Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C035303.159ON97796244810.0
NDAI0G028703.159ON99198137090.0
YDL031W (DBP10)3.159ON99598535890.0
Smik_4.2043.159ON99898835410.0
Suva_4.2183.159ON100799435390.0
Skud_4.2203.159ON100199135170.0
KAFR0C010603.159ON97395034700.0
CAGL0K01551g3.159ON96994734270.0
KNAG0K011103.159ON100195633920.0
KLLA0F24684g3.159ON97396033670.0
AEL086W3.159ON96094833300.0
KLTH0C08866g3.159ON97296433280.0
Kpol_1032.113.159ON97794433260.0
SAKL0C08778g3.159ON100398933150.0
TPHA0M003303.159ON98195432580.0
Kwal_56.228043.159ON97396732510.0
TDEL0D046303.159ON96895431710.0
ZYRO0B04972g3.159ON97994531710.0
TBLA0B015903.159ON92995324650.0
CAGL0D03124g5.208ON7254205969e-65
KLLA0F15752g5.208ON7484095934e-64
Smik_12.555.208ON7354085924e-64
YLL008W (DRS1)5.208ON7524085926e-64
KNAG0H025205.208ON7544165901e-63
TDEL0E042105.208ON7404115882e-63
Suva_10.675.208ON7444165863e-63
NDAI0C024905.208ON7714135874e-63
ZYRO0B10318g5.208ON7504065855e-63
SAKL0G09328g5.337ON5054445696e-63
Skud_12.595.208ON7584075847e-63
Kpol_1005.115.337ON5064215697e-63
TPHA0D019905.337ON4984215671e-62
TPHA0N007005.208ON7554085812e-62
KAFR0C064205.208ON7394175741e-61
TBLA0C061605.208ON7574105741e-61
AAL164C5.208ON7344085732e-61
SAKL0G12760g5.208ON7374055722e-61
Kwal_33.143255.337ON5004215555e-61
KLTH0B03278g5.208ON7394205652e-60
Kwal_33.151655.208ON7314065633e-60
NDAI0F020106.148ON8884305463e-57
CAGL0L03846g2.164ON5444045285e-57
Kwal_14.16536.148ON6884165359e-57
TDEL0G014206.204ON5124065222e-56
Smik_14.2152.164ON5474045233e-56
TBLA0D035206.148ON8894245374e-56
YNL112W (DBP2)2.164ON5464045215e-56
KLTH0D09328g2.164ON5514055206e-56
Skud_7.2046.204ON5164055178e-56
Suva_14.2262.164ON5434035198e-56
TBLA0C055802.164ON5404045181e-55
ZYRO0B09856g2.164ON5404105172e-55
NDAI0F027402.164ON5614045172e-55
NCAS0G025602.164ON5564055172e-55
TDEL0F011902.164ON5494055163e-55
Skud_15.3708.614ON6094105193e-55
Suva_7.1926.204ON5184055134e-55
KAFR0B045602.164ON5434045144e-55
YGL078C (DBP3)6.204ON5234055124e-55
KLLA0F01034g8.614ON6274105185e-55
TDEL0B040606.148ON8474365285e-55
Smik_15.3908.614ON6094105176e-55
Smik_7.2056.204ON5224055117e-55
CAGL0H03377g6.204ON5404065092e-54
YOR204W (DED1)8.614ON6044105122e-54
AFL027C6.148ON8164135222e-54
NCAS0C017208.614ON6404085142e-54
Ecym_54222.164ON5604035075e-54
KLLA0F23716g2.164ON5544095059e-54
NCAS0B017308.614ON6184125081e-53
CAGL0L02915g8.614ON6174105081e-53
KLTH0H05852g6.148ON8114205114e-53
Ecym_22696.148ON8774005135e-53
NDAI0E015908.614ON6084455016e-53
KLTH0D09746g8.614ON6214155019e-53
SAKL0E10670g2.164ON5744054981e-52
KAFR0G020308.614ON6064054972e-52
KLLA0F10505g6.148ON8124225035e-52
Kpol_1072.508.614ON6504104941e-51
Kpol_534.316.148ON8724195021e-51
NDAI0E024308.614ON6614084922e-51
KLLA0C15499g6.204ON5043854806e-51
KLTH0H00638g5.69ON4334294747e-51
Kwal_27.117348.469ON5714134821e-50
KLLA0A09669g5.40ON4974194762e-50
AFL221C2.164ON5574054792e-50
KNAG0H013703.249ON3984324656e-50
Kwal_56.247605.69ON4334304632e-49
KAFR0G034806.148ON8524374833e-49
KLTH0E10890g8.469ON5894134715e-49
KAFR0B015205.40ON4964174648e-49
ZYRO0G14960g6.148ON8314134781e-48
Ecym_47755.40ON5004164621e-48
CAGL0M13519g5.40ON4944164621e-48
SAKL0H01430g5.40ON5004174612e-48
CAGL0K07029g6.148ON8164004743e-48
Ecym_13958.469ON5653964624e-48
TPHA0N011306.148ON8774184744e-48
TPHA0L021605.40ON4984154585e-48
Suva_4.4946.148ON8504164726e-48
NCAS0A014005.241ON7624184706e-48
KLTH0B08998g5.40ON4924184559e-48
TBLA0I018603.249ON3874134471e-47
TDEL0G006505.40ON4854164531e-47
NCAS0B025708.469ON5904154592e-47
NCAS0H012806.148ON8874134673e-47
NDAI0C023205.241ON7644244634e-47
KAFR0E028108.469ON5683954544e-47
NCAS0F022005.40ON5084164515e-47
KNAG0M006606.148ON8844024655e-47
Kpol_513.155.40ON5014174506e-47
AER301C5.69ON4354234448e-47
Kwal_23.42885.40ON4924264488e-47
ZYRO0D07546g5.40ON4944164471e-46
AGR333C5.40ON5044164462e-46
KLLA0D09504g5.241ON7704114563e-46
CAGL0K11198g8.469ON5824134475e-46
TBLA0C067805.40ON4964174425e-46
TPHA0M009003.249ON4004064355e-46
SAKL0G11748g5.241ON7634184545e-46
NDAI0C036005.40ON5194154436e-46
Suva_13.4805.40ON5054304417e-46
YDR243C (PRP28)8.469ON5884064467e-46
YMR290C (HAS1)5.40ON5054164401e-45
KNAG0D027805.40ON4764064381e-45
Smik_13.5065.40ON5054164391e-45
Skud_13.4635.40ON5054154392e-45
NCAS0A015505.208ON7482314492e-45
Suva_2.4098.469ON5894064413e-45
Suva_12.485.241ON7704154474e-45
YJL033W (HCA4)5.241ON7704164475e-45
Skud_7.1008.124ON5584174385e-45
KNAG0I020502.164ON4233674243e-44
Smik_10.2395.241ON7704024403e-44
KLTH0A02244g8.87ON5984594343e-44
Kpol_534.535.208ON7522434394e-44
CAGL0F05577g8.402ON6664244364e-44
TBLA0H032408.402ON7674434386e-44
Kwal_26.84702.164ON4253644201e-43
Skud_10.1895.241ON7704154361e-43
Kpol_340.28.402ON6704424321e-43
Kpol_1007.108.469ON6054174292e-43
Kpol_165.12.164ON4413624192e-43
CAGL0L08976g8.87ON6174114283e-43
TDEL0E038505.241ON7614104323e-43
TPHA0B029302.164ON4273664164e-43
Kpol_1058.438.87ON6074294264e-43
TDEL0B016708.469ON5794064244e-43
Skud_14.2192.164ON4353764165e-43
SAKL0H11968g8.469ON5664064236e-43
Ecym_83588.124ON5694824227e-43
Skud_15.2105.643ON4824094178e-43
YOR046C (DBP5)5.643ON4824094161e-42
Kwal_23.51258.87ON5984554211e-42
Suva_8.985.643ON4824174151e-42
Smik_15.2245.643ON4774094142e-42
Smik_6.818.87ON6064634202e-42
ZYRO0F04312g8.87ON6024564202e-42
TBLA0D034005.241ON7754104253e-42
YFL002C (SPB4)8.87ON6064754184e-42
Skud_6.728.87ON6064684175e-42
KNAG0D022508.124ON5604194147e-42
Ecym_73248.87ON5974534158e-42
SAKL0A06204g6.148ON8432464229e-42
SAKL0H13574g8.402ON6684274189e-42
ZYRO0E02530g8.124ON5564114139e-42
Ecym_41658.402ON6584244171e-41
ZYRO0C04378g8.402ON6814554143e-41
SAKL0B02794g8.87ON5984634103e-41
KLTH0H15686g2.384ON4394194006e-41
KAFR0B061708.402ON6234244088e-41
Ecym_60492.384ON4384233971e-40
YBR237W (PRP5)6.148ON8492474122e-40
KAFR0D046305.337ON4872393982e-40
KLTH0F08382g8.402ON6574124053e-40
TBLA0C006908.87ON6044614024e-40
ZYRO0C14234g5.337ON4942413965e-40
ACR253C1.211ON3964283905e-40
NDAI0C042505.337ON5042413966e-40
AGL112C8.402ON6584164019e-40
ADR260C2.384ON4384203901e-39
Smik_4.4428.402ON6654254011e-39
KNAG0B046605.337ON4942223941e-39
YDR194C (MSS116)8.402ON6644254011e-39
Smik_2.3806.148ON8502434041e-39
KNAG0A058502.384ON4494193892e-39
KLLA0A05731g1.211ON3964223852e-39
Skud_2.3696.148ON8482454032e-39
YJL138C (TIF2)1.211ON3954333852e-39
YKR059W (TIF1)1.211ON3954333852e-39
NCAS0J005808.87ON6114243972e-39
TDEL0F052608.402ON6554283982e-39
Kwal_23.32358.402ON6764143992e-39
TPHA0B030401.211ON3964333843e-39
Smik_10.941.211ON3954333833e-39
Smik_11.3211.211ON3954333833e-39
Ecym_51961.211ON3964283834e-39
Ecym_32175.337ON4862413894e-39
NCAS0F027905.337ON5022503894e-39
KLLA0E21935g2.384ON4374203864e-39
ADL024C8.124ON5694023925e-39
ZYRO0B05852g3.122ON7514253985e-39
TPHA0G020502.384ON4384193856e-39
KLLA0C14608g5.337ON4872223876e-39
TPHA0D009408.124ON5704173916e-39
Skud_10.761.211ON3954293817e-39
TPHA0G025852.384ON4384193847e-39
Suva_6.598.87ON6064193927e-39
YHR065C (RRP3)5.337ON5012413861e-38
Suva_4.1632.384ON4464193831e-38
Suva_11.2941.211ON3964323791e-38
KNAG0A046608.402ON7134283941e-38
Smik_8.1365.337ON5012413852e-38
CAGL0J10912g5.337ON4932413842e-38
Kpol_1058.532.384ON4424193812e-38
Kpol_1060.581.211ON3964333782e-38
Skud_4.1712.384ON4464193812e-38
YDL084W (SUB2)2.384ON4464193802e-38
Skud_4.4588.402ON6644173902e-38
NCAS0A039502.384ON4464243802e-38
TBLA0B088802.384ON4424243802e-38
Suva_6.2181.211ON3964323772e-38
Smik_4.1522.384ON4464193802e-38
KLTH0F05610g1.211ON3964293773e-38
Skud_11.2951.211ON4294293793e-38
Kpol_1041.332.384ON4414323803e-38
Skud_8.1225.337ON5032413833e-38
CAGL0L06908g2.384ON4394193784e-38
TDEL0E028905.337ON5012493824e-38
TBLA0D057501.211ON4014333755e-38
YGL171W (ROK1)8.124ON5643953845e-38
TBLA0C035005.337ON5062413816e-38
CAGL0K02387g8.124ON5653943846e-38
Kwal_33.140001.211ON3964293747e-38
TDEL0H009301.211ON3954333737e-38
ZYRO0D03058g1.211ON3954333739e-38
Suva_7.928.124ON5583963829e-38
TDEL0G031402.384ON4444193751e-37
YBR142W (MAK5)3.122ON7734383881e-37
SAKL0C06336g1.211ON3974283721e-37
Smik_7.1008.124ON5573953801e-37
KAFR0G006501.211ON3954293711e-37
Suva_15.2545.337ON5032413771e-37
NCAS0A140607.336ON5102083772e-37
SAKL0F11088g7.336ON4972083762e-37
ZYRO0A08272g2.384ON4434193732e-37
Ecym_46467.336ON4902093752e-37
SAKL0E05148g2.384ON4684193742e-37
KLTH0F07106g5.337ON5252413773e-37
KAFR0F029402.384ON4434293723e-37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03530
         (977 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1730   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1433   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1387   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1368   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1367   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1359   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1341   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1324   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1311   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1301   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1287   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1286   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1285   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1281   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1259   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1256   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1226   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1226   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   954   0.0  
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   234   9e-65
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   233   4e-64
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   232   4e-64
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   232   6e-64
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   231   1e-63
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   231   2e-63
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   230   3e-63
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   230   4e-63
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   229   5e-63
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   223   6e-63
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   229   7e-63
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   223   7e-63
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   223   1e-62
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   228   2e-62
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   225   1e-61
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   225   1e-61
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   225   2e-61
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   224   2e-61
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   218   5e-61
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   222   2e-60
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   221   3e-60
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    214   3e-57
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   207   5e-57
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   210   9e-57
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   205   2e-56
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   206   3e-56
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   211   4e-56
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   205   5e-56
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   204   6e-56
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   203   8e-56
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   204   8e-56
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   204   1e-55
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   203   2e-55
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   203   2e-55
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   203   2e-55
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   203   3e-55
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   204   3e-55
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   202   4e-55
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   202   4e-55
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   201   4e-55
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   204   5e-55
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   207   5e-55
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   203   6e-55
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   201   7e-55
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   200   2e-54
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   201   2e-54
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   205   2e-54
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   202   2e-54
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   199   5e-54
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   199   9e-54
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   200   1e-53
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   200   1e-53
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   201   4e-53
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   202   5e-53
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   197   6e-53
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   197   9e-53
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   196   1e-52
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   196   2e-52
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   198   5e-52
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   194   1e-51
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   197   1e-51
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   194   2e-51
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   189   6e-51
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   187   7e-51
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   190   1e-50
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   187   2e-50
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   189   2e-50
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   183   6e-50
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   182   2e-49
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   190   3e-49
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   186   5e-49
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   183   8e-49
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   188   1e-48
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   182   1e-48
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   182   1e-48
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   182   2e-48
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   187   3e-48
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   182   4e-48
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   187   4e-48
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   181   5e-48
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   186   6e-48
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    185   6e-48
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   179   9e-48
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   176   1e-47
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   179   1e-47
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    181   2e-47
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   184   3e-47
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    182   4e-47
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   179   4e-47
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     178   5e-47
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   183   5e-47
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   177   6e-47
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   175   8e-47
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   177   8e-47
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   176   1e-46
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   176   2e-46
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   180   3e-46
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   176   5e-46
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   174   5e-46
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   172   5e-46
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   179   5e-46
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   175   6e-46
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   174   7e-46
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   176   7e-46
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   174   1e-45
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   173   1e-45
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   173   1e-45
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   173   2e-45
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   177   2e-45
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   174   3e-45
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   176   4e-45
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   176   5e-45
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   173   5e-45
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   167   3e-44
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   174   3e-44
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   171   3e-44
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   173   4e-44
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   172   4e-44
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   173   6e-44
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   166   1e-43
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   172   1e-43
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   171   1e-43
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   169   2e-43
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   166   2e-43
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   169   3e-43
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   171   3e-43
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   164   4e-43
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   168   4e-43
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              167   4e-43
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   164   5e-43
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   167   6e-43
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   167   7e-43
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   165   8e-43
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   164   1e-42
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   166   1e-42
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   164   1e-42
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   164   2e-42
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   166   2e-42
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   166   2e-42
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   168   3e-42
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   165   4e-42
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   165   5e-42
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   164   7e-42
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   164   8e-42
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   167   9e-42
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   165   9e-42
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   163   9e-42
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   165   1e-41
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   164   3e-41
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   162   3e-41
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   158   6e-41
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   161   8e-41
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   157   1e-40
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   163   2e-40
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   157   2e-40
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   160   3e-40
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   159   4e-40
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   157   5e-40
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   154   5e-40
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    157   6e-40
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   159   9e-40
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   154   1e-39
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   159   1e-39
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   156   1e-39
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   159   1e-39
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   160   1e-39
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   154   2e-39
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   152   2e-39
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   159   2e-39
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   152   2e-39
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   152   2e-39
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      157   2e-39
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   157   2e-39
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   158   2e-39
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   152   3e-39
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   152   3e-39
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   152   3e-39
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   152   4e-39
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   154   4e-39
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    154   4e-39
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   153   4e-39
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   155   5e-39
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   157   5e-39
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   152   6e-39
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   153   6e-39
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   155   6e-39
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   151   7e-39
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              152   7e-39
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   155   7e-39
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   153   1e-38
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   152   1e-38
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   150   1e-38
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   156   1e-38
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   152   2e-38
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   152   2e-38
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   151   2e-38
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   150   2e-38
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   151   2e-38
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   150   2e-38
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   154   2e-38
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    150   2e-38
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   150   2e-38
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   149   2e-38
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   150   2e-38
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   149   3e-38
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   150   3e-38
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   150   3e-38
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   152   3e-38
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   150   4e-38
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   151   4e-38
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   149   5e-38
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   152   5e-38
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   151   6e-38
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   152   6e-38
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   148   7e-38
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   148   7e-38
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   148   9e-38
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   151   9e-38
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   149   1e-37
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   154   1e-37
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   147   1e-37
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   150   1e-37
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   147   1e-37
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   149   1e-37
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   149   2e-37
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   149   2e-37
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   148   2e-37
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   149   2e-37
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   148   2e-37
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   149   3e-37
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   147   3e-37
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   150   3e-37
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   150   3e-37
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   148   3e-37
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   151   4e-37
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   147   5e-37
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   145   6e-37
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   147   8e-37
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   147   9e-37
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   145   1e-36
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    150   1e-36
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   146   2e-36
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   144   3e-36
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   145   3e-36
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   144   3e-36
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   149   3e-36
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}            144   4e-36
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   146   5e-36
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   148   5e-36
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   144   5e-36
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   148   6e-36
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   148   6e-36
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   148   7e-36
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   145   7e-36
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   144   1e-35
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   147   1e-35
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   144   1e-35
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   144   1e-35
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   144   1e-35
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   144   1e-35
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   145   1e-35
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   144   1e-35
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   145   2e-35
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   143   2e-35
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   145   2e-35
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   143   2e-35
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   143   4e-35
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   144   4e-35
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   143   5e-35
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   142   7e-35
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   141   8e-35
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   144   8e-35
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   140   1e-34
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   142   1e-34
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   139   2e-34
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   142   3e-34
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    141   3e-34
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   140   3e-34
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   140   4e-34
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   142   4e-34
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   140   4e-34
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...   142   4e-34
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   140   5e-34
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   140   8e-34
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   139   8e-34
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   140   9e-34
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...   141   1e-33
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   136   1e-33
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   139   1e-33
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   139   2e-33
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   140   2e-33
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   140   2e-33
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   138   3e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   139   3e-33
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   138   4e-33
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   138   4e-33
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   139   5e-33
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   139   6e-33
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   139   7e-33
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   139   7e-33
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   134   8e-33
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   138   8e-33
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   138   1e-32
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   136   1e-32
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   135   1e-32
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   136   1e-32
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   133   1e-32
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   135   1e-32
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   135   2e-32
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   136   2e-32
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   136   2e-32
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   132   3e-32
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   135   3e-32
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   134   3e-32
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   135   4e-32
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   133   4e-32
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   132   5e-32
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   132   6e-32
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    133   6e-32
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   131   7e-32
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   130   1e-31
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   130   1e-31
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   132   2e-31
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   130   2e-31
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   130   2e-31
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   129   3e-31
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   131   3e-31
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   131   4e-31
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   132   4e-31
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   128   1e-30
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   129   1e-30
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   129   2e-30
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   129   4e-30
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   128   4e-30
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   129   6e-30
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   127   8e-30
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   127   8e-30
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   125   9e-30
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   127   1e-29
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...   128   1e-29
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   123   4e-29
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   123   3e-28
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   122   5e-28
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   119   5e-28
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   119   6e-28
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   119   6e-28
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   122   6e-28
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   121   9e-28
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   118   1e-27
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   118   1e-27
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   118   1e-27
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   117   2e-27
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   120   3e-27
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   116   5e-27
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   116   6e-27
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   119   6e-27
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   113   1e-26
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   114   2e-26
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   114   3e-26
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   116   3e-26
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   114   4e-26
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   116   4e-26
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   113   4e-26
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   116   5e-26
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   116   5e-26
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   113   6e-26
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   115   6e-26
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   115   8e-26
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   115   9e-26
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   115   1e-25
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   115   1e-25
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   112   2e-25
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   114   2e-25
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   110   5e-25
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   112   8e-25
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   110   1e-24
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   111   1e-24
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   108   2e-24
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   112   2e-24
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   110   2e-24
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643    109   3e-24
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   110   3e-24
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   110   3e-24
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   110   3e-24
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   110   6e-24
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   109   9e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   109   1e-23
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   108   1e-23
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            108   2e-23
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   108   2e-23
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...   106   3e-23
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   107   3e-23
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     107   4e-23
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...   105   4e-23
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   106   5e-23
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   107   6e-23
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   107   7e-23
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   106   7e-23
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   107   7e-23
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   106   8e-23
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...   105   8e-23
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...   104   8e-23
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   106   9e-23
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...   104   1e-22
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    99   3e-22
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   103   4e-22
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   104   5e-22
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   103   6e-22
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...   101   8e-22
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   103   1e-21
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...   102   1e-21
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...   100   2e-21
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...   101   2e-21
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...   100   2e-21
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   102   2e-21
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643     99   2e-21
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   101   3e-21
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   100   5e-21
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...    99   7e-21
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...    99   9e-21
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...   100   1e-20
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   100   1e-20
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    99   1e-20
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...    99   2e-20
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    99   2e-20
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...    98   2e-20
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...    97   8e-20
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    97   8e-20
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    96   2e-19
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    91   9e-19
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    94   1e-18
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    93   1e-18
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    93   2e-18
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    92   3e-18
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    90   1e-17
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    88   5e-17
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    87   8e-17
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...    87   8e-17
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    87   9e-17
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    86   2e-16
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    84   5e-16
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    84   8e-16
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    84   9e-16
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    84   1e-15
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    84   1e-15
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    83   2e-15
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    82   2e-15
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    82   3e-15
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    80   1e-14
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    80   1e-14
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    79   2e-14
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    75   5e-14
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    75   6e-14
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     76   2e-13
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    70   4e-13
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    68   1e-12
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    73   2e-12
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    72   3e-12
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    72   4e-12
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    70   1e-11
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    70   2e-11
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    69   3e-11
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    68   5e-11
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    68   6e-11
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    67   9e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    67   1e-10
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    67   1e-10
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    67   2e-10
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    65   8e-10
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    64   9e-10
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    64   1e-09
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    64   1e-09
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    63   3e-09
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    60   1e-08
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    59   4e-08
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    52   5e-06
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    46   2e-04
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    47   3e-04
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    42   6e-04
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    46   6e-04
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    45   6e-04
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    45   0.001
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    44   0.002
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    44   0.002
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    44   0.003
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    43   0.003
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    43   0.004
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    43   0.004
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    43   0.005
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    42   0.006
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    42   0.008
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    41   0.015
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    41   0.019
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    40   0.024
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    40   0.026
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    40   0.026
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    40   0.026
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    40   0.037
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    40   0.038
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    40   0.039
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    40   0.047
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    39   0.056
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    39   0.062
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    39   0.063
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    39   0.080
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    39   0.085
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    39   0.089
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    39   0.092
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    39   0.11 
NDAI0I00750 Chr9 (164874..169178) [4305 bp, 1434 aa] {ON} Anc_6....    39   0.12 
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    38   0.12 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    38   0.13 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    38   0.13 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    38   0.14 
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    38   0.15 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    38   0.15 
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    38   0.18 
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    38   0.18 
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    38   0.19 
KNAG0F01640 Chr6 (294524..298645) [4122 bp, 1373 aa] {ON} Anc_6....    37   0.21 
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    37   0.27 
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    37   0.29 
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    37   0.33 
Kwal_26.8466 s26 complement(797363..797710) [348 bp, 115 aa] {OF...    34   0.44 
NDAI0I03300 Chr9 (771772..771820,771929..775467) [3588 bp, 1195 ...    36   0.47 
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     36   0.48 
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    36   0.53 
YGL251C Chr7 complement(27921..31426,31579..31636) [3564 bp, 118...    36   0.57 
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    36   0.59 
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    36   0.59 
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    36   0.61 
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    36   0.64 
Ecym_3178 Chr3 (339229..342534) [3306 bp, 1101 aa] {ON} similar ...    36   0.65 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    36   0.66 
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    36   0.67 
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    36   0.72 
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    36   0.73 
TDEL0A06910 Chr1 complement(1207623..1211717) [4095 bp, 1364 aa]...    36   0.75 
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    35   0.83 
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    35   0.85 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    35   0.87 
Skud_14.220 Chr14 (406111..406449) [339 bp, 112 aa] {ON} YNL112W...    33   0.89 
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    35   0.95 
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    35   0.97 
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    35   1.1  
Skud_13.356 Chr13 complement(614958..619313) [4356 bp, 1451 aa] ...    35   1.1  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    35   1.1  
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    35   1.2  
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    35   1.2  
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    35   1.2  
NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6....    35   1.3  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    35   1.3  
ZYRO0E08250g Chr5 complement(647243..651127) [3885 bp, 1294 aa] ...    35   1.3  
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    35   1.4  
CAGL0M01276g Chr13 complement(144593..146641) [2049 bp, 682 aa] ...    35   1.4  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    35   1.5  
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    35   1.5  
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    35   1.6  
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    34   1.8  
Suva_7.10 Chr7 complement(22345..22614,22645..25886,26044..26101...    34   1.9  
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    34   1.9  
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    34   2.0  
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    34   2.1  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    34   2.4  
Smik_5.132 Chr5 (183376..186810) [3435 bp, 1144 aa] {ON} YER013W...    34   2.4  
KLLA0B03179g Chr2 (289199..292204) [3006 bp, 1001 aa] {ON} simil...    34   2.4  
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    34   2.6  
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    34   2.6  
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    34   2.7  
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    34   2.7  
YER013W Chr5 (178841..182278) [3438 bp, 1145 aa] {ON}  PRP22DEAH...    34   2.8  
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    34   2.9  
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    34   3.0  
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    33   3.1  
Skud_5.117 Chr5 (176045..179494) [3450 bp, 1149 aa] {ON} YER013W...    33   3.2  
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...    33   3.6  
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    33   3.6  
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    33   3.7  
CAGL0G00506g Chr7 complement(48535..54405) [5871 bp, 1956 aa] {O...    33   5.4  
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    33   5.6  
KNAG0K00270 Chr11 complement(37409..43306) [5898 bp, 1965 aa] {O...    33   5.8  
Smik_16.37 Chr16 complement(59747..65650) [5904 bp, 1967 aa] {ON...    32   8.9  
Kwal_23.4010 s23 complement(525504..528128) [2625 bp, 874 aa] {O...    32   9.2  

