+++S   R  
Sbjct: 441 GNVQLLKGLNILTTLKDHAHLIVQSPKDLAELDLVKDINAYVKNLSLPFSFLQSIIERGV 500

Query: 245 KYALINKSAITSQIESQFTEYI 266
           ++ LIN +A  S++ S  T+ +
Sbjct: 501 QFTLINTTANDSRLNSIVTQAV 522

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 32.3 bits (72), Expect = 1.8,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 259 ESQFTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQRK 309
           + +  + + +P + +  G    YC  CAK+F+T      H+ GK H +  K+ K
Sbjct: 28  QQKIQQLLNQPVDETKPGLGQHYCIHCAKYFETAVALKTHLKGKIHKRRVKELK 81

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 282  CAKWFKTESVFVNHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMA 341
               +FKT+    NHI   NH+  + QRK   L +   HR FFLL E+F+E+  + E+  +
Sbjct: 1157 ITNFFKTD----NHI---NHL--DTQRKFIGLHDSPYHRCFFLLPEKFQESSSYKELYGS 1207

Query: 342  LT 343
            +T
Sbjct: 1208 IT 1209

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 31.6 bits (70), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 259 ESQFTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQRK 309
           + Q  + + +P + +  G    YC  CAK+F+T      H+ GK H +  K+ K
Sbjct: 28  QEQIQKLMNQPLDETKPGLGQHYCIHCAKYFETGVALKTHLKGKVHKRRVKELK 81

>Skud_2.231 Chr2 complement(419081..420172) [1092 bp, 363 aa] {ON}
           YBR105C (REAL)
          Length = 363

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 132 INQK----ITRYAMFSASISESKPNNILSQRCA--GLDINKYFSREEQYGQYMDFENFYL 185
           +NQK    +T  +  +++I +S+P   L    +    +I++ FS+E+Q+G Y+D    ++
Sbjct: 232 MNQKNSINLTHDSTATSAIKDSQPQQQLPTTSSTDANNISRIFSQEKQFGDYLDERFIFM 291

Query: 186 EWLNVVKTGDVTLLQ 200
           +W       D  L++
Sbjct: 292 KWKEKFLVPDALLME 306

>NCAS0A10160 Chr1 (2025950..2026969) [1020 bp, 339 aa] {ON}
           Anc_3.214 YDL005C
          Length = 339

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 158 RCAGLDINKYFSREEQYGQYMDFENFYLEWLNVVKTGDVTLLQF 201
              GLD+N+    ++ Y    DF +  ++W N  +TGD+ L  F
Sbjct: 296 NATGLDLNQ--ENDDNYLTLNDFNDLNIDWTNGGETGDLDLNDF 337

>Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {ON}
           YLR074C (REAL)
          Length = 166

 Score = 30.4 bits (67), Expect = 6.9,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 268 EPTEHSVKGQYCKACAKWFKTESVFVNHIPGKNHIKNEKQRKNALLSE--------YKLH 319
           + T+  +   YC  CAK+ +T      H+ GK H +  K+ K+   ++        Y L+
Sbjct: 40  DETKPGLGQHYCIHCAKYMETAIALKTHLKGKVHKRRVKELKSVPYTQEVSDAAAGYNLN 99

Query: 320 RFFFLLQE 327
           +F   +QE
Sbjct: 100 KFLNRVQE 107

>AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR148W (PEP3)
          Length = 910

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 34/65 (52%)

Query: 92  RRVLLDLGKETVKDDNITLETFKTMIQDINAKKSSSEVLPINQKITRYAMFSASISESKP 151
           +R+ L + + T+ +D    ++ +++IQD N   +  ++LP+  K+   A     +  S  
Sbjct: 712 KRLWLKIARVTIYEDTDVRQSIRSIIQDANGVLTIKDLLPLVSKVATIANLKEELVRSLE 771