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1730 bits (4481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 864/962 (89%), Positives = 864/962 (89%)

Query: 1   MAPTLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXXVQDVIEY 60
           MAPTLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALN               VQDVIEY
Sbjct: 1   MAPTLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNSSESDASESDDDEEDVQDVIEY 60

Query: 61  SXXXXXXXXXXXXXXXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDKS 120
           S                       SFPSLELS                  YFSTTNLDKS
Sbjct: 61  SDDETETKKKNDKKKNNNKTKEDKSFPSLELSDDEADRRNNEDEDDDVNAYFSTTNLDKS 120

Query: 121 KHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           KHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI
Sbjct: 121 KHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFG 240
           LPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFG
Sbjct: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFG 240

Query: 241 MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS
Sbjct: 241 MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300

Query: 301 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360
           RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL
Sbjct: 301 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360

Query: 361 QEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
           QEVIKIPLASRDQLAKFNAQNI                         ERLPPANQLPSEK
Sbjct: 361 QEVIKIPLASRDQLAKFNAQNIKDNASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEK 420

Query: 421 STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
           STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA
Sbjct: 421 STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480

Query: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGK 540
           RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGK
Sbjct: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGK 540

Query: 541 KILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNV 600
           KILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNV
Sbjct: 541 KILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNV 600

Query: 601 MKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKL 660
           MKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKL
Sbjct: 601 MKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKL 660

Query: 661 DFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLT 720
           DFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLT
Sbjct: 661 DFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLT 720

Query: 721 HTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQENXXXXXTFKDPTFFLSHYAPA 780
           HTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQEN     TFKDPTFFLSHYAPA
Sbjct: 721 HTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQENKKKKKTFKDPTFFLSHYAPA 780

Query: 781 SDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKY 840
           SDIQDKQLQV            YDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKY
Sbjct: 781 SDIQDKQLQVANGFANEAAQAAYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKY 840

Query: 841 IIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGK 900
           IIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGK
Sbjct: 841 IIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGK 900

Query: 901 FKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAF 960
           FKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAF
Sbjct: 901 FKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAF 960

Query: 961 ME 962
           ME
Sbjct: 961 ME 962

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1433 bits (3709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 726/981 (74%), Positives = 798/981 (81%), Gaps = 24/981 (2%)

Query: 1   MAPTLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXXVQDVIEY 60
           MA   KR+R    D    SS  E+    FDIA DIALN               VQDVI+Y
Sbjct: 1   MALKEKRTR----DTAVDSSDSENDAADFDIATDIALNASDSDDASSDSDNEDVQDVIDY 56

Query: 61  SXXXXXXXXXXXXXXXXXXXXX-XXSFPSLELSXXXXXXXXXXXXXXXXX--------XY 111
           S                        SFP LELS                          Y
Sbjct: 57  SDSEHQQEDNKIARKEKQKKQDIDKSFPILELSDDEDTKKKSNSKNNGSDNDDDDDINAY 116

Query: 112 FSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMART 171
           FSTTNL+KSKHKKGSFPSFGLSK I++NIT++GFRQPTPIQRKTIPLILQNRDIVGMART
Sbjct: 117 FSTTNLEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMART 176

Query: 172 GSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTG 231
           GSGKTAAFILPMI K+KTHS KIGARAVILSPSRELAMQTHNVFK+FSKGTQLRSVLLTG
Sbjct: 177 GSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTG 236

Query: 232 GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLN 291
           GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEM+LDLKSIEYAVFDEADRLFEMGFQ+QLN
Sbjct: 237 GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLN 296

Query: 292 ELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDE 351
           ELLASLPS+RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAE+KISENLEMLFLSTKNDE
Sbjct: 297 ELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDE 356

Query: 352 REANLLYLLQEVIKIPLASRDQLAKFNAQNIX-XXXXXXXXXXXXXXXXXXXXXXXXERL 410
           REANLLYLLQ+VIKIPLA+++Q  KFN QN                           ERL
Sbjct: 357 REANLLYLLQDVIKIPLATKEQQRKFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERL 416

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PPANQLPSEK+TILFVPTRHHVEYIS LL++SGYLISYIYGTLDQHARKRQLYNFRTGLT
Sbjct: 417 PPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLT 476

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
           SILVVTDVAARGVDIPMLANVINFSLPASSKIF+HRVGRTARAGNRGWAYSIVSESELPY
Sbjct: 477 SILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPY 536

Query: 531 LLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLEL 590
           LLDLE+FLGKKI++TPMYDS+ +IM  KWIAEG+DE +F  PK++YT+R+ILGSAPRLE+
Sbjct: 537 LLDLELFLGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEV 596

Query: 591 EGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIM 650
           EGLGDLY+N+M++NFE++L+K VAMKAEKLYFRTR +ASPESLKRSKEIIASGWDEQN++
Sbjct: 597 EGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVL 656

Query: 651 FGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHEL 710
           FGKN EKEKLDFLAKLQNRRNKETVFEF+ NPDDEMSVFMKRRRRQLAPIQRKA+ER EL
Sbjct: 657 FGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKEL 716

Query: 711 LQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLK-QFEDGDELLAGQEN-----XXXX 764
           LQ EK+AGLTH++EDE+LKGD+ E   Y++SEDTLK QF+D DELLA QEN         
Sbjct: 717 LQMEKMAGLTHSVEDEILKGDDNE-AGYSVSEDTLKQQFQDADELLADQENKSKKDKKSK 775

Query: 765 XTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDK 824
            +FKDP FFLSHYAPA DIQDKQL++            YDLNNDDKVQVHKQTA VKWDK
Sbjct: 776 KSFKDPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDK 835

Query: 825 KRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLL 884
           KRKKYVN QGLDNKKYIIGE GQKIAASFRSGKFDEW K RK+KPLKVGARE++IPSN+L
Sbjct: 836 KRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNIL 895

Query: 885 SDPTQGP-GAQ-NSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGF-RG 941
           ++PT G  G+Q N++RGKFKHKQ+KAPK+PDKHRDDY  QKKKV KAL NG+QVRG+   
Sbjct: 896 ANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNA 955

Query: 942 PGMKSELKSTEEIRKQRAFME 962
           PGM +ELKSTE+I K R   E
Sbjct: 956 PGMSNELKSTEQIMKDRNVKE 976

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1387 bits (3589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/985 (69%), Positives = 784/985 (79%), Gaps = 28/985 (2%)

Query: 1   MAPTLKRSR-LEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX------ 53
           MA   KR R LED D     +G E+ D+ FDIA +IALN                     
Sbjct: 1   MAGVQKRKRDLEDQD----DNGSEEDDIAFDIANEIALNDSESDANDSDSEVEADYGPND 56

Query: 54  VQDVIEYSXXXXXXXXXXXXXXXXXXXXXX------XSFPSLELSXXXXXXXXXXXX--- 104
           VQDVIEYS                             +FP LE+S               
Sbjct: 57  VQDVIEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEMSDDENNASGKTQTGDD 116

Query: 105 XXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRD 164
                 YFST NL+K+KHKKGSFPSFGLSK +++NI RKGFRQPTPIQRKTIPLILQ+RD
Sbjct: 117 EDDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRD 176

Query: 165 IVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQL 224
           IVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVILSPSRELAMQT NVFKDF++GT+L
Sbjct: 177 IVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTEL 236

Query: 225 RSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEM 284
           RSVLLTGGDSLE+QFGMMM NPDVIIATPGRFLHLKVEMNLDLKS+EY VFDEADRLFEM
Sbjct: 237 RSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEM 296

Query: 285 GFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF 344
           GFQEQLNELLASLP++RQTLLFSATLP+SLVDF KAGL NPVLVRLDAETK+SENLEMLF
Sbjct: 297 GFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF 356

Query: 345 LSTKNDEREANLLYLLQEVIKIPLASRDQLAKF-NAQNIXXXXXXXXXXXXXXXXXXXXX 403
           LS+KN +REANLLY+LQE+IKIPLA+ +QL K  N+ N                      
Sbjct: 357 LSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKRRNFKKE 416

Query: 404 XXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLY 463
               +++P AN+LPSEK+TILFVPTRHHVEYIS LLR+ GYLISYIYGTLDQHARKRQLY
Sbjct: 417 KFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLY 476

Query: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523
           NFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIFVHRVGRTARAGN+GWAYSIV
Sbjct: 477 NFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 536

Query: 524 SESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILG 583
           +E+ELPYLLDLE+FLGKKIL+TPMYDS+ D+M K+WI EG  E  F+PPK+SYT R++LG
Sbjct: 537 AENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLG 596

Query: 584 SAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASG 643
           S PRL++EGLGDLY+N+M SNF++QL K  AMKAEKLY+RTR +ASPESLKRSKEII+SG
Sbjct: 597 SCPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSG 656

Query: 644 WDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRK 703
           WD QN  FGKN EKEKLDFLAKLQNRRNKETVFEF  NPDDEM+VFMKRRR+QLAPIQRK
Sbjct: 657 WDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRK 716

Query: 704 AKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQENXX- 762
           A ER ELL+KE++AGL+H++EDE+LKGD+ E   YT+SED LK+FED D+LL  QEN   
Sbjct: 717 ATERRELLEKERMAGLSHSIEDEILKGDDGE-TGYTVSEDALKEFEDADQLLEAQENENK 775

Query: 763 ---XXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTAT 819
                 +FKDPTFFLSHYAPA DIQDKQLQ+            YDLN+DDKVQVHKQTAT
Sbjct: 776 KKKKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTAT 835

Query: 820 VKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSI 879
           VKWDKKRKKYVN QG+DNKKYIIGESGQKIAASFRSG+FD+W+KAR LKPLKVG+RE+SI
Sbjct: 836 VKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSI 895

Query: 880 PSNLLSDPTQGPGAQN-SVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRG 938
           PSNLL DP+QGP A   +VRGKFKHKQ+KAPK+PDKHRD+Y +QKKKV KAL++G+ V+G
Sbjct: 896 PSNLLEDPSQGPAANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGISVKG 955

Query: 939 F-RGPGMKSELKSTEEIRKQRAFME 962
           +   PG++SELKSTE+IRK R   E
Sbjct: 956 YNNAPGLRSELKSTEQIRKDRIIAE 980

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/988 (69%), Positives = 779/988 (78%), Gaps = 31/988 (3%)

Query: 1   MAPTLKRSR-LEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX------ 53
           MA   KR R LED D      G E+ D+ FDIA DIALN                     
Sbjct: 1   MAGMQKRRRNLEDQDV----IGSEEDDIAFDIANDIALNDSESDSNDSENEIEAGYGPSD 56

Query: 54  VQDVIEYSXXXXXXXXXXXXX---------XXXXXXXXXXSFPSLELSXXXXXXXXXXXX 104
           VQD+IEYS                                +FP LELS            
Sbjct: 57  VQDIIEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAAFPILELSDDENNISGQTQA 116

Query: 105 XXXX---XXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQ 161
                    YFST NL+K KHKKGSFPSFGLSK +++NI RKGFRQPTPIQRKTIPLILQ
Sbjct: 117 GEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ 176

Query: 162 NRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKG 221
           +RDIVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVILSPSRELAMQT NVFKDF++G
Sbjct: 177 SRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARG 236

Query: 222 TQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRL 281
           T+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEMNLDLKS+EY VFDEADRL
Sbjct: 237 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRL 296

Query: 282 FEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLE 341
           FEMGFQEQLNELLASLP++RQTLLFSATLP+SLVDF KAGL NPVLVRLDAETK+SENLE
Sbjct: 297 FEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLE 356

Query: 342 MLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFN-AQNIXXXXXXXXXXXXXXXXXX 400
           MLFLS+KN +REANLLY+LQEVI+IPLA+ +QL K   + N                   
Sbjct: 357 MLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINF 416

Query: 401 XXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKR 460
                  +++P AN+LPSEK+TILFVPTRHHVEYIS LLR+ GYLISYIYGTLDQHARK 
Sbjct: 417 KKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKN 476

Query: 461 QLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAY 520
           QLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIFVHRVGRTARAGN+GWAY
Sbjct: 477 QLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAY 536

Query: 521 SIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRM 580
           SIV+E+ELPYLLDLE+FLGKKIL+TPMYDS+ D+M K+W+ EG+   NF+ PK+SYT R+
Sbjct: 537 SIVAENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRL 596

Query: 581 ILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEII 640
           +LGS PRL++EGLGDLY+N+M SNF++QL K  AMKAEKLY+RTR +ASPESLKRSKEII
Sbjct: 597 VLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEII 656

Query: 641 ASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPI 700
           ASGWD QN  FGKN EKEKLDFLAKLQNRRNKETVFEF  NPDDEM+VFMKRRR+QLAPI
Sbjct: 657 ASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPI 716

Query: 701 QRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQEN 760
           QRKA ER ELL+KE++AGL+H++EDE+LKGD+ E   YT+SED LK FED D+LL  QEN
Sbjct: 717 QRKATERRELLEKERMAGLSHSIEDEILKGDDGE-TGYTVSEDALKNFEDADQLLEAQEN 775

Query: 761 XX----XXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQ 816
                    TFKDPTFFLSHYAPA +IQDKQLQ+            YDLN+DDKVQVHKQ
Sbjct: 776 ESKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQ 835

Query: 817 TATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARE 876
           TATVKWDKKRKKYVN QG+DNKKYIIGESGQKIAASFRSG+FD+W+KAR LKPLKVG+RE
Sbjct: 836 TATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRE 895

Query: 877 SSIPSNLLSDPTQGPGAQN-SVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQ 935
           SSIPSNLL DP+QG G+   +VRGKFKHKQ+KAPK+PDKHRD+Y +QKKKV KAL++G+ 
Sbjct: 896 SSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGIS 955

Query: 936 VRGF-RGPGMKSELKSTEEIRKQRAFME 962
           V+G+   PG+++ELKSTE+IRK R   E
Sbjct: 956 VKGYNNAPGLRNELKSTEQIRKDRNMAE 983

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
           (REAL)
          Length = 1007

 Score = 1367 bits (3539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/994 (69%), Positives = 782/994 (78%), Gaps = 40/994 (4%)

Query: 1   MAPTLKRSR-LEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX------ 53
           MA   KR R L D D     SG E++D  FDIA DIALN                     
Sbjct: 1   MAGVQKRKRDLGDQDG----SGSEEEDAAFDIANDIALNASESDSDDSGSEEEADYGLSG 56

Query: 54  VQDVIEYSXXXXXXXXXXXXXXXXXXXX------------------XXXSFPSLELSXXX 95
           VQDVIEYS                                         +FP+LELS   
Sbjct: 57  VQDVIEYSSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAAAFPTLELSDDE 116

Query: 96  XX---XXXXXXXXXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQ 152
                             YFSTTNL+K+KHKKGSFPSFGLSK +++NI RKGFRQPTPIQ
Sbjct: 117 NSVPGKNQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQ 176

Query: 153 RKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTH 212
           RKTIPLILQ+RDIVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVILSPSRELAMQT 
Sbjct: 177 RKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTF 236

Query: 213 NVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEY 272
           NVFK+F++GT LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEMNLDLKS+EY
Sbjct: 237 NVFKEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEY 296

Query: 273 AVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDA 332
            VFDEADRLFEMGFQEQLNELLASLP++RQTLLFSATLP+SLVDF KAGL NPVLVRLD 
Sbjct: 297 VVFDEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDT 356

Query: 333 ETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFN-AQNIXXXXXXXXX 391
           ETK+SENLEMLF+STKND+REANLLY+LQEVIKIPLA+ +QL K   + N          
Sbjct: 357 ETKVSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDN 416

Query: 392 XXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYG 451
                           +R+P  N+LPSEK+TILFVPTRHHVEYIS LLR+ G+LISYIYG
Sbjct: 417 DRQKKRKNFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYG 476

Query: 452 TLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTA 511
           TLDQHARKRQLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIFVHRVGRTA
Sbjct: 477 TLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTA 536

Query: 512 RAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKP 571
           RAGN+GWAYSIV+E+ELPYLLDLE+FLGKKIL+ PMYDS++ +M K+W+ EG  E  F+P
Sbjct: 537 RAGNKGWAYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQP 596

Query: 572 PKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPE 631
           P +SYT R++LGS PRL++EGLGDLY+N+M SNF++QL K  A+KAE+LY+RTR AASPE
Sbjct: 597 PTLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPE 656

Query: 632 SLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMK 691
           SLKRSKEIIASGWD QN  FGKN EKEKLDFLAKLQNRRNKETVFEF  NPDDEMSV MK
Sbjct: 657 SLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMK 716

Query: 692 RRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQFEDG 751
           RRR+QLAPIQRK++ER ELL+KE++AGL+H++EDE+LKG++ E   YTISED LK+FED 
Sbjct: 717 RRRKQLAPIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGE-TGYTISEDALKEFEDA 775

Query: 752 DELLAGQENXX----XXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNN 807
           D+LL  QEN         TFKDP+FFLSHYAPA +IQDKQL++            YDLN 
Sbjct: 776 DQLLEAQENDSKKKKKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNG 835

Query: 808 DDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKL 867
           DDKVQVHKQTATVKWDKKRKKYVN QGLDNKKYIIGESGQKIAASFRSG+FD+W+KAR L
Sbjct: 836 DDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNL 895

Query: 868 KPLKVGARESSIPSNLLSDPTQGPGAQ-NSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKV 926
           KPLKVG+RESSIPSNLL+DP+QGPGA+  +VRGKFKHKQ+KAPK+PDKHRD+Y TQKKKV
Sbjct: 896 KPLKVGSRESSIPSNLLADPSQGPGARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKV 955

Query: 927 AKALENGVQVRGF-RGPGMKSELKSTEEIRKQRA 959
            KAL++GV VRG+   PG++SELKST++IRK RA
Sbjct: 956 EKALQSGVNVRGYNNAPGLRSELKSTDQIRKDRA 989

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
           (REAL)
          Length = 1001

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/991 (68%), Positives = 777/991 (78%), Gaps = 34/991 (3%)

Query: 1   MAPTLKRSR-LEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX------ 53
           M+   KR R LED D     SG E++D  FDIA DIALN                     
Sbjct: 1   MSGVQKRKRDLEDQDV----SGSEEEDTAFDIANDIALNGSDSDSDGSSSGTEADYGLGD 56

Query: 54  VQDVIEYSXXXXXX------------XXXXXXXXXXXXXXXXXSFPSLELSXXXXXXXXX 101
           VQDVI+YS                                   +FP+LELS         
Sbjct: 57  VQDVIKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAAFPTLELSDDENDASGK 116

Query: 102 XXX---XXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPL 158
                       YFSTTNL+K+KHKKGSFPSFGLSK +++NI RKGFRQPTPIQRKTIPL
Sbjct: 117 TQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIKRKGFRQPTPIQRKTIPL 176

Query: 159 ILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDF 218
           ILQ+RDIVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVILSPSRELAMQT NVFKDF
Sbjct: 177 ILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDF 236

Query: 219 SKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEA 278
           +KGT+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKVEMNLDLKS+EY VFDEA
Sbjct: 237 AKGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEA 296

Query: 279 DRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISE 338
           DRLFEMGFQEQLNELLASLP+ RQTLLFSATLP+SLVDF KAGL NPVLVRLD ETK+SE
Sbjct: 297 DRLFEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSE 356

Query: 339 NLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFN-AQNIXXXXXXXXXXXXXXX 397
           NLEMLFLS+KN +REANLLY+LQEVIKIPLA+ +QL K   + N                
Sbjct: 357 NLEMLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSDSDDENDRHKKK 416

Query: 398 XXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHA 457
                     +++P AN+LPSE++TILFVPTRHHVEYIS LLR+ GYLISYIYGTLDQHA
Sbjct: 417 RNFKKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHA 476

Query: 458 RKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRG 517
           RKRQLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SSKIFVHRVGRTARAGN+G
Sbjct: 477 RKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 536

Query: 518 WAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYT 577
           WAYSIVSE+ELPYLLDLE+FLGKKIL+ PMYD++ D + K+WI EG+ E  F+PPK+SYT
Sbjct: 537 WAYSIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWIDEGNLEFQFQPPKLSYT 596

Query: 578 NRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSK 637
            R++LGS PRL++EGLGDLY+N+M SNF++QL    +MKAEKLY+RTR +ASPESLKRSK
Sbjct: 597 KRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKLYYRTRTSASPESLKRSK 656

Query: 638 EIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQL 697
           EIIASGWD QN  FGKN EKEKLDFLAKLQNRRNKETVFEF  NPDDEM+V MKRRR+QL
Sbjct: 657 EIIASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVLMKRRRKQL 716

Query: 698 APIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQFEDGDELLAG 757
           APIQRKA ER +LL+KE++AGL+H++E+E+LKGD+ E   YT+SE+ LK+FED D+LL  
Sbjct: 717 APIQRKASERRKLLEKERMAGLSHSIENEILKGDDGE-TGYTVSEEALKEFEDADQLLEA 775

Query: 758 QENXX----XXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQV 813
           QEN         TFKDPTFFLSHYAPA +IQDKQLQ+            YDLN DDKVQV
Sbjct: 776 QENDSKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQV 835

Query: 814 HKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVG 873
           HKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKIAASFRSG+FD+W+KAR LKPLK G
Sbjct: 836 HKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKAG 895

Query: 874 ARESSIPSNLLSDPTQGPGAQN-SVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALEN 932
           +RESSIPSNLL+DP+QGPG+   + RGKFKHKQ+KAPK+PDKHRD+Y +QKKKV KAL++
Sbjct: 896 SRESSIPSNLLADPSQGPGSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQS 955

Query: 933 GVQVRGF-RGPGMKSELKSTEEIRKQRAFME 962
           GV V+G    PG+ SELKSTE+IRK R   E
Sbjct: 956 GVNVKGHNNAPGLSSELKSTEQIRKDRVMAE 986

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1341 bits (3470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/950 (69%), Positives = 753/950 (79%), Gaps = 11/950 (1%)

Query: 12  DSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXX-XVQDVIEYSXXXXXXXXX 70
           DSD+E  S+ +      FDIA +IALN                V+D+I YS         
Sbjct: 13  DSDSETESANE------FDIASNIALNSSDSDSDSDVDEQDGEVEDIISYSDDEKSQVEE 66

Query: 71  XXXXXXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLD-KSKHKKGSFPS 129
                          FP LELS                  YFST NL+ K+KHKKGSF S
Sbjct: 67  VPKKSKKEKKVIK-DFPLLELSDDEDSKKQANDNDDDVNSYFSTNNLNTKTKHKKGSFAS 125

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           FGLSK I++NI+++GFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPMIEKLKT
Sbjct: 126 FGLSKLILTNISKRGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKT 185

Query: 190 HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVI 249
           HS KIGARA+ILSPSRELAMQTHNVFK+FSKG+ LRSVLLTGGDSLEDQFGM+M NPDVI
Sbjct: 186 HSSKIGARAIILSPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVI 245

Query: 250 IATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSAT 309
           IATPGRFLHLKVEMNLDLKS+EY  FDEADRLFEMGFQEQLNEL+ SLPS+RQTLLFSAT
Sbjct: 246 IATPGRFLHLKVEMNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSAT 305

Query: 310 LPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLA 369
           LPSSLVDFAKAGLTNPVLVRLD ETKISENLEMLFLS KN+EREANLLYLLQE I IPLA
Sbjct: 306 LPSSLVDFAKAGLTNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLA 365

Query: 370 SRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTR 429
           + +Q+ K N ++                          +RLPPANQLPSEK+TI+FVPTR
Sbjct: 366 TEEQIKKLNNESKIDDDSDSEDDEATRRQKRKSKNFKKQRLPPANQLPSEKATIIFVPTR 425

Query: 430 HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLA 489
           HHVEYIS LL++ GYL+SYIYGTLDQ AR RQLYNFR GLTSILVVTDVAARGVDIPMLA
Sbjct: 426 HHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPMLA 485

Query: 490 NVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYD 549
           NVINFSLP SSK+FVHRVGRTARAGNRGWAYSIVSE+ELPYLLDLE+FLGKKIL+T MYD
Sbjct: 486 NVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMYD 545

Query: 550 SMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQL 609
           +  DIM KKW++EG  E+ F+ PK SYTNRM+LGSAPRL++E L DLY  V+  +F++++
Sbjct: 546 ATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLKM 605

Query: 610 LKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNR 669
           +K  A+KAEKLYFRTR +ASPES+KRSKEII SGWDEQNI FGKN EKEK  FLAKLQNR
Sbjct: 606 MKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQNR 665

Query: 670 RNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLK 729
            NKETVFEFA NPDDEMSV MKRRRRQLAPIQRKA+ER EL++KE+LAGLTH +ED++LK
Sbjct: 666 HNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRIEDQILK 725

Query: 730 GDNAEDNSYTISEDTLKQFEDGDELLAGQENXXXXXTFKDPTFFLSHYAPASDIQDKQLQ 789
           GD+ E   YT+ ED LK+FED D++L          TF+D  FFLSHYAP S IQD+Q +
Sbjct: 726 GDDFE-AGYTVPEDALKEFEDADKVLEASNKKSEQKTFRDENFFLSHYAPTSAIQDQQYK 784

Query: 790 VXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKI 849
           +            YDLN+DDKVQVHKQTATVKWDKKRKKYVN+QG+DNKKYI+GESGQKI
Sbjct: 785 LSTGFTNAAAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIVGESGQKI 844

Query: 850 AASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQ-GPGAQNSVRGKFKHKQLKA 908
           AASFRSGKF+EW+KARKLKPLKVGARES++ +NLLS+PT+     Q +VRGKFKHKQ+K+
Sbjct: 845 AASFRSGKFEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSNGQKTVRGKFKHKQMKS 904

Query: 909 PKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQR 958
           PKLPDK RDDY+ QKKKVA AL  G  V+G+ GPGMK+ELKSTE+IRK+R
Sbjct: 905 PKLPDKFRDDYEKQKKKVASALARGAHVKGYSGPGMKNELKSTEQIRKER 954

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1324 bits (3427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/947 (69%), Positives = 747/947 (78%), Gaps = 12/947 (1%)

Query: 22  DEDQDVGFDIAGD-IALNXXXXXXXXXXXXXXXVQDVIEYSXXXXXXXXXXXXXXXXXXX 80
           + D D   DIAG+ +A                 VQDVIEYS                   
Sbjct: 14  ESDSDEEIDIAGNLVADGSDSESDDSSDGSDEEVQDVIEYSSDEEEPAKPAKAVKKKVED 73

Query: 81  XXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNI 140
               SFPSLELS                  YFS     KSKHKKGSF SFGLSK I+ NI
Sbjct: 74  K---SFPSLELSDDEDEKKKVDNDDDDVNAYFSVNTDAKSKHKKGSFASFGLSKLILVNI 130

Query: 141 TRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVI 200
           +++GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF+LPMIEKLKTHS KIGARA+I
Sbjct: 131 SKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAII 190

Query: 201 LSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLK 260
           LSPSRELAMQTH+VFK+FS+GT LRSVLLTGGDSLEDQFGMMM NPDVIIATPGRFLHLK
Sbjct: 191 LSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGRFLHLK 250

Query: 261 VEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKA 320
           VEMNLDLKS+EYAVFDEADRLFEMGFQEQLNELLA+LPSSRQTLLFSATLP+SLVDFAKA
Sbjct: 251 VEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLVDFAKA 310

Query: 321 GLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQ 380
           GL NPVLVRLDAE+KIS+NLEMLFLSTKNDEREANLLY+LQEVIK+PLA+ +Q+ + N  
Sbjct: 311 GLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIKQLN-- 368

Query: 381 NIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLR 440
           +                          + +P AN+LPSEK+T++FVPTRHHVEY+SNLL+
Sbjct: 369 DNKADDSDESAEEDEDKKRRKRKSFNRKAMPKANELPSEKATVVFVPTRHHVEYLSNLLK 428

Query: 441 ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASS 500
           + GYL+SYIYG LDQHARK QLYNFR GLTSILVVTDVAARGVDIPMLANV+N+SLPASS
Sbjct: 429 DCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPMLANVVNYSLPASS 488

Query: 501 KIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWI 560
           KIF+HRVGRTARAGNRGWAYSIVSE+ELPYLLDLE+FLG+KIL+TPMY+++  +  +KW+
Sbjct: 489 KIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMYEALERLSKEKWV 548

Query: 561 AEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKL 620
           AEG+DE  F+ PK+SYT+RM+LGS PRL++E L +LY N+MKSNF++ + K  A+KAEKL
Sbjct: 549 AEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLDMAKKTALKAEKL 608

Query: 621 YFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFAS 680
           YFRTR +ASPESLKRSKEII+SGWDEQN++FGKN EKEK  FL KLQNRRNKETVFEF  
Sbjct: 609 YFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTR 668

Query: 681 NPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTI 740
           NP+DEM+  M RRRR +APIQRKAKER ELL+KE++AGLTH +EDE+LKGD+AE   YT+
Sbjct: 669 NPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEILKGDDAE-VGYTV 727

Query: 741 SEDTLKQFEDGDELLAGQENXX--XXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXX 798
           +EDTLK FED D +LA QEN       TF+DP FFLSHYAPA++IQDKQL++        
Sbjct: 728 TEDTLKAFEDADTILAEQENASKKKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEA 787

Query: 799 XXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKF 858
               YDLN+DDKVQVHKQTATVKWDKKRKKYVN+ G+DNKKYIIGESGQKIAASFRSGKF
Sbjct: 788 AQSAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKF 847

Query: 859 DEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSV--RGKFKHKQLKAPKLPDKHR 916
           DEW+KARKL PLK GA ESSIPSNLL DPT+GPG   S    GKFKHK  KAP+LPDK R
Sbjct: 848 DEWSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKR 907