Query: 152 NNILS 156
           N+ +S
Sbjct: 772 NHQMS 776

>YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}
           BUD20Protein involved in bud-site selection; diploid
           mutants display a random budding pattern instead of the
           wild-type bipolar pattern
          Length = 166

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 8/59 (13%)

Query: 277 QYCKACAKWFKTESVFVNHIPGKNHIKNEKQRKNALLSE--------YKLHRFFFLLQE 327
            YC  CAK+ +T      H+ GK H +  K+ +    ++        Y L++F   +QE
Sbjct: 49  HYCIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFLNRVQE 107

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 254 ITSQIESQ--FTEYIKEPTEHSVKG---QYCKACAKWFKTESVFVNHIPGKNHIKNEKQR 308
           I  +++SQ    + + +P + +  G    YC  CAK+F+T      H+ GK H +  K+ 
Sbjct: 21  IHEELKSQEKIQQLLNQPLDETKPGLGQHYCIHCAKYFETGIALKTHLKGKIHRRRVKEL 80

Query: 309 KN 310
           K+
Sbjct: 81  KS 82

>KLTH0H15576g Chr8 (1346402..1347862) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40210 Saccharomyces cerevisiae YMR140W SIP5
           Sip5p facilitates the interaction between the Glc7p
           phosphatase and the Snf1p kinase
          Length = 486

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 56/132 (42%), Gaps = 17/132 (12%)

Query: 57  SNNKIYKRKKLK-------RSRKQFVLQQQEI--NIFLKDFEERRRVLLDLGKETVKDDN 107
            N   YKRK  K       R  KQ +++  E     FL  F       LD   + VK  N
Sbjct: 65  GNGNPYKRKSTKDKEKMEERHVKQLIVKYNETVDGGFLAPFGSCGTDKLDYDAKVVK--N 122

Query: 108 ITLE----TFKTMIQDINAKKSSSEVLPINQKITRYAMFSASIS--ESKPNNILSQRCAG 161
           + +E     F T +QD +   S  EV+ I + +  +A F+ ++   E  P   LSQ    
Sbjct: 123 LIMERRLAPFYTPLQDFDDSWSREEVIKIIEALPLHAPFNENLETFEDVPIGDLSQNDID 182

Query: 162 LDINKYFSREEQ 173
             I+K  SR EQ
Sbjct: 183 HLIDKTLSRREQ 194

>KLTH0F10186g Chr6 complement(878318..878878) [561 bp, 186 aa] {ON}
           similar to uniprot|Q12368 Saccharomyces cerevisiae
           YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
           Putative RNA binding zinc finger protein
          Length = 186

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 5/57 (8%)

Query: 250 NKSAITSQIESQFTEYIKEPTEHSVK-----GQYCKACAKWFKTESVFVNHIPGKNH 301
           N + + ++      E +  PT  S K     G YC+ C   FK    FVNH+  K H
Sbjct: 46  NHALLVAEATQNSNERVLAPTITSYKKGKQFGFYCELCDLTFKDTLQFVNHLNHKTH 102

>TBLA0B08420 Chr2 complement(2013679..2014119) [441 bp, 146 aa] {ON}
           Anc_3.75 YOL108C
          Length = 146

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 48  IDTPAESNKSNNKIYKRKKLKRSRKQFV--LQQQEINIFLKDFEERRRVLL----DLGKE 101
           ID+P  ++ SN+   K KK+++ R + V  L Q ++ I   D E+RRR L+    D   E
Sbjct: 11  IDSPVPNSLSNSADSKVKKVRKPRSKKVNKLSQDQVRINHVDSEKRRRDLVRGIYDKLVE 70

Query: 102 TVKD 105
           TV D
Sbjct: 71  TVPD 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,981,505
Number of extensions: 2791709
Number of successful extensions: 14072
Number of sequences better than 10.0: 153
Number of HSP's gapped: 14604
Number of HSP's successfully gapped: 157
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)