Query: 917 DDYQTQKKKVAKALENGVQVRGF-RGPGMKSELKSTEEIRKQRAFME 962
           DDY  QKKKV  ALE G+ V+G+   P  KSELKS  +IRK R   E
Sbjct: 908 DDYHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQIRKDRKTKE 954

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON}
           Anc_3.159 YDL031W
          Length = 1001

 Score = 1311 bits (3392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/956 (67%), Positives = 753/956 (78%), Gaps = 17/956 (1%)

Query: 18  ASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXXVQDVIEYSX---XXXXXXXXXXXX 74
            SS +E+ D   DIAGDIAL                + D+I+YS                
Sbjct: 29  GSSAEEEDDALVDIAGDIAL--ESSDEEEEEDVQGDIADIIDYSDEEPAEAKGKQQKQKQ 86

Query: 75  XXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTN-LDKSKHKKGSFPSFGLS 133
                     +FPSLELS                  YFST N  +K K KKGSF SFGLS
Sbjct: 87  KPSKKSPKENAFPSLELSDDESSKAAGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLS 146

Query: 134 KFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGK 193
           K I+SN+TRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF+LPMIEKLKTHS K
Sbjct: 147 KAILSNVTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSK 206

Query: 194 IGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATP 253
           IG RA+ILSPSRELA+QTHNVFKDFSKGT LRSVLLTGGDSLE+QFGMMM+NPDV+IATP
Sbjct: 207 IGVRAIILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATP 266

Query: 254 GRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSS 313
           GRFLHLKVEMNL LK++EYAVFDEADRLFEMGFQEQLNELLA+LPSSRQTLLFSATLPSS
Sbjct: 267 GRFLHLKVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSS 326

Query: 314 LVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQ 373
           LV+FAKAGLTNPVLVRLDAE+KISENL+MLFLS KNDEREANLLYLLQ VIKIPLA+ +Q
Sbjct: 327 LVEFAKAGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQ 386

Query: 374 LAKFNAQNIXXXXXXXXXXXXXXX------XXXXXXXXXXERLPPANQLPSEKSTILFVP 427
           L K    +                                +RLP AN+LPSE +T++FVP
Sbjct: 387 LKKLRDSDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVP 446

Query: 428 TRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPM 487
           TRHHVEYIS +L++ GYL+SYIYG+LDQ+ARK QLYNFR GLTSILVVTDVAARGVDIPM
Sbjct: 447 TRHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPM 506

Query: 488 LANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPM 547
           LANVIN+SLP+SSKIF+HRVGRTARAGN+GWAY+IVSESELPYLLDLE+FL KK+L+TPM
Sbjct: 507 LANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPM 566

Query: 548 YDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEI 607
            ++ + I+ +KWI +G+DE++FKPP VSYT+R++LGS PRL+LE +GDL++N++++NF++
Sbjct: 567 LEAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDL 626

Query: 608 QLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQ 667
            L+K  ++KAEKLYFRTR  AS ESLKRSKE+IASGWDEQNI+FG N EKEK++FLAKLQ
Sbjct: 627 SLMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQ 686

Query: 668 NRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEV 727
           NRRNKETVFEF+ NPDDEMSVFMKRRRRQLAP+Q+KAKER ELL+KE+ +GL+H++EDE+
Sbjct: 687 NRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSIEDEI 746

Query: 728 LKGDNAE--DNSYTISEDTLKQFEDGDELLAGQ-ENXXXXXTFKDPTFFLSHYAPASDIQ 784
              +N    +  YT+SE+ LKQFED DELL  Q E       +KDP FFLSHYAPA+DIQ
Sbjct: 747 FNQNNNTEMETGYTVSEEALKQFEDADELLQKQSEKKTKPKNYKDPNFFLSHYAPAADIQ 806

Query: 785 DKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGE 844
           DKQLQV            YDLN+DDKVQVHKQTATVKWDKKRKKYVN+QG+DNKKYIIGE
Sbjct: 807 DKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGE 866

Query: 845 SGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPT--QGPGAQNSVRGKFK 902
           SGQKIAASFRSGKFDEW+KAR +KPLKVGA+E SI ++LL DPT         +  GK+K
Sbjct: 867 SGQKIAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNISGNRTASGKYK 926

Query: 903 HKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQR 958
           HKQ KAPKLPDKHRD+Y +QKKK+A A+E G  V+GF GPG +SELKST +IRK R
Sbjct: 927 HKQDKAPKLPDKHRDNYHSQKKKIASAMERGTYVKGFNGPGTQSELKSTAQIRKGR 982

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/960 (68%), Positives = 745/960 (77%), Gaps = 24/960 (2%)

Query: 15  AEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXX------XXXVQDVIEYSXXXXXXX 68
           AE  SS DED    FDIAGDIALN                     VQDVIE+S       
Sbjct: 11  AEDYSSEDED---AFDIAGDIALNADSEDSDISDDDNDNIGFQAEVQDVIEFSSDEEEKE 67

Query: 69  XXXXXXXXXXXXXX----XXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDKSKHKK 124
                                FPSLELS                  YF+TT    +KHKK
Sbjct: 68  KKPKKQNKKAKVKAGPIVDSKFPSLELSDDEKKATNESDDDLND--YFNTTADAAAKHKK 125

Query: 125 GSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 184
           GSF SFGLSK ++ NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPMI
Sbjct: 126 GSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185

Query: 185 EKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
           EKLKTHS KIG RAVILSPSRELA+QTH VFK+FSKG+ LRS+LLTGGDSLEDQFGMMM 
Sbjct: 186 EKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTL 304
           NPDV+IATPGRFLHLKVEMNLDLKS+EY VFDEADRLFEMGFQEQLNELL + P++RQTL
Sbjct: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVI 364
           LFSATLPSSLVDFAKAGL+NPVLVRLDAETKISENLEMLF+S K DEREANLLYLLQE I
Sbjct: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365

Query: 365 KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTIL 424
           K+P+A+  Q+ K   QN                           RLP AN++PSEK+TI+
Sbjct: 366 KMPVATESQIKKLKQQN--DADSDSDDSEDEKKKKAKKAKKSKRRLPNANEMPSEKATIV 423

Query: 425 FVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVD 484
           FVPTRHHVEY++ LL+  GYL+SYIYG L+QHARK+QLYNFR GLTSILVVTDVAARGVD
Sbjct: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483

Query: 485 IPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILM 544
           IP+LANVIN+SLP SSKIF+HRVGRTARAGNRGWA+SIVSE+ELPYLLDLE+FLGKKIL+
Sbjct: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILL 543

Query: 545 TPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSN 604
           TPMY+S   I+ KK  +EG++  NF  PKVSYT RM+LG+ PR E++G+GDLY N++KS+
Sbjct: 544 TPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSD 601

Query: 605 FEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLA 664
           FE+  +KGVA+KAEKLYFRTR  AS ES+KRSKEI+ SGWDEQNI FGKNAEKEKLDFLA
Sbjct: 602 FELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLA 661

Query: 665 KLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTME 724
           KLQ+R NKETVFEFA NPDDEMSV MKRRRRQ+APIQRKAKER ELL+KE++ GL H++E
Sbjct: 662 KLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIE 721

Query: 725 DEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQEN--XXXXXTFKDPTFFLSHYAPASD 782
           DE+LKG++ E   Y++ ++ LK+FED D LL  QEN       TF+DPTF+LSH+AP SD
Sbjct: 722 DEILKGEDNE-VGYSVPDEVLKEFEDADVLLEEQENIKKKQKKTFRDPTFYLSHFAPTSD 780

Query: 783 IQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYII 842
           IQDKQLQ+            +DL NDDKVQVHKQTATVKWDKKRKKYVN QGLDNKKYII
Sbjct: 781 IQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYII 840

Query: 843 GESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFK 902
           GESGQKI ASFRSGKF +W+KARK+ PLKVGARES+IPSNLL+DPT    ++ +V GKFK
Sbjct: 841 GESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTS--PSERTVGGKFK 898

Query: 903 HKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAFME 962
           HK  KAPKLPDKHRDDY  QKKKV  ALE GV+V+G+ GPGMK E+KS +EIRK R   E
Sbjct: 899 HKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDEIRKLREIKE 958

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1287 bits (3330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/948 (67%), Positives = 748/948 (78%), Gaps = 25/948 (2%)

Query: 22  DEDQDVGFDIAGDIALNXXXXXXXXXXXXXXXVQDVIEYS------XXXXXXXXXXXXXX 75
           DE +D  FDIAG+IAL                VQD+IE+S                    
Sbjct: 16  DEGED--FDIAGNIAL-DSEDSDDSVSDSDNEVQDIIEFSDDEKQNAPQVSKTAKGAKGA 72

Query: 76  XXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTN-LDKSKHKKGSFPSFGLSK 134
                    +FPSLELS                  YF+TT+ L  SK KKGSF SFGLSK
Sbjct: 73  KVAAPRSDAAFPSLELSDGEDADNGDKDDVDS---YFNTTSQLAASKAKKGSFASFGLSK 129

Query: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKI 194
           FI+ NI+RKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LP+IEKLK HS KI
Sbjct: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI 189

Query: 195 GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPG 254
           GARA+ILSPSRELAMQTH VFK+F+KG+ LRSVLLTGGD LEDQF MMM+NPDVIIATPG
Sbjct: 190 GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPG 249

Query: 255 RFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSL 314
           RFLHLKVEMNLDL SIEY VFDEADRLFEMGFQEQLNELL SLP++RQTLLFSATLPSSL
Sbjct: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSL 309

Query: 315 VDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQL 374
           VDFAKAGLTNPVLVRLD ETK+SENLEMLFLS KNDEREANLLYLLQEVIKIP+A+ +QL
Sbjct: 310 VDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL 369

Query: 375 AKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEY 434
            +F  Q+                          + LP A  +PS  STI+FV TRHHVEY
Sbjct: 370 QRFRKQS----NDDADDSDDETDKKKKHSKKSKQPLPSAKDMPSPNSTIIFVSTRHHVEY 425

Query: 435 ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 494
           +SNLL++ GYL+SY+YGTLDQHAR++QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N 
Sbjct: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485

Query: 495 SLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDI 554
           SLPASSKIFVHRVGRTARAGN+GWAY+I+SESELPYLLDLE+FLGKK+L+TPMY++  D+
Sbjct: 486 SLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMYEATCDL 545

Query: 555 MLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVA 614
           + KKWI+EG++   F+PPK+SY NR+ILGSAPRL+LE +GDL++N+++SNFE+Q LK V+
Sbjct: 546 LKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVS 605

Query: 615 MKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKET 674
           +KAEKLY RTR  AS ES+KR+KE+IA+GWDEQN+ FGKN EKEKL+FLAKLQNR NKET
Sbjct: 606 IKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKET 665

Query: 675 VFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAE 734
           VFEFA N DDEM++ MKRRRRQ+APIQ++AKER +LL+KE+ AGL HT+EDE+LKG+  E
Sbjct: 666 VFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILKGEENE 725

Query: 735 DNSYTISEDTLKQFEDGDELLAGQENXXXXXTFKDPTFFLSHYAPASDIQDKQLQVXXXX 794
              Y++ ++ L+ FED DEL A +        F+D  F+LSH+APASDIQDKQLQV    
Sbjct: 726 -VGYSVPQELLRDFEDADELAAKRNT---KKGFRDENFYLSHFAPASDIQDKQLQVASSF 781

Query: 795 XXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFR 854
                   +DL+NDDKVQVHKQTATVKWDKKRKKYVNVQG+DNKKYIIGESGQKI ASFR
Sbjct: 782 TNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFR 841

Query: 855 SGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDK 914
           SGKFDEW+KARKL PLKVGARESSIP+NLL+DPT          GKFKHKQ+KAPK+PDK
Sbjct: 842 SGKFDEWSKARKLAPLKVGARESSIPANLLADPT----GSRLANGKFKHKQIKAPKMPDK 897

Query: 915 HRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAFME 962
           +RDDYQ+Q KKV KA+E+G+ V+G+  PGMK EL++TE+IRKQR+  E
Sbjct: 898 NRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1286 bits (3328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/964 (65%), Positives = 757/964 (78%), Gaps = 20/964 (2%)

Query: 6   KRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX------VQDVIE 59
           KRSR      ++A S DED     DIAG+IAL+                     VQD+IE
Sbjct: 7   KRSR-----QQSALSDDED----VDIAGNIALDSSDSSSSSDNDDDGSEDEAGDVQDIIE 57

Query: 60  YSXXXXXXXXXXXXXXXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDK 119
           +S                        FP+LELS                  YFST N + 
Sbjct: 58  FSDEDEEEARAKAAPQKKKKNAHEGGFPALELSDNEDHDDGKDGADDVTE-YFSTNNPEA 116

Query: 120 SKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 179
           +KHKKGSF SFGLSKFI+SNI +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF
Sbjct: 117 AKHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF 176

Query: 180 ILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQF 239
           +LPMIEKLK HS KIGARAVILSPSRELAMQTH VF++FS+G+ LRSVLLTGG+SLE+QF
Sbjct: 177 VLPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQF 236

Query: 240 GMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS 299
           G+MM+NPDV+IATPGRFLHLKVEMNLDLKS+EY VFDEADRLFEMGF+EQL+ELLA+LP 
Sbjct: 237 GLMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPV 296

Query: 300 SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYL 359
           +RQTLLFSATLPSSLV+FAKAGLTNPVLVRLDAETK+SENLEMLFLS+KN+EREANLLYL
Sbjct: 297 ARQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYL 356

Query: 360 LQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
           LQE +KIP+A+ +QL ++ A+                           ++LP AN+LPSE
Sbjct: 357 LQEAMKIPVATEEQLLEYKAKVKNSYDSDDSDEDAKAKAKKQRKSAIRKKLPSANELPSE 416

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
            +TI+FVPTRHHVEYIS LL++ GYL+SY+YGTLDQHAR++QL+NFR GLT+ILVVTDVA
Sbjct: 417 HATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVA 476

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARGVDIP+LANV+N+SLPASSKIFVHRVGRTARAGN+G+AYSIVSE+ELPYLLDLE+FLG
Sbjct: 477 ARGVDIPLLANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLG 536

Query: 540 KKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQN 599
           KKIL+TPM+++ ++++  KWIAEG+ E+ F PPKVSYTNRM+LG+ PRL+LE  GDL++N
Sbjct: 537 KKILLTPMFEATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKN 596

Query: 600 VMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEK 659
           + +S+F++Q LKGVA KAEKLYFRTRP AS +S+KRSKE+IASGWDEQN+ FGKN EKEK
Sbjct: 597 LTQSSFDLQQLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEK 656

Query: 660 LDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGL 719
           LDFLAKLQNR NKETVFEFA N DDEMS+ MK+RR Q+APIQR+AKER ELL+KE++AGL
Sbjct: 657 LDFLAKLQNRNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGL 716

Query: 720 THTMEDEVLKGDNAEDNSYTISEDTL-KQFEDGDELLAGQENXXXXXTFKDPTFFLSHYA 778
            HT+EDE+LKGD  E   Y++ E+ L ++F+D DELL  Q       +F+DP FFLSHYA
Sbjct: 717 RHTVEDEILKGDENE-VGYSVPEEVLHREFQDADELLGAQSKSKRPKSFRDPAFFLSHYA 775

Query: 779 PASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNK 838
           PAS+IQDKQL+V            +DL+NDDKVQ HKQ AT KWDKKR+KYVN QGLDNK
Sbjct: 776 PASEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGLDNK 835

Query: 839 KYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVR 898
           KYI+GESG KI ASFRSGKFDEW+KARKL PLKVGA+ESS  + +LS+PT     Q S+ 
Sbjct: 836 KYIMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKESSTTAKMLSNPT--AEGQRSIG 893

Query: 899 GKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQR 958
           G+FKH +++APKLPDKHRDDY  QKKKV KA+ +G+ V+G+  PGMKSE++ST++I K+R
Sbjct: 894 GRFKHNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIPVKGYNAPGMKSEMRSTQQIYKER 953

Query: 959 AFME 962
              E
Sbjct: 954 VAKE 957

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1285 bits (3326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/944 (66%), Positives = 742/944 (78%), Gaps = 13/944 (1%)

Query: 28  GFDIAGDIALNXXXXXXXXXXXXXXX--VQDVIEYSXXXXXXXXXXXXXXXXXXXXXXXS 85
           GFDI  +I LN                 VQD++++S                       S
Sbjct: 23  GFDITSNIGLNTADSSDESESSGDDEEEVQDIVDFSDEEDTKKKPKSSNKTLTDNN---S 79

Query: 86  FPSLELS--XXXXXXXXXXXXXXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITRK 143
           FPSLE+S                    YFS  N +KSKHKKGSFPSFG SK I+SN+ +K
Sbjct: 80  FPSLEISDDEDSNNKGDHEDDDDDLNDYFSINNSEKSKHKKGSFPSFGFSKLILSNVHKK 139

Query: 144 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSP 203
           GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPMIEKLK+HS KIGARAVILSP
Sbjct: 140 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIGARAVILSP 199

Query: 204 SRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEM 263
           SRELA+QTH VFK+FSKGT LRSVLLTGGDSLEDQF MMM+NPDVI+ATPGRFLHLKVEM
Sbjct: 200 SRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGRFLHLKVEM 259

Query: 264 NLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLT 323
           +LDLK++EY VFDEADRLFEMGFQEQLNELLA+LP +RQTLLFSATLPSSLVDFAKAGLT
Sbjct: 260 SLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLVDFAKAGLT 319

Query: 324 NPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAK---FNAQ 380
           NPVLVRLDAETKISENLE+LFLSTKN+ERE NLLYLLQ+VIKIPL + DQ+ K   FN  
Sbjct: 320 NPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIKKLSDFNKS 379

Query: 381 NIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLR 440
                                       ++  +N+LP+EKSTI+F PTRHHVEYI+ LL+
Sbjct: 380 LSDSDSEDEDNKGKQNSRKSKKGKFQKLKVSASNELPTEKSTIVFAPTRHHVEYITQLLK 439

Query: 441 ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASS 500
           +SG+L+SY+YGTLDQHARKRQL NFR GLTSILVVTDVAARGVDIPMLANVIN+SLPASS
Sbjct: 440 DSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPASS 499

Query: 501 KIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWI 560
           KIF+HRVGRTARAGNRGWAYSIVSE+ELPY+LDLE+FLGKKIL+T MY++   +M  KWI
Sbjct: 500 KIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMYEASCKLMKSKWI 559

Query: 561 AEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKL 620
           A+G+ E +F+ PK+SYTNR++LGSAPR ++E +GDLY+N+++SNF++Q+ K V++KAEKL
Sbjct: 560 ADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQMAKKVSLKAEKL 619

Query: 621 YFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFAS 680
           Y RTR AASPES+KRSKE+IASGWDEQNI FG+N EKEKL+FLAK QNRRNKETVFEF  
Sbjct: 620 YCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQNRRNKETVFEFGK 679

Query: 681 NPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTI 740
           NP+D+ ++ M++RR+Q+APIQRKA++R ELL KE++AGLTH +EDE+LKG++ E   Y++
Sbjct: 680 NPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKIEDEILKGEDHE-AGYSV 738

Query: 741 SEDTLKQFEDGDELLAGQENX--XXXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXX 798
            E+ LK FED D++L  QE+       TF+DP FF+SHYAPA DIQDKQLQ+        
Sbjct: 739 PEEALKSFEDADKILEEQESSRKKKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFTNDA 798

Query: 799 XXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKF 858
               YDLN+DDKVQVHKQTATVKWDKKRKKYVN+QG+DNKKYIIGESGQKI ASF+SGKF
Sbjct: 799 AQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKSGKF 858

Query: 859 DEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDKHRDD 918
            EW+K+R +K +K GARE+SIP+NLLSDPT   G+Q    G+FKHKQ KAP+LPDK RDD
Sbjct: 859 AEWSKSRNIKGIKTGARETSIPTNLLSDPTTDSGSQRGPGGRFKHKQNKAPRLPDKFRDD 918

Query: 919 YQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAFME 962
           YQ+QKKKV  A+E GV V+GF G    +ELK+T +IRK+R   E
Sbjct: 919 YQSQKKKVQSAIERGVSVKGFGGSSGNTELKTTAQIRKERMAKE 962

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar
           to uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
           Essential protein involved in ribosome biogenesis
           putative ATP-dependent RNA helicase of the DEAD- box
           protein family
          Length = 1003

 Score = 1281 bits (3315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/989 (66%), Positives = 759/989 (76%), Gaps = 43/989 (4%)

Query: 4   TLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXX----XXVQDVIE 59
           +LKR R  +S+  +    +E++DV FDIAGDIAL+                   VQDVIE
Sbjct: 5   SLKRKR--ESNNPSVEEEEEEEDV-FDIAGDIALDSSEDDDDDDDDGEQDSEQEVQDVIE 61

Query: 60  YSXXXXXXXXXXXXXXXXXXXXXXX--------SFPSLELSXXXXXXXXXXXXXXXXXXY 111
           +S                               SFP+LELS                  Y
Sbjct: 62  FSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPRPSFPTLELSDAEDEAPDADKDAVND--Y 119

Query: 112 FSTTNLDK-SKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMAR 170
           FSTT      KHKKGSFPSFG SKFI++NI+RKGFRQPTPIQRKTIPLILQ RDIVGMAR
Sbjct: 120 FSTTAAAAAGKHKKGSFPSFGFSKFILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMAR 179

Query: 171 TGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLT 230
           TGSGKTAAF LPMIEKLK HS KIG RAVILSPSRELAMQT+ VFK+FS+G+ LRSVLLT
Sbjct: 180 TGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLT 239

Query: 231 GGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           GGDSLE+QFGMMM NPDV+IATPGRFLHLKVEMNLDLK++EY VFDEADRLFEMGFQEQL
Sbjct: 240 GGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQL 299

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           NELLA+LP +RQTLLFSATLP SLVDFAKAGLTNPVLVRLDAE+K+SENLEMLFL+TKN 
Sbjct: 300 NELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNG 359

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           EREANLLYLLQEVI+IP+A+ +QL +  A N                          + +
Sbjct: 360 EREANLLYLLQEVIRIPVATAEQLKQLRALNDRSDSDADSDANDKNDRKKRKKQARRK-M 418

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           P AN+LPSEK+TILFVPTRHHVEY+S LL++SGYL+SYIYGTLDQ+ARK+QL+NFR+GLT
Sbjct: 419 PSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT 478

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
           SILVVTDVAARGVDIPMLANVINFSLP+SSKIF+HRVGRTARAGN GWAYSIVSE+ELPY
Sbjct: 479 SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPY 538

Query: 531 LLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLEL 590
           LLDLE+FLGKKIL+ PMYD+  ++M K+W+AEG  E  F  P+VSYTNRM+LGS PRLE+
Sbjct: 539 LLDLELFLGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEM 598

Query: 591 EGLGDLYQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIM 650
           E +GDLY+N+++S+F++QLLK VA+KAEKLYFRTR  AS E++KRSKEIIASGWDEQN+ 
Sbjct: 599 ESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLK 658

Query: 651 FGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHEL 710
           FGKN EKEKLDFLAKLQNR +KETVFEFA N +DEM+V M+RRRRQ+APIQRKA+ER EL
Sbjct: 659 FGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQEL 718

Query: 711 LQKEKLAGLTHTMEDEVLKGDNAEDNSYTISEDTLKQ-FEDGDELLAGQEN--------- 760
           L+KE++AGL HT+EDEVLKG + E   Y++ E+ L Q FED D++L  QEN         
Sbjct: 719 LEKERMAGLRHTLEDEVLKGGDGE-FGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKT 777

Query: 761 -----------XXXXXTFKDPTFFLSHYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDD 809
                           T+KDP FFLSHYAPA DIQDKQLQ+            +DL++D+
Sbjct: 778 RQGETKPKPKPKPKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDN 837

Query: 810 KVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSGKFDEWTKARKLKP 869
           KVQVHKQTATVKWDKKRKKYVN QGLDNKKYIIGESGQKI ASFRSGKF EW+KARKL P
Sbjct: 838 KVQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGP 897

Query: 870 LKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKA 929
           LKVGARE+S PSNLLSDP    G +    G+FKHK  KAPKLPD+HRDDY+TQ+KKVA A
Sbjct: 898 LKVGARETSGPSNLLSDPAS--GGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANA 955

Query: 930 LENGVQVRGFRGPGMKSELKSTEEIRKQR 958
           LE G+ V+GF  PG KSE+KSTE+IR QR
Sbjct: 956 LERGISVKGFGAPGAKSEMKSTEQIRSQR 984

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1259 bits (3258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/954 (66%), Positives = 727/954 (76%), Gaps = 23/954 (2%)

Query: 25  QDVGFDIAGDIALNXXXXXXXXXXXXXXX------VQDVIEYSXXXXXXXXXXXXXXXXX 78
           +D G DIA  IA N                     VQD+IEYS                 
Sbjct: 20  EDNGVDIAKSIAFNASGSDSSDDSDEEDDFKVDDGVQDLIEYSDEETTEKEVKKTKKASN 79

Query: 79  XXXXXXSFPSLELSXXXXXXXXXXXX----XXXXXXYFSTTNLDKSKHKKGSFPSFGLSK 134
                  FP LE+S                      YFST   DKSKHKKGSFPSFGLSK
Sbjct: 80  ------PFPLLEMSDDEDDKNSKNSAFNDDADDVNDYFSTNMQDKSKHKKGSFPSFGLSK 133

Query: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKI 194
            I+SNI +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFILPMIEKLKTHSGKI
Sbjct: 134 LILSNINKKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHSGKI 193

Query: 195 GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPG 254
           GARAVILSPSRELAMQTH VFKDFS+G+QLRSVLLTGGDSLE+QF MMM+NPDVI+ATPG
Sbjct: 194 GARAVILSPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPG 253

Query: 255 RFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSL 314
           RF+HLKVEM LDLK++EY VFDEADRLFEMGFQEQLNELLASLP +RQTLLFSATLP+SL
Sbjct: 254 RFMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSL 313

Query: 315 VDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQL 374
           VDFAKAGLTNPVLVRLDAE+KISENL++ F STKN+EREA LLY+LQ+VI + + + +++
Sbjct: 314 VDFAKAGLTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEI 373

Query: 375 AKFNAQNIXX----XXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRH 430
            K  A N                               +LP AN+LPSEK+TI+FVPTRH
Sbjct: 374 KKLTASNKRSDEIDSDNEREQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFVPTRH 433

Query: 431 HVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLAN 490
           HVEYISNLL++ GYL+SY+YGTLDQHARK QL+NFR GLTSILVVTDVAARGVDIPMLAN
Sbjct: 434 HVEYISNLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPMLAN 493

Query: 491 VINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDS 550
           VIN+SLPASSKIFVHRVGRTARAGN+GWAYSI SE+ELPYLLDLE+FLGKKIL+T MY++
Sbjct: 494 VINYSLPASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMYEA 553

Query: 551 MSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLL 610
              +   KWIA G++E  F+PPK SYT+RMILGS PRLELE +GDLY+N+M ++F++Q+ 
Sbjct: 554 TCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQMA 613

Query: 611 KGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRR 670
           K  ++KAEKLYFRTR AASPES+KR KE+IASGWDEQ+IMFGKN EKEKLDFL+K QNR 
Sbjct: 614 KKTSLKAEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQNRN 673

Query: 671 NKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKG 730
           NKETVFEF  NP D  +V M RRRRQLAPIQRKA ER +LL+KE+LAGL+H +EDE+LKG
Sbjct: 674 NKETVFEFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDEILKG 733

Query: 731 DNAEDNSYTISEDTLKQFEDGDELLAGQE-NXXXXXTFKDPTFFLSHYAPASDIQDKQLQ 789
           ++ E + YTIS++ L  FED D+LL  QE       T+KDP FFLSHYAPA DIQDKQL 
Sbjct: 734 EDHE-SGYTISKEALAAFEDADKLLQEQEKKKRKPKTYKDPQFFLSHYAPAKDIQDKQLN 792

Query: 790 VXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKI 849
           +            YDLNNDDKVQVHKQTA +KWDK RKKYVN+ GLDNKKYIIGE GQKI
Sbjct: 793 LTSGFTNDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKI 852

Query: 850 AASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAP 909
            ASF+SG+FDEW+KAR +KPLK G RE SIP+NLL+D T       +  G+FKHKQ KAP
Sbjct: 853 PASFKSGRFDEWSKARHIKPLKAGVREDSIPTNLLADVTGPSDGSRTFGGRFKHKQNKAP 912

Query: 910 KLPDKHRDDYQTQKKKVAKALENGVQVRGFRG-PGMKSELKSTEEIRKQRAFME 962
           +LPDKHRDDY++QKKKV  ALE GVQV+G+     +KSELK+  +IRK+R   E
Sbjct: 913 RLPDKHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNE 966

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1256 bits (3251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/967 (64%), Positives = 753/967 (77%), Gaps = 21/967 (2%)

Query: 4   TLKRSRLEDSDAEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX-----VQDVI 58
           TLKRSR ED  ++       ++DV  DIAG+IAL+                    VQD+I
Sbjct: 5   TLKRSRREDPLSD-------EEDV--DIAGNIALDSDESSESEDDSEDGEGEEGDVQDII 55

Query: 59  EYS--XXXXXXXXXXXXXXXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTN 116
           ++S                         SFP LELS                  YF+TTN
Sbjct: 56  DFSGDEEETSKNAKKTGKAEKKPSSKQASFPLLELSDDEEEQAANDGEDDVTE-YFTTTN 114

Query: 117 LDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKT 176
            + SKHKKGSF SFGLSKFIISNI +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKT
Sbjct: 115 AEASKHKKGSFASFGLSKFIISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKT 174

Query: 177 AAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           AAF+LPMIE+LK HS KIGARAVI+SPSRELA+QTH VF++FS+G+ LRSVLLTGG+SLE
Sbjct: 175 AAFVLPMIERLKGHSAKIGARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLE 234

Query: 237 DQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
           +QFG+MM+NPDV+IATPGRFLHLKVEMNLDLKSIEY VFDEADRLFEMGF+EQLNELLA+
Sbjct: 235 EQFGLMMSNPDVVIATPGRFLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAA 294

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANL 356
            P +RQTLLFSATLPSSLVDFAKAGLT+PVLVRLD ETK+SENLEML+LS+KN+EREANL
Sbjct: 295 FPVARQTLLFSATLPSSLVDFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANL 354

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
           LYLLQE ++IP+A+ +QLA++  +                            ++P AN+L
Sbjct: 355 LYLLQEAMQIPVATEEQLAEYRTKIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANEL 414

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
           PSE +TI+FVPTRHHVEYI+ LL++ GYL+SY+YGTLDQHAR++QL+NFR GLT+ILVVT
Sbjct: 415 PSEHATIVFVPTRHHVEYITQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVT 474

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEI 536
           DVAARGVDIPMLANV+N+SLPASSKIFVHRVGRTARAGN+G AYSIVS++ELPYLLDLE+
Sbjct: 475 DVAARGVDIPMLANVVNYSLPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLEL 534

Query: 537 FLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDL 596
           FLGKKIL+TPMY++ ++++  +WIAEG  E+ F  PKVSYTNRM+LG+ PRLELE  GDL
Sbjct: 535 FLGKKILLTPMYEATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDL 594

Query: 597 YQNVMKSNFEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAE 656
           +++++ S+F+++ LK VA KAEKLYFRTRP AS +S+KRSKE+++SGWDEQN+ FGKN E
Sbjct: 595 FKSLIDSSFDLKQLKAVANKAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNME 654

Query: 657 KEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKL 716
           KEKLDFLAKLQNR +KETVFEFA N DDEM++ MK+RR Q+APIQR+AKER ELL+KE+ 
Sbjct: 655 KEKLDFLAKLQNRHHKETVFEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERK 714

Query: 717 AGLTHTMEDEVLKGDNAEDNSYTISEDTLKQ-FEDGDELLAGQENXXXXXTFKDPTFFLS 775
           AGL H++EDE+LKGD  E   Y++ E+ L Q FED DELL GQ+      +F+DPT+FLS
Sbjct: 715 AGLVHSVEDEILKGDETE-VGYSVPEEVLHQEFEDADELLEGQKKEKKQKSFRDPTYFLS 773

Query: 776 HYAPASDIQDKQLQVXXXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGL 835
           HYAPAS+IQDKQL+V            +DL+NDDKVQ HKQ AT+KWDKKR+KYVN QGL
Sbjct: 774 HYAPASEIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGL 833

Query: 836 DNKKYIIGESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQN 895
           DNKKYI GESG KI ASFRSGKFDEW+KARKL P+KVGARESS  S +LS+PT     Q 
Sbjct: 834 DNKKYITGESGHKIPASFRSGKFDEWSKARKLGPIKVGARESSSTSKMLSNPTS--NNQR 891

Query: 896 SVRGKFKHKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIR 955
              GKFKH ++KAPKLPDK+RDDY  QKKKV KA+ +G++V+GF  PGMKSE+++ ++I 
Sbjct: 892 MGGGKFKHNKVKAPKLPDKNRDDYHVQKKKVEKAISSGIRVKGFNAPGMKSEMRTPQQIY 951

Query: 956 KQRAFME 962
           K+R   E
Sbjct: 952 KERVAKE 958

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1226 bits (3171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/954 (64%), Positives = 726/954 (76%), Gaps = 22/954 (2%)

Query: 15  AEAASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXXXX-VQDVIEYSXXXXXXXXXXXX 73
           ++ + SG E+    +DI  DIALN                 QD+IEYS            
Sbjct: 16  SDGSESGSEED---YDIVNDIALNSSDSDEDDSSEDSEGGEQDIIEYSDEEEEHQHEKKK 72

Query: 74  XXXXXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDKSKHKKGSFPSFGLS 133
                      SFP LE S                  YFSTT     KHKKGSFPSFGLS
Sbjct: 73  SAPKDK-----SFPKLEASGDEAEDDADDVNE-----YFSTTAQTNKKHKKGSFPSFGLS 122

Query: 134 KFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGK 193
           K I++NI+RKGF QPTPIQRKTIPLILQ+RDIVG+ARTGSGKTAAFILPMIEKLK+HS K
Sbjct: 123 KLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSK 182

Query: 194 IGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATP 253
           +GARAVILSPSRELAMQTH VFKDFS+GT LRSVLLTGGDSLE+QFGMMM+NPDVI+ATP
Sbjct: 183 VGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATP 242

Query: 254 GRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSS 313
           GRFLHLKVEMNLDLKSIEYAVFDE+DRLFEMGF+EQLNELLA+LPS+RQTLLFSATLP+S
Sbjct: 243 GRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNS 302

Query: 314 LVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQ 373
           LVDFAKAGLTNPVLVRLD E+KISENLEMLFLSTK+DEREA LLYL+QEVI+IPLA+ +Q
Sbjct: 303 LVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQ 362

Query: 374 LAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVE 433
           +     ++                           R+P ANQLPSEKSTILFVPTRHHVE
Sbjct: 363 IKLIKDKSPDSDEESDDDNGKRSHNKHKKEKFKKVRMPAANQLPSEKSTILFVPTRHHVE 422

Query: 434 YISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVIN 493
           YI+NLL+  GYL+SYIYG+LDQ AR RQLYNFR GLTSILVVTDVAARGVDIPMLANVIN
Sbjct: 423 YIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN 482

Query: 494 FSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSD 553
           FS P+SSKIFVHRVGRTARAGNRGWAYSI+SESELPYLLDLE+FLGKKIL TPMY++ +D
Sbjct: 483 FSFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMYEAATD 542

Query: 554 IMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGV 613
           ++ K+W+ EG ++I FK PK SYTNR++LGS PRL+++ +GDLY+N+M S+FE++ L+GV
Sbjct: 543 LLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGV 601

Query: 614 AMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKE 673
           A KAEKLY RTR AAS ES+KRS+E++ SGWDEQN+MFGKN EKEKLDFLAKLQ+R NKE
Sbjct: 602 AKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKE 661

Query: 674 TVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNA 733
           TVFEFA N DDE S+ MK+RR Q+API  KAK+R ELL+ +K AG +H MEDE+L  DN 
Sbjct: 662 TVFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAMEDELL-NDN- 719

Query: 734 EDNSYTISEDTLKQFEDGDELLAGQE--NXXXXXTFKDPTFFLSHYAPASDIQDKQLQVX 791
           E    ++ E+ L++FED D+LL  QE        +F+DP FFLSHYAP   + + +L + 
Sbjct: 720 ELIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLT 779

Query: 792 XXXXXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAA 851
                       D+N DDKVQVHKQ ATVKWD K+KKY+N QG DNKKYI+GESGQKI A
Sbjct: 780 SGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPA 839

Query: 852 SFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQG--PGAQNSVRGKFKHKQLKAP 909
           SFRSGK+ EW+KAR L+P+KVGARES   +N+L +P Q      Q +V GKFKHKQ+KAP
Sbjct: 840 SFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAP 899

Query: 910 KLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGM-KSELKSTEEIRKQRAFME 962
           KLPDKHRDDY  QKKKV +AL+ G+ V+G+   G  K+EL+S  +IRKQR   E
Sbjct: 900 KLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSE 953

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1226 bits (3171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/945 (65%), Positives = 724/945 (76%), Gaps = 19/945 (2%)

Query: 29  FDIAGDIALNXXXXXXX--XXXXXXXXVQDVIEYSXXXXXXXXXXXXXXXXXXXXXXXSF 86
           FDIAG+IAL                   QDVI+YS                        F
Sbjct: 22  FDIAGNIALTSSESEGEDGSDEDSEENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKH-DF 80

Query: 87  PSLELSXXXXXXXXXXXX----XXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFIISNITR 142
           P LELS                      YF+T N +  KHKKGSFPSFG SKFI++NI +
Sbjct: 81  PILELSDNEEDADAKKKKEDGDADDISEYFTTNNSESKKHKKGSFPSFGFSKFILNNINK 140

Query: 143 KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILS 202
           KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF+LPMIEKLK HS KIGARAVILS
Sbjct: 141 KGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILS 200

Query: 203 PSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVE 262
           PSRE+AMQT+ VFK+FSKG+ LRSVLLTGGDSLEDQFGMMM+NPDV++ATPGRFLHLKVE
Sbjct: 201 PSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVE 260

Query: 263 MNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGL 322
           MNL+LKS+EYAVFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLP++LVDFAKAGL
Sbjct: 261 MNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGL 320

Query: 323 TNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQ---LAKFNA 379
           TNPVLVRLDAE+KISENLEMLF+STK+DEREANL YLLQEVIKIPLA+ +Q   L + N 
Sbjct: 321 TNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNK 380

Query: 380 QNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLL 439
                                        +LP AN+LPSEK+TI+FVPTRHHVEYIS LL
Sbjct: 381 ALSDSEDSDAENGKKDRRKKGKKNKAKRPKLPSANELPSEKATIVFVPTRHHVEYISQLL 440

Query: 440 RESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPAS 499
           +  GYL+SYIYGTLDQHAR+RQLYNFR GLTSILVVTDVAARGVDIPMLANVINF++P+S
Sbjct: 441 KACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSS 500

Query: 500 SKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKW 559
           SKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLE+FLGKKIL+ PMY++  +++ +KW
Sbjct: 501 SKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMYEATCNLLKEKW 560

Query: 560 IAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEK 619
           + EG+DE  F+PPKVSYT+RM+LGS PR+ELE +GDLY+N+M SN+++   +GV++KAE 
Sbjct: 561 VNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEI 620

Query: 620 LYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFA 679
           +Y RTR  AS ES+KR+K++I SGWDEQNI+FGKN E EK  FLAKLQ+RRNKETVFEFA
Sbjct: 621 MYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFA 680

Query: 680 SNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYT 739
            NPDD+MSV MK+RR+QL P+Q +AK+R EL++KEKLAGLTH++EDEVL     E   Y+
Sbjct: 681 RNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGE-VGYS 739

Query: 740 ISEDTLKQFEDGDELLAGQENX-----XXXXTFKDPTFFLSHYAPASDIQDKQLQVXXXX 794
           + +  L++FED D++L  QE           +FKD  FF+SHYAPA  +QD QL +    
Sbjct: 740 VPDAVLEEFEDADQVLEDQETEGKKQKQKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGF 799

Query: 795 XXXXXXXXYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFR 854
                   YDLN+DDK+QVHKQTATVKWDKK+KKYVN QG DN +YI  ESGQKI AS+R
Sbjct: 800 TTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNPQGADNVRYITSESGQKIPASYR 859

Query: 855 SGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDK 914
           SGKFDEW+K RKLK  KVG+RESS+ +NLL DPT+G  + N+ R  F HKQ+KAPK+PDK
Sbjct: 860 SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRR--FMHKQVKAPKVPDK 917

Query: 915 HRDDYQTQKKKVAKALENGVQVRGF-RGPGMKSELKSTEEIRKQR 958
           +RDDY  QK KVAKALE G+ V+G    PGM +EL+S ++IRKQR
Sbjct: 918 YRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQR 962

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/953 (54%), Positives = 644/953 (67%), Gaps = 54/953 (5%)

Query: 18  ASSGDEDQDVGFDIAGDIALNXXXXXXXXXXXXX-XXVQDVIEYSXXXXXXXXXXXXXXX 76
            +S  E+ D   DI  +IALN                VQD IEYS               
Sbjct: 3   TTSDIEESDSEIDIGQNIALNSDSSSDSESDNSSETEVQDEIEYSDNQEEEVKEDKRTDK 62

Query: 77  XXXXXXXXSFPSLELSXXXXXXXXXXXXXXXXXXYFSTTNLDKSKHKKGSFPSFGLSKFI 136
                    FP L+                    YF+TT+LD  K KKGSF SFG ++FI
Sbjct: 63  ENNTKSKNDFPQLD------GNVEVESDDDDINDYFATTHLDTKKFKKGSFASFGFNRFI 116

Query: 137 ISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGA 196
           ++NI +KG++QPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPMIEKLKTHS KIG 
Sbjct: 117 MNNINKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIGV 176

Query: 197 RAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRF 256
           R VILSPSRE+A+QTH VFK+FSK T+LRSVLLTGGDSLEDQFGMMM+NPDV+IATPGRF
Sbjct: 177 RGVILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGRF 236

Query: 257 LHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVD 316
           LHLKVEM LDLKS+EY VFDEADRLFEMGF+EQLNELLA+LP +RQ+LLFSATLP+SLV+
Sbjct: 237 LHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLVE 296

Query: 317 FAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAK 376
           FAKAGL NPVLV+LD E+KIS+NLEMLFLS K +ERE+NLL+LLQ+VI +P+AS +++ +
Sbjct: 297 FAKAGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMKR 356

Query: 377 FNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYIS 436
           F   +                           +   ++++P E++TI+FVPTRHHVEYIS
Sbjct: 357 FQTDS------REVEEKEEKEKEKGKEKEKRAKYYKSDEIPHEQATIIFVPTRHHVEYIS 410

Query: 437 NLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSL 496
            LL + GYL+SY+YGTLDQHAR+ QL  F  G+T ILVVTDVAARGVDIP+L NVIN+SL
Sbjct: 411 QLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLLPNVINYSL 470

Query: 497 PASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIML 556
           P SSKIFVHRVGRTARAGNRGWAYSIVSESELPYL++L  FLGKK++ T M + +     
Sbjct: 471 PGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMVEKLG---- 526

Query: 557 KKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMK 616
                     ++F   K+SY   M+LGS PR+++E  GDLY+NV    F++Q+ K    K
Sbjct: 527 ----------VSF--DKISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEK 574

Query: 617 AEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVF 676
           AEKLY RTR  AS +S+KRSKE+I   WD QN+ FG++ E+ KL+ L K   R+NKETVF
Sbjct: 575 AEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFALRKNKETVF 634

Query: 677 EFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDN 736
           EF  N +DEMS  M RR + +  I+RKAK R E+ ++E+         +E L   +    
Sbjct: 635 EFGKNGEDEMSTLMNRRWKVVKGIERKAKRRREMKEEEEGGVEEELQFEEELGSGSGPGP 694

Query: 737 SYTISEDTLKQ------FEDGDELLAGQENXXXXXTFKDPTFFLSHYAPASDIQDKQLQV 790
                +D +        FEDGD +L GQ       TFKD  FFLSHYA    ++++  +V
Sbjct: 695 GQGPGQDLVDAGNYNGVFEDGDAILNGQ--TKKRKTFKDERFFLSHYADPKKVENE--EV 750

Query: 791 XXXXXXXXXXXXYDLNNDDKVQVHKQ-TATVKWDKKRKKYVNVQGLDNKKYIIGESGQKI 849
                       YDLNND+K+QVHKQ +ATVKWD+KRKKYVN+QG+DNKKYIIGESG+KI
Sbjct: 751 VDGFINAASEASYDLNNDEKIQVHKQSSATVKWDRKRKKYVNLQGIDNKKYIIGESGRKI 810

Query: 850 AASFRSGKFDEWTKARKLKP---LKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQL 906
            A+FRSGK++EW KAR +     ++VGARE        S+ +   G +    G+FKHK  
Sbjct: 811 PATFRSGKYEEWAKARNINTRNVMRVGARE--------SEGSVVGGGRGGGGGRFKHKLD 862

Query: 907 KAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRA 959
           K PK+PDK+RDDY+ QK+K  +A+E GV ++G R  G K ELK+  EIRK R 
Sbjct: 863 KKPKMPDKYRDDYKKQKEKNERAVERGV-MKGKR--GYKDELKNVAEIRKNRV 912

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  234 bits (596), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 224/420 (53%), Gaps = 62/420 (14%)

Query: 114 TTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGS 173
           + N  K  HK  +F    LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 197 SENAKKEVHK--TFNDLALSRPVMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 254

Query: 174 GKTAAFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTG 231
           GKTAAF++P+IE+L     K+ + R ++L+P+RELA+Q  +V K   +  + L   L  G
Sbjct: 255 GKTAAFMIPIIERLLYKPAKVASTRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVG 314

Query: 232 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           G +L  Q  M+   PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++L
Sbjct: 315 GLNLRQQEQMLKTRPDIVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDEL 374

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KN 349
           NE+++ LPS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K 
Sbjct: 375 NEIMSLLPSKRQTLLFSATMNSRIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKR 434

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
           D  + +LL+ L                                                +
Sbjct: 435 DHLKPSLLFNL----------------------------------------------IRK 448

Query: 410 LPPANQLPSEKSTILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFR 466
           L P  Q    K  ++FV  +   H +  I  LL   G  ++ ++G+L Q  R   +  F+
Sbjct: 449 LDPNGQ----KRIVVFVARKDMAHKLRIILGLL---GMAVAELHGSLTQEQRLDSVNKFK 501

Query: 467 TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           +    +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V E+
Sbjct: 502 SLQVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFVGEA 561

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  233 bits (593), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/409 (34%), Positives = 217/409 (53%), Gaps = 56/409 (13%)

Query: 122 HKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFIL 181
           HK  +F S  LS+ ++  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++
Sbjct: 232 HK--TFNSLSLSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMI 289

Query: 182 PMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQF 239
           P+IE+L      I + R V+L+P+RELA+Q  +V K+  K    L   L  GG +L  Q 
Sbjct: 290 PIIERLLYKPAHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQE 349

Query: 240 GMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP 298
             +   PD++IATPGRF+ HL+   +  + S+E  V DEADR+ E GFQE+L E+++ +P
Sbjct: 350 QALKTRPDIVIATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIP 409

Query: 299 SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANLL 357
           S RQTLLFSAT+ S +       L  PV + +D   + ++ L   F+   K D  +  LL
Sbjct: 410 SKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKRDHLKPALL 469

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
           Y L  + K+   S+ ++  F A+                                     
Sbjct: 470 YQL--IRKLDNTSQKRIVVFVARK------------------------------------ 491

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
                     T H +  +  LL   G  +  ++G+L Q  R + + NF++    +L+ TD
Sbjct: 492 ---------ETAHKLRIVLGLL---GMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTD 539

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           +A+RG+DIP +  VINF +P + +I++HRVGRTARAG  G + + V ES
Sbjct: 540 LASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVTFVGES 588

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  232 bits (592), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/408 (34%), Positives = 216/408 (52%), Gaps = 60/408 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 215 NFNSLSLSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 274

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLEDQFGMMM 243
           +L     KI + R ++L P+RELA+Q  +V K  ++  + +   L  GG +L  Q  M+ 
Sbjct: 275 RLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLK 334

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           + PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++LNE++  LPS+RQ
Sbjct: 335 SRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQ 394

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANLLYLLQ 361
            LLFSAT+ S +       L  PV + +D   K +  L   F+   K D  +  LL+ L 
Sbjct: 395 NLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNL- 453

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                                                          +L P  Q    K 
Sbjct: 454 ---------------------------------------------IRKLDPVGQ----KR 464

Query: 422 TILFVP---TRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
            ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+     +L+ TD+
Sbjct: 465 IVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDL 521

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V ES
Sbjct: 522 ASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFVGES 569

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  232 bits (592), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 142/408 (34%), Positives = 216/408 (52%), Gaps = 60/408 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 232 NFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLEDQFGMMM 243
           +L     KI + R ++L P+RELA+Q  +V K  ++  + +   L  GG +L  Q  M+ 
Sbjct: 292 RLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLK 351

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           + PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++LNE++  LPS+RQ
Sbjct: 352 SRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQ 411

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANLLYLLQ 361
            LLFSAT+ S +       L  PV + +D   K +  L   F+   K D  +  LL+ L 
Sbjct: 412 NLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNL- 470

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                                                          +L P  Q    K 
Sbjct: 471 ---------------------------------------------IRKLDPTGQ----KR 481

Query: 422 TILFVP---TRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
            ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+     +L+ TD+
Sbjct: 482 IVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDL 538

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V ES
Sbjct: 539 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGES 586

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  231 bits (590), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 219/416 (52%), Gaps = 60/416 (14%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D  K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ LQ +D++  A TGSGKTA
Sbjct: 232 DAKKQTHETFNSLSLSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGKTA 291

Query: 178 AFILPMIEKLKTHSGKIG-ARAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSL 235
           AF++P+IE+L     K+   R ++L+P+RELA+Q  +V K   +  + L   L  GG +L
Sbjct: 292 AFMIPIIERLLFKPSKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSGLTFGLAVGGLNL 351

Query: 236 EDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             Q   +   PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++L E++
Sbjct: 352 RQQEQALKARPDIVIATPGRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKEIM 411

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDERE 353
             LPS RQ LLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +
Sbjct: 412 TMLPSKRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAASKLTQEFVRIRKRDNLK 471

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
             LL+ L             + K ++                                  
Sbjct: 472 PALLFNL-------------IRKLDSN--------------------------------- 485

Query: 414 NQLPSEKSTILFVP---TRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
               ++K  ++FV    T H +  I  LL   G  ++ ++G+L Q  R   +  F++   
Sbjct: 486 ----AQKRIVVFVARKETAHRLRIILGLL---GMAVAELHGSLTQEQRLESVTRFKSLDV 538

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
            +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + ++V ES
Sbjct: 539 PVLICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLVGES 594

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  231 bits (588), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/411 (34%), Positives = 219/411 (53%), Gaps = 54/411 (13%)

Query: 120 SKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAF 179
           +K     F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF
Sbjct: 214 TKQVHNDFNSLSLSRPVLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTAAF 273

Query: 180 ILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLED 237
           ++P+IE+L     KI + R ++L+P+RELA+Q  +V K   K  + L   L  GG +L  
Sbjct: 274 MIPIIERLLYKPAKIASTRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNLRQ 333

Query: 238 QFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
           Q   +   PD+++ATPGRF+ H++   + ++ S+E  V DEADR+ E GFQE+LNE+L+ 
Sbjct: 334 QEQSLKARPDIVVATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEILSL 393

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREAN 355
           LPS RQTLLFSAT+ S +       L  PV V +D   + +  L   F+   K D  + +
Sbjct: 394 LPSKRQTLLFSATMNSKIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFVRIRKRDHLKPS 453

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           +L+ L  + K+    + ++  F A+                                   
Sbjct: 454 VLFHL--IKKLDGTGQKRMVVFVARK---------------------------------- 477

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
                         H +  I  LL   G  +  ++G+L Q  R + +  F++    ILV 
Sbjct: 478 -----------EMAHRLRIILGLL---GISVGELHGSLSQEQRLQSVNQFKSLEVPILVC 523

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           TD+A+RG+DIP +  VIN+ +P + ++++HRVGRTARAG  G + S+V ES
Sbjct: 524 TDLASRGLDIPKIEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLVGES 574

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  230 bits (586), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/416 (34%), Positives = 219/416 (52%), Gaps = 60/416 (14%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D  K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 216 DAKKQMYDNFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTA 275

Query: 178 AFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSL 235
           AF++P+IE+L    GKI + R ++L P+RELA+Q  +V K  ++  + +   L  GG +L
Sbjct: 276 AFMIPIIERLLYKPGKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGGLNL 335

Query: 236 EDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             Q  ++ + PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++LNE++
Sbjct: 336 RQQEQLLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM 395

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDERE 353
             LPS+RQ LLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +
Sbjct: 396 GLLPSNRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKRDHLK 455

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
             LL+ L                                                +L P 
Sbjct: 456 PALLFNL----------------------------------------------IRKLDPM 469

Query: 414 NQLPSEKSTILFVP---TRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
            Q    K  ++FV    T H +  I  LL   G  +  ++G+L Q  R   +  F+    
Sbjct: 470 GQ----KRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEV 522

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
            +LV TD+A+RG+DIP +  V+N+ +P S +I++HRVGRTARA   G + ++V ES
Sbjct: 523 PVLVCTDLASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLVGES 578

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  230 bits (587), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 219/413 (53%), Gaps = 54/413 (13%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D  K    SF +  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 242 DAKKQTHTSFNTLSLSRPVLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGKTA 301

Query: 178 AFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSL 235
           AF++P+IE+L     K+ + R ++L+P+RELA+Q  +V K   K    L   L  GG +L
Sbjct: 302 AFMIPIIERLLFKPAKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGLNL 361

Query: 236 EDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             Q  ++   PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQE+LNE++
Sbjct: 362 RQQEQILKQRPDIVIATPGRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNEIM 421

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN-DERE 353
             LP+ RQT+LFSAT+ S +       L  PV + ++   + +  L   F+  +  D  +
Sbjct: 422 QLLPTKRQTMLFSATMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQEFVRIRTRDHLK 481

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
             LL+ L  + K+   S+ ++  F A+                                 
Sbjct: 482 PALLFNL--IKKLDEYSQKRMVVFVARK-------------------------------- 507

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                         T H +  I  LL   G  ++ ++G+L Q  R   +  F++    +L
Sbjct: 508 -------------ETAHKLRIILGLL---GMNVAELHGSLTQEQRLESVTKFKSLEIPVL 551

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           + TD+A+RG+DIP +  VIN+ +P S  I++HRVGRTARAG  G + S+V ES
Sbjct: 552 ICTDLASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLVGES 604

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  229 bits (585), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 135/406 (33%), Positives = 217/406 (53%), Gaps = 56/406 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 238 NFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 297

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQFGMMM 243
           +L     K+ + R ++L+P+RELA+Q  +V K   K    L   +  GG +L  Q  ++ 
Sbjct: 298 RLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVGGLNLRQQEQILK 357

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ+++NE++  LPS RQ
Sbjct: 358 TRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEINEIMHLLPSKRQ 417

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDE--REANLLYLL 360
           T+LFSAT+ S +       L  PV V  D   +    L+  F+  +  +  + + L YL+
Sbjct: 418 TMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKRDHLKPSTLFYLI 477

Query: 361 QEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
           +                                               +L  A Q    K
Sbjct: 478 K-----------------------------------------------KLDGAAQ----K 486

Query: 421 STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
             ++FV  +  V  +  +L   G  ++ ++G+L+Q  R + +  F++    +L+ TD+A+
Sbjct: 487 RMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTDLAS 546

Query: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + S V E+
Sbjct: 547 RGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFVGET 592

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  223 bits (569), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 154/444 (34%), Positives = 224/444 (50%), Gaps = 65/444 (14%)

Query: 117 LDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKT 176
           +D+ +    SF    L   +I      GF +PTPIQ K IP  L+  DI+G+A+TGSGKT
Sbjct: 77  IDEGEQTFDSFSDLNLVPELIEACKNLGFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKT 136

Query: 177 AAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           AAF +P++ +L  H  +    A IL+P+RELA Q    F        +R+  + GG ++ 
Sbjct: 137 AAFAIPILNRL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGALMGVRATCIVGGMNMM 194

Query: 237 DQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           DQ   +M  P +IIATPGR + HL+      L+ + + V DEADRL +M F   L+ +L 
Sbjct: 195 DQARDLMRKPHIIIATPGRLMDHLENTRGFSLRKLRFLVMDEADRLLDMEFGPVLDRILK 254

Query: 296 SLPS-SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
            +P+  R T LFSAT+ S +    +A LTNPV   +  + +  + L    +      +  
Sbjct: 255 IIPTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNT 314

Query: 355 NLLYLLQEVI--KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
            L+YLL E I   + + +R    K NA+ I                              
Sbjct: 315 FLIYLLNEFIGKTVIVFTR---TKANAERI------------------------------ 341

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
                   ST+             NLL  S    + ++G L+Q+ R   L  F+ G  SI
Sbjct: 342 --------STLC------------NLLEFSA---TALHGDLNQNQRTGALDLFKAGKRSI 378

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLL 532
           LV TDVAARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L
Sbjct: 379 LVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELIL 438

Query: 533 DLEIFLGKKILMTPMYDSMSDIML 556
            +E  LGKK+   P  +   DI+L
Sbjct: 439 RIEDVLGKKL---PKENVDKDIIL 459

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  229 bits (584), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 142/407 (34%), Positives = 215/407 (52%), Gaps = 58/407 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 238 NFNSLSLSRPVLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIE 297

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGDSLEDQFGMMM 243
           +L     KI + R ++L P+RELA+Q  +V K  ++    +   L  GG +L  Q  M+ 
Sbjct: 298 RLLYKPAKIASTRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVGGLNLRQQEQMLK 357

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           + PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++LNE++  LPSSRQ
Sbjct: 358 SRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSSRQ 417

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            LLFSAT+ S +       L  PV + +D   K +  L                    QE
Sbjct: 418 NLLFSATMNSKIKSLVSLSLKRPVRIMIDPPKKAATKLT-------------------QE 458

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
            ++I    RD L      N+                          +L P  Q    K  
Sbjct: 459 FVRI--RKRDHLKPALIFNL------------------------IRKLDPMAQ----KRI 488

Query: 423 ILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           ++FV  +   H +  I  LL   G  +  ++G+L Q  R   +  F+     +L+ TD+A
Sbjct: 489 VVFVARKESAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVSKFKNLEVPVLICTDLA 545

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           +RG+DIP +  VIN+ +P S ++++HRVGRTARAG  G + + V ES
Sbjct: 546 SRGLDIPKIEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFVGES 592

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  223 bits (569), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 148/421 (35%), Positives = 214/421 (50%), Gaps = 62/421 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSDLDLVPELIEACKNLNFAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILN 146

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 147 RL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRK 204

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 264

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEF 324

Query: 364 I--KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           I   I + +R    K NA+ I                                       
Sbjct: 325 IGKTIIVFTR---TKANAERITT------------------------------------- 344

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
                        ++NLL  S    + ++G L+Q+ R   L  F+ G  SILV TDVAAR
Sbjct: 345 -------------LANLLEFSA---TALHGDLNQNQRTGSLDLFKAGRRSILVATDVAAR 388

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKK 541
           G+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LGKK
Sbjct: 389 GLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKK 448

Query: 542 I 542
           +
Sbjct: 449 L 449

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  223 bits (567), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 151/421 (35%), Positives = 210/421 (49%), Gaps = 62/421 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 76  SFNELDLVPELIQACHNLNFSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 135

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           KL     +    A IL+P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 136 KL--WEDQQPYYACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRK 193

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 194 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTT 253

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  E L    +      +   L+YLL E 
Sbjct: 254 YLFSATMTSKIEKLQRASLTNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEF 313

Query: 364 I--KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           I   I + +R    K NA                            ERL   + L    S
Sbjct: 314 IGKSIIVFTR---TKANA----------------------------ERLSALSNLLEFSS 342

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           T L                         +G L+Q+ R   L  F+ G   ILV  DVAAR
Sbjct: 343 TAL-------------------------HGDLNQNQRTGALDLFKAGKRQILVAIDVAAR 377

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKK 541
           G+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LGKK
Sbjct: 378 GLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKK 437

Query: 542 I 542
           +
Sbjct: 438 L 438

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  228 bits (581), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/408 (34%), Positives = 219/408 (53%), Gaps = 60/408 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F +  LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 221 NFNTLSLSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAAFMIPIIE 280

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQFGMMM 243
           +L      I + R ++L+P+RELA+Q  +V K   K    L   L  GG +L  Q   + 
Sbjct: 281 RLLYKPANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLRQQEQELK 340

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PDV+IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQE+LNE+++ LP+ RQ
Sbjct: 341 TRPDVVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMSLLPTKRQ 400

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANLLYLLQ 361
           TLLFSAT+ S +       L  PV + ++   + +  L   F+   K D  +  LLY L 
Sbjct: 401 TLLFSATMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKPALLYYL- 459

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                       + K ++                                      S+K 
Sbjct: 460 ------------IRKLDSS-------------------------------------SQKR 470

Query: 422 TILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
            ++FV  +   H +  I  LL   G  ++ ++G+L Q  R + +  F++    +L+ TD+
Sbjct: 471 IVVFVSRKEMAHRLRIIMGLL---GMKVAELHGSLTQEQRLQSVNQFKSLEVPVLICTDL 527

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V ES
Sbjct: 528 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGES 575

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  225 bits (574), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 143/417 (34%), Positives = 220/417 (52%), Gaps = 62/417 (14%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D  K    +F +  LS+ ++  ++  GF +P+PIQ  TIP+ L  +DIV  A TGSGKTA
Sbjct: 207 DAKKQTHTTFNTLNLSRPVLKGLSSLGFTKPSPIQSATIPIALLGKDIVAGAVTGSGKTA 266

Query: 178 AFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKD---FSKGTQLRSVLLTGGD 233
           AF++P+IE+L     K+ + R VIL+P+RELA+Q  +V K    F  G  L   L  GG 
Sbjct: 267 AFMIPIIERLLYKPAKVASTRVVILTPTRELAIQISDVAKKIGHFVNG--LTFGLAVGGL 324

Query: 234 SLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
           +L  Q  ++ + PD++IATPGRF+ H++   +  +  +E  V DEADR+ E GFQ++L+E
Sbjct: 325 NLRQQEQILKSRPDIVIATPGRFIDHVRNSASFSVDRVEILVLDEADRMLEEGFQDELSE 384

Query: 293 LLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER 352
           ++  LP+ RQ LLFSAT+ S +       L  PV + +D   + ++ L            
Sbjct: 385 IMTLLPTRRQNLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAADRL------------ 432

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
                  +QE ++I    RD L      N+                          +L  
Sbjct: 433 -------VQEFVRI--RKRDHLKPALLYNLI------------------------RKLDS 459

Query: 413 ANQLPSEKSTILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
             Q    K  ++FV  +   H +  I  LL   G  ++ ++G+L Q  R   +  F++  
Sbjct: 460 TGQ----KRIVVFVSRKEVAHRLRIILGLL---GMGVAELHGSLSQEQRLDSVNKFKSLD 512

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
             +L+ TD+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V ES
Sbjct: 513 VPVLICTDLASRGLDIPKIEIVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGES 569

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  225 bits (574), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/410 (33%), Positives = 216/410 (52%), Gaps = 54/410 (13%)

Query: 121 KHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           K    +F +  LS+ ++  +   G+ +P+PIQ   IP+ L  +DI+  A TGSGKTAAF+
Sbjct: 232 KQVHNTFNTLSLSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFM 291

Query: 181 LPMIEKLKTHSGKI-GARAVILSPSRELAMQTHNVFKDFSKGTQLRSV-LLTGGDSLEDQ 238
           +P+IE+L     K+   R ++L+P+RELA+Q  +V K   K     +  L  GG +L  Q
Sbjct: 292 IPIIERLLYKPAKVTSTRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFGLAVGGLNLRQQ 351

Query: 239 FGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASL 297
              + + PD+++ATPGRF+ H++   + ++ S+E  V DEADR+ E GFQ++LNE+++ L
Sbjct: 352 EQQLKSRPDIVVATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLL 411

Query: 298 PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANL 356
           PS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +  L
Sbjct: 412 PSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLKPAL 471

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
           LY L  + K+  A + ++  F A+                                    
Sbjct: 472 LYTL--IRKLDGAGQKRIVVFVARK----------------------------------- 494

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
                      T H +  I  LL   G  +  ++G+L Q  R   +  F++    +L+ T
Sbjct: 495 ----------ETAHKLRIILGLL---GQSVGELHGSLTQEQRLDSVNKFKSLEVPVLLCT 541

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           D+A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V E+
Sbjct: 542 DLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGEA 591

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  225 bits (573), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/408 (34%), Positives = 217/408 (53%), Gaps = 60/408 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+IE
Sbjct: 220 TFNSLSLSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIE 279

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLEDQFGMMM 243
           +L     KI + R ++L+P+RELA+Q  +V K   K  + L   L  GG +L  Q   + 
Sbjct: 280 RLLYKPAKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALK 339

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PD++IATPGR + H++   +  + S+E  V DEADR+ E GFQ++LNE+++ +PS RQ
Sbjct: 340 LRPDIVIATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQ 399

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER-EANLLYLLQ 361
           TLLFSAT+ S +       L  PV + +D   + +  L   F+  +  E  +  LLY L 
Sbjct: 400 TLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHL- 458

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                       L K ++                                       +K 
Sbjct: 459 ------------LRKLDS-------------------------------------TGQKR 469

Query: 422 TILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
            ++FV  +   H +  I  LL   G     ++G+L Q  R + + NF++    +LV TD+
Sbjct: 470 IVVFVARKEVAHRLRVILGLL---GMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDL 526

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VIN+ +P + +I++HRVGRTARAG  G + ++V ES
Sbjct: 527 ASRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARAGREGKSVTLVGES 574

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  224 bits (572), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/405 (33%), Positives = 215/405 (53%), Gaps = 54/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE
Sbjct: 224 SFNSLSLSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAYMIPIIE 283

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQFGMMM 243
           +L     ++ + R V+L+P+RELA+Q  +V K   K    L   L  GG +L  Q   + 
Sbjct: 284 RLLYKPAQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQQEQTLK 343

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PD++IATPGRF+ H++   +  + S+E  V DEADR+ E GF ++LNE+++ +PS RQ
Sbjct: 344 LRPDIVIATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSLIPSKRQ 403

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KNDEREANLLYLLQ 361
           TLLFSAT+ S +       L  PV + +D   + +  L   F+   K D  +  LL+ L 
Sbjct: 404 TLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPALLFHL- 462

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
            + KI   S+                                                K 
Sbjct: 463 -IRKIDETSQ------------------------------------------------KR 473

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++FV  +     +  +L   G  ++ ++G+L Q  R + + +F++    +L+ TD+A+R
Sbjct: 474 IVVFVSRKEMAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTDLASR 533

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+DIP +  VINF +P + +I++HRVGRTARAG  G + S V ES
Sbjct: 534 GLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFVGES 578

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  218 bits (555), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 142/421 (33%), Positives = 213/421 (50%), Gaps = 62/421 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 80  SFSELKLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 139

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 140 QL-WHDQQ-PYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 197

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      ++ ++Y V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 198 PHIIIATPGRLMDHLENTKGFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 257

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 258 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 317

Query: 364 I--KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           +   + + +R    K NA+ I                                       
Sbjct: 318 LGKTVIIFTR---TKANAERIST------------------------------------- 337

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
                        + NLL  S    + ++G L+Q+ R   L  F+ G  SILV TDVAAR
Sbjct: 338 -------------LCNLLEFSS---TALHGDLNQNQRTGALDLFKAGRRSILVATDVAAR 381

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKK 541
           G+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG+K
Sbjct: 382 GLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGRK 441

Query: 542 I 542
           +
Sbjct: 442 L 442

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  222 bits (565), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 222/420 (52%), Gaps = 62/420 (14%)

Query: 114 TTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGS 173
           +T   K+ H   +F S  LS+ ++  +    + +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 214 STEAKKTVHT--NFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGS 271

Query: 174 GKTAAFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQLRSV-LLTG 231
           GKTAA+++P+IE+L     +I + R ++L+P+RELA+Q  +V    +K     S  L  G
Sbjct: 272 GKTAAYMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVG 331

Query: 232 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           G +L  Q   + + PD++IATPGR + H++   + ++ S+E  V DEADR+ E GFQ++L
Sbjct: 332 GLNLRQQEQTLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDEL 391

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST-KN 349
           NE+++ +PS RQTLLFSAT+ S +       L  PV + +D   + +  L   F+   K 
Sbjct: 392 NEIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKR 451

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
           DE +  LL+ L       +   D L+                                  
Sbjct: 452 DELKPALLFHL-------IRKLDDLS---------------------------------- 470

Query: 410 LPPANQLPSEKSTILFVPTR---HHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFR 466
                    +K  ++FV  +   H +  I  LL   G  ++ ++G+L Q  R + +  F+
Sbjct: 471 ---------QKRVVVFVARKEVAHKLRIILGLL---GMKVAELHGSLSQEQRLQAVNGFK 518

Query: 467 TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           +    +L+ TD+A+RG+DIP +  VIN+ +P +  I++HRVGRTARAG  G + S V ES
Sbjct: 519 SLQVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFVGES 578

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  221 bits (563), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 132/406 (32%), Positives = 217/406 (53%), Gaps = 56/406 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE
Sbjct: 216 NFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTAAYMIPIIE 275

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQFGMMM 243
           +L     ++ + R ++L+P+RELA+Q  +V    +K    +   L  GG +L  Q   + 
Sbjct: 276 RLLYKPAQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNLRQQEQALR 335

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PDV+IATPGR + H++   + ++ S+E  V DEADR+ E GFQ++LNE+++ +PS RQ
Sbjct: 336 ARPDVVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLIPSKRQ 395

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENL--EMLFLSTKNDEREANLLYLL 360
           TLLFSAT+ S +       L  PV + +D   + +  L  E + +  ++D + A L +L+
Sbjct: 396 TLLFSATMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLKPALLFHLI 455

Query: 361 QEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
           +                                               +L  A+Q    K
Sbjct: 456 R-----------------------------------------------KLDDASQ----K 464

Query: 421 STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
             ++FV  +     +  +L   G  ++ ++G+L Q  R + +  F++    +L+ TD+A+
Sbjct: 465 RVVVFVARKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTDLAS 524

Query: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           RG+DIP +  VINF +P +  I++HRVGRTARAG  G + S V ES
Sbjct: 525 RGLDIPKIEFVINFDMPKTYDIYLHRVGRTARAGREGRSISFVGES 570

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  214 bits (546), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/430 (30%), Positives = 224/430 (52%), Gaps = 51/430 (11%)

Query: 116 NLDKSKHKKGSFP-------SFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVG 167
           NLD  K K    P         GL+  ++  IT+  GFR  TPIQ + IP I+   D++G
Sbjct: 270 NLDNIKVKGHDCPKPITKWSQLGLNTDVMDLITKDFGFRSLTPIQSQAIPAIMDGHDVIG 329

Query: 168 MARTGSGKTAAFILPMIEKLKTHS----GKIGARAVILSPSRELAMQTHN-VFKDFSKGT 222
           +++TGSGKT +++LP+I  +K  +     + G   +IL+P+RELA+Q H  + K  S  T
Sbjct: 330 ISKTGSGKTISYLLPLIRHIKAQNPLMKNETGPLGLILAPTRELALQIHQEIIKFISTDT 389

Query: 223 QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMN---LDLKSIEYAVFDEAD 279
            + S+  TGG  L+ Q   +     +++ATPGR + L    N   + +K + + + DEAD
Sbjct: 390 AITSICCTGGSELKQQINSLKKGVHIVVATPGRLIDLLTLNNGRLMSIKRVTFVIMDEAD 449

Query: 280 RLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISEN 339
           RLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L +FA   L +P+ + +++++ ++E 
Sbjct: 450 RLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLRNFAMRILRDPLSITINSQSLVNER 509

Query: 340 LEMLFLSTKNDEREAN-LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXX 398
           ++  F    NDE + + LL +++E    P+ + D L K   +                  
Sbjct: 510 VQQRFHICANDEEKFDELLAMIEENSSEPIETTD-LGKEEEE------------------ 550

Query: 399 XXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHAR 458
                             P ++ TI+FV ++   ++I   L   GY    I+       R
Sbjct: 551 ---------------EHTPQDRKTIIFVASQQICDFIGTKLENEGYQPFSIHAGKSYQER 595

Query: 459 KRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGW 518
            + L NF++   SILV T+V +RG++I  ++ VI F+   +   +VH  GRTAR  + G 
Sbjct: 596 VQNLENFKSTKNSILVATEVLSRGLNITEVSLVIIFNAVKTFAQYVHTTGRTARGNHSGV 655

Query: 519 AYSIVSESEL 528
           A S++  +EL
Sbjct: 656 AISLILPNEL 665

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  207 bits (528), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 202/404 (50%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIREL 230

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 IRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A+  L +P+ V++ + E   S N+  L                  
Sbjct: 291 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQLV----------------- 333

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           EV+      RD+L K                                 L  A+Q   E  
Sbjct: 334 EVVS-EFEKRDRLVKH--------------------------------LDTASQ-DKESK 359

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FRTG + I+V TDVAAR
Sbjct: 360 ILIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAAR 419

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  V+N+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 420 GIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE 463

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  210 bits (535), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 216/416 (51%), Gaps = 62/416 (14%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+  I++ IT    F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+ 
Sbjct: 109 WSQLGLTTDIMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLR 168

Query: 186 KLKT-------HSGKIGARAVILSPSRELAMQTHNVFKDFSKG-TQLRSVLLTGGDSLED 237
           ++K         SG +G   +IL+P+RELA+Q H     F KG T+LRS+  TGG  L+ 
Sbjct: 169 QIKALRPLAREESGPLG---LILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQ 225

Query: 238 QFGMMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
           Q   +    ++++ATPGRF+ L + +N    ++ + I + V DEADRLF++GF+ Q+ E+
Sbjct: 226 QINDLKKGVEIVVATPGRFIDL-LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEI 284

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
           + ++   +Q +LFSAT PS L  FA   L  PV + +++++ I+EN+E      +NDE +
Sbjct: 285 MKTVRPDKQCVLFSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEK 344

Query: 354 AN-LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
            N LL +L+  I     S D                                        
Sbjct: 345 FNSLLEVLKAQINREAESHDD--------------------------------------- 365

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
                 ++ TI+FV ++   + I   L +  Y    I+     H R   L  F+     I
Sbjct: 366 -----KDEKTIIFVSSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGI 420

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
           L+ T+V +RG+++P ++ V+ ++   +   +VH  GRTAR   +G A S++   EL
Sbjct: 421 LLCTEVLSRGLNVPEVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLLLRDEL 476

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  205 bits (522), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 206/406 (50%), Gaps = 56/406 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   I + I+   F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 103 SFDELSLDSKIQAAISV--FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 160

Query: 186 KLKTHSGKI-GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
           KL T  GK  G + +++SP+RELA Q ++      +   L    + GG    +Q    + 
Sbjct: 161 KLVTEDGKKKGVQVLVISPTRELASQIYDNMILLIEKADLECCCVYGGVPKYEQ-REKLK 219

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASL-PSSRQT 303
              V++ATPGR L L  E ++DL ++ Y V DEADR+ E GF+E +  ++ S   SSRQT
Sbjct: 220 KAQVVVATPGRLLDLMQEGSVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSSRQT 279

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND--EREANLLYLLQ 361
           L+F+AT P  + + A   +++PV V +    ++S N  +  +    D  ++E  LL LL+
Sbjct: 280 LMFTATWPKEVRELASTFMSDPVKVSIGNRDELSANKRITQVVEVIDQFQKERKLLELLK 339

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           +    P                                                   ++ 
Sbjct: 340 KYQSGP-------------------------------------------------KKDEK 350

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F   +     +   L+ +GY ++ I+G L Q  R + L  F+TG +++L+ TDVAAR
Sbjct: 351 VLIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRSQALNEFKTGASNLLLATDVAAR 410

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 411 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 456

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  206 bits (523), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 201/404 (49%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++S +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+  +                  
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIV----------------- 336

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           EV+      RD+L K+                                L  A+Q  +E  
Sbjct: 337 EVVS-DFEKRDRLNKY--------------------------------LETASQ-DNEYK 362

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           T++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 363 TLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAAR 422

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 423 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE 466

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  211 bits (537), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 137/424 (32%), Positives = 223/424 (52%), Gaps = 58/424 (13%)

Query: 126 SFPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 184
           ++   GLS   ++ IT+   F  PTPIQ + IP I+  +DI+G+++TGSGKT A+ILP++
Sbjct: 290 NWAQLGLSSLTMNYITQILKFETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLL 349

Query: 185 EKLKTHS----GKIGARAVILSPSRELAMQTHNVFKDF--SKGTQLRSVLLTGGDSLEDQ 238
             ++        + G  A++L+P+RELA+Q ++   +F  +   QL S+   GG  L  Q
Sbjct: 350 RHVRAQKPLSRNETGPIALVLAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQ 409

Query: 239 FGMMMNNPDVIIATPGRFLHLKVEMNLDL---KSIEYAVFDEADRLFEMGFQEQLNELLA 295
             ++     +I+ATPGR++ L      +L   K I + V DEADRLF++GF+ Q+++++ 
Sbjct: 410 INIIKKGVSIIVATPGRYIDLLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMK 469

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND-EREA 354
           ++   +  +LFSAT P  L  FA   L +P+ + +D+E  I+EN+E  F   K+D E+  
Sbjct: 470 TIRPDKHGVLFSATFPKKLRSFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFN 529

Query: 355 NLLYLLQ----EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           NLL +L     E I+   ASRD ++  N                                
Sbjct: 530 NLLDILNKHDYENIQ-SSASRDGISNEN-------------------------------- 556

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
                   +K  I+FV ++   E I N L  +G+    I+     + R + L NFR    
Sbjct: 557 --------DKKIIIFVSSQQISELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKN 608

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELP- 529
           SIL+ T+V +RG+++P  + VI ++   +   +VH  GRT R   RG A S++ E++LP 
Sbjct: 609 SILLCTEVLSRGLNVPETSLVIIYNAVKAFAQYVHTTGRTGRGIYRGVAISLLLENDLPA 668

Query: 530 -YLL 532
            Y+L
Sbjct: 669 AYIL 672

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  205 bits (521), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 125/404 (30%), Positives = 201/404 (49%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   ++++ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+  +                  
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIV----------------- 336

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           EV+      RD+L K+                                L  A+Q  +E  
Sbjct: 337 EVVS-DFEKRDRLNKY--------------------------------LETASQ-DNEYK 362

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           T++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 363 TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAAR 422

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 423 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE 466

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  204 bits (520), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 123/405 (30%), Positives = 202/405 (49%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G  ++++S +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 112 TFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 171

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 172 HINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 231

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 232 TRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 291

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A+  L +P+ V + + E   S N+  +     + E+   LL  L+
Sbjct: 292 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE 351

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                  AS D+ +K                                             
Sbjct: 352 ------TASEDKDSKI-------------------------------------------- 361

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+  LR+ G+    I+G   Q+ R   L  FRTG + I+V TDVAAR
Sbjct: 362 -LIFASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAAR 420

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E+
Sbjct: 421 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEA 465

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  203 bits (517), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 207/405 (51%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L+  I + I++  F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 108 SFDYLSLNPSIQAEISK--FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 165

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L    GK G + +++SP+RELA Q ++     +    ++   + GG   ++Q   +  +
Sbjct: 166 HLMNDQGKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKRS 225

Query: 246 PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQTL 304
             V++ATPGR L L  E ++DL  + Y V DEADR+ E GF+E +  ++    +S RQTL
Sbjct: 226 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTL 284

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER--EANLLYLLQE 362
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL LL+ 
Sbjct: 285 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLK- 343

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                        K+++                               P  N+       
Sbjct: 344 -------------KYHSG------------------------------PKKNE-----KV 355

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F   +     +   L+ +GY ++ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 356 LIFALYKKEATRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 415

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           +DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 416 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 460

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  204 bits (519), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 127/403 (31%), Positives = 202/403 (50%), Gaps = 53/403 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++S +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPDYVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 174

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++LSP+RELA+Q       F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDL 234

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 235 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
           TL++SAT P  +   A   L +P+ V++ +       LE+           ++ +  L E
Sbjct: 295 TLMWSATWPKEVKQLAADYLNDPIQVQVGS-------LELA---------ASHTITQLVE 338

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
           V+      RD+L K                                 L  A+Q   E  T
Sbjct: 339 VVS-DFEKRDRLNK--------------------------------HLETASQ-DDEYKT 364

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + I+V TDVAARG
Sbjct: 365 LIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARG 424

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           +D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 425 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAVSFFTE 467

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  204 bits (518), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 201/404 (49%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   ++++ +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 NFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++LSP+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  + + A+  L +P+ V++ + E   S  +  L     + E+   ++  L+
Sbjct: 294 TLMWSATWPKEVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRMVKHLE 353

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                 +AS+D+ +K                                             
Sbjct: 354 ------VASQDKESKI-------------------------------------------- 363

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 364 -LVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDVAAR 422

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 423 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE 466

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  203 bits (517), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 203/410 (49%), Gaps = 65/410 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 SFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIV 170

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++L+P+RELA+Q       F + +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDL 230

Query: 243 MNNPDVIIATPGRFLHLKVEMN-LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSR 301
               +++IATPGR + + +E+N  +LK + Y V DEADR+ +MGF+ Q+ +++  +   R
Sbjct: 231 ARGAEIVIATPGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR 289

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAETKISENLEMLFLSTKNDEREANL 356
           QTL++SAT P  +   A+  LT+P+ V+     L A   I + +E++    K D    +L
Sbjct: 290 QTLMWSATWPKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDRLSKHL 349

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
                      +AS DQ +K                                        
Sbjct: 350 ----------EIASEDQDSK---------------------------------------- 359

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
                 ++F  T+   + I+  LR+ G+    I+G  DQ  R   L  F+ G + I+V T
Sbjct: 360 -----VLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVAT 414

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           DVAARG+D+  +  VIN+ +P + + +VHR+GRT RAG +G A S  +E 
Sbjct: 415 DVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFTEG 464

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  203 bits (517), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/404 (31%), Positives = 201/404 (49%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 119 SFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 178

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 179 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 238

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 239 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 298

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+             A L+ +L 
Sbjct: 299 TLMWSATWPKEVQQLASDYLNDPIQVQVGSLELSASHNI-------------AQLVEVLS 345

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           E  K     RD+L K                                 L  A++   E  
Sbjct: 346 EFEK-----RDRLLK--------------------------------HLETASE-DKESK 367

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+ +LRE G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 368 ILIFASTKRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAAR 427

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  VIN+ +P + + +VHR+GRT RAG +G A S  +E
Sbjct: 428 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFTE 471

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  203 bits (517), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 199/405 (49%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   ++++ +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 116 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 175

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 176 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 235

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 236 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 295

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L       E+   LL  L+
Sbjct: 296 TLMWSATWPKEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE 355

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                  AS+DQ +K                                             
Sbjct: 356 ------TASQDQESKI-------------------------------------------- 365

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + ++  LRE G+    I+G  DQ  R   L  FR+G + I+V TDVAAR
Sbjct: 366 -LIFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAAR 424

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E 
Sbjct: 425 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEG 469

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  203 bits (516), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 201/405 (49%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 110 SFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIV 169

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++L+P+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 170 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 229

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 230 ARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 289

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N++ +                  
Sbjct: 290 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELAASHNIKQVV----------------- 332

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           EVI      RD+L K                                 +  A+Q   E  
Sbjct: 333 EVI-TDFEKRDRLTK--------------------------------HMDIASQ-DKESK 358

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+  LR+ G+    I+G  DQ  R   L  FRTG + I+V TDVAAR
Sbjct: 359 ILVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAAR 418

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E+
Sbjct: 419 GIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEA 463

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  204 bits (519), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 205/410 (50%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-E 185
           F S  L   ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 186 KLKT------------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
             KT            +  K    AVI++P+RELA Q  +  K F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGS 267

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 294 LASLP----SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +         +RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++++ LL LL        AS D L                                   
Sbjct: 388 QDKKSALLDLLS-------ASTDGL----------------------------------- 405

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+G 
Sbjct: 406 ------------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGT 453

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            S+LV T VAARG+DIP + +VIN+ LP+    +VHR+GRT RAGN G A
Sbjct: 454 ASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 503

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  202 bits (513), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 206/405 (50%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   I + I++  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 110 SFDHLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 167

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L     K G + +++SP+RELA Q ++     +    L+   + GG   ++Q   +  +
Sbjct: 168 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS 227

Query: 246 PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQTL 304
             V++ATPGR L L  E ++DL  + Y V DE DR+ E GF+E +  ++    +S RQTL
Sbjct: 228 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTL 286

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER--EANLLYLLQE 362
           +F+AT P  + + A + + NP+ V +    +++ N ++  +    D R  E  LL LL+ 
Sbjct: 287 MFTATWPKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLK- 345

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                        K+++                               P  N+       
Sbjct: 346 -------------KYHSG------------------------------PKKNE-----KV 357

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F   +     +   L+ +GY ++ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 358 LIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARG 417

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           +DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 418 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 462

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  202 bits (514), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 198/404 (49%), Gaps = 55/404 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 NFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++LSP+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDL 230

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 VRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L     + E+   L   L+
Sbjct: 291 TLMWSATWPKEVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHLE 350

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                 +AS D+ +K                                             
Sbjct: 351 ------IASEDKDSKI-------------------------------------------- 360

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+  LR  G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 361 -LVFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAAR 419

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           G+D+  +  VIN+ +P + + +VHR+GRT RAG +G A S  +E
Sbjct: 420 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFTE 463

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  201 bits (512), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 205/405 (50%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   I + I++  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 115 SFDYLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 172

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L     K G + +++SP+RELA Q ++     +    ++   + GG   ++Q  + +  
Sbjct: 173 HLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKK 231

Query: 246 PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQTL 304
             V++ATPGR L L  E ++DL  + Y V DEADR+ E GF+E +  ++    +S RQTL
Sbjct: 232 SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTL 291

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER--EANLLYLLQE 362
           +F+AT P  + + A   + NP+ V +    +++ N  +  +    D R  E  LL LL+ 
Sbjct: 292 MFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLK- 350

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                        K+++                               P  N+       
Sbjct: 351 -------------KYHSG------------------------------PKKNE-----KV 362

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F   +     +   L+ +GY ++ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 363 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 422

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           +DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 423 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 467

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  204 bits (518), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 129/410 (31%), Positives = 207/410 (50%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F S  L   ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 161 FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 220

Query: 187 L-------------KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
                          ++  K+   AVIL+P+RELA Q ++  K F+  + ++ +++ GG 
Sbjct: 221 SFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGA 280

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
           S+++Q   M    ++++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 281 SIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRI 340

Query: 294 L--ASLPS--SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +  + +PS  +RQTL+FSAT PS +   A   L + V + +      SEN+    L  ++
Sbjct: 341 VEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVED 400

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++   LL              D LA  N                               
Sbjct: 401 FDKNDTLL--------------DLLAASN------------------------------- 415

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                    E  T++FV T+   + +++ L   G+  + I+G   Q  R+R L  F+TG 
Sbjct: 416 ---------EGLTLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGR 466

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            +ILV T VAARG+DIP + +VINF LP     +VHR+GRT RAGN G A
Sbjct: 467 ATILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVA 516

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  207 bits (528), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 133/436 (30%), Positives = 227/436 (52%), Gaps = 59/436 (13%)

Query: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTH---- 190
           FI+ N+    +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++ ++K      
Sbjct: 271 FIMHNLK---YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLA 327

Query: 191 SGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGDSLEDQFGMMMNNPDVI 249
           + + G   +IL+P+RELA+Q H   + F+K    + S+  TGG  L+ Q  M+    +++
Sbjct: 328 TNETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIV 387

Query: 250 IATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLL 305
           +ATPGRF+ L + +N    L  K I + V DEADRLF++GF+ Q+ +++ ++   +Q +L
Sbjct: 388 VATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVL 446

Query: 306 FSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN-LLYLLQEVI 364
           FSAT P+ L  FA   L  P+ + ++++  ++EN++  F     DE +   LL +L + +
Sbjct: 447 FSATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRALLSILDKRM 506

Query: 365 KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTIL 424
           K    + +                                        A+   ++   I+
Sbjct: 507 KEEDENEESEL-------------------------------------ADDEVNDDKAII 529

Query: 425 FVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVD 484
           FV ++   +++   L   GY I  I+       R   L NFR    SIL+ T+V +RG++
Sbjct: 530 FVSSQQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGLN 589

Query: 485 IPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELP--YLL-----DLEIF 537
           +P ++ VI ++   +   +VH  GRTAR  N G A +++  +E+P  Y+L     D EI 
Sbjct: 590 VPEVSLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITLLLSNEIPAAYILRKALRDQEIE 649

Query: 538 LGKKILMTPMYDSMSD 553
                L+  +YD MSD
Sbjct: 650 SHDPKLVKELYD-MSD 664

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  203 bits (517), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 205/410 (50%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-E 185
           F S  L + ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 186 KLKT------------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
             KT            +  K    AVI++P+RELA Q  +  K F+  + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 267

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 294 LASLP----SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +          RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGDRQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++++ LL LL        AS D L                                   
Sbjct: 388 QDKKSALLDLLS-------ASTDGL----------------------------------- 405

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+G 
Sbjct: 406 ------------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA 453

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            S+LV T VAARG+DIP + +VIN+ LP+    +VHR+GRT RAGN G A
Sbjct: 454 ASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 503

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  201 bits (511), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 206/405 (50%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   I + I++  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 114 SFDYLSLDPSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 171

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L     K G + +++SP+RELA Q ++     +    ++   + GG   ++Q   +  +
Sbjct: 172 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS 231

Query: 246 PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL-ASLPSSRQTL 304
             V++ATPGR L L  E ++DL  + Y V DEADR+ E GF+E +  ++  +  S RQTL
Sbjct: 232 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTL 290

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER--EANLLYLLQE 362
           +F+AT P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL LL+ 
Sbjct: 291 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELLK- 349

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                        K+++                               P  N+       
Sbjct: 350 -------------KYHSG------------------------------PKKNE-----KV 361

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F   +     +   L+ +GY ++ I+G L Q  R + L  F++G +++L+ TDVAARG
Sbjct: 362 LIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARG 421

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           +DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 422 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 466

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  200 bits (509), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/406 (31%), Positives = 205/406 (50%), Gaps = 56/406 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    L K + + I +  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 131 AFNQISLDKEVQNEIAK--FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIN 188

Query: 186 KLKTHSGKI-GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
            L T S K  G + +++SP+RELA Q ++     ++   +   ++ GG   +DQ   +  
Sbjct: 189 NLLTSSSKPKGIKVLVISPTRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQRRQIAK 248

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           + +V++ATPGR L L  E ++DL  ++Y V DEADR+ E GF+E +  ++    S  RQT
Sbjct: 249 S-NVVVATPGRLLDLIEEGSVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQT 307

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER--EANLLYLLQ 361
           L+F+AT P  + + A   +  PV V +    ++S N  +  +    D R  E  LL    
Sbjct: 308 LMFTATWPKEVRELASTFMKEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLL---- 363

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                     D L K+ +                               P  N       
Sbjct: 364 ----------DLLKKYQSG------------------------------PKKND-----K 378

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F   +     +   L  +GY ++ I+G L Q  R + L  F++G +++L+ TDVAAR
Sbjct: 379 VLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAAR 438

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+DIP +  VIN + P + + +VHR+GRT RAG  G A+++ +E E
Sbjct: 439 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQE 484

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  201 bits (512), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 205/410 (50%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-E 185
           F S  L   ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 144 FTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 203

Query: 186 KLKT------------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
             KT            +  K    AVI++P+RELA Q  +  K F+  + +++ ++ GG 
Sbjct: 204 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 263

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            + +Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 264 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 323

Query: 294 LASLPSS----RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +     +    RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +N
Sbjct: 324 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 383

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++++ LL LL        AS D L                                   
Sbjct: 384 QDKKSALLDLLS-------ASTDGL----------------------------------- 401

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+G 
Sbjct: 402 ------------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGA 449

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            ++LV T VAARG+DIP + +VIN+ LP+    +VHR+GRT RAGN G A
Sbjct: 450 ATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 499

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  205 bits (522), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 126/413 (30%), Positives = 217/413 (52%), Gaps = 62/413 (15%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+  I++ +TR+  F  PTPIQ + IP I+  RD++G+++TGSGKT +FILP++ 
Sbjct: 238 WSQLGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLR 297

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFSKG-TQLRSVLLTGGDSLEDQFG 240
           ++K        + G   +ILSP+RELA+Q H     F+ G   +RS+  TGG  L+ Q  
Sbjct: 298 QIKAQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQIN 357

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    +++IATPGRF+ L + +N    ++ K I + V DEADRLF++GF+ Q+N+++  
Sbjct: 358 DIKRGVEIVIATPGRFIDL-LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKC 416

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE-AN 355
           +   +Q +LFSAT P+ L  FA   L +PV + +++++ I+EN+E       N+E +  +
Sbjct: 417 IRPDKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKS 476

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           L++ L                   QN+                                 
Sbjct: 477 LIHWL---------------ALTQQNL--------------------------------- 488

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
             +++ TI+FV ++   + + N L  +G+    I+       R   L  F+     IL+ 
Sbjct: 489 --NDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILIC 546

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR  N+G A +++  +EL
Sbjct: 547 TEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLLMNTEL 599

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  202 bits (514), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 204/408 (50%), Gaps = 71/408 (17%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-EKLKT- 189
           L + ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  KT 
Sbjct: 176 LDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTG 235

Query: 190 -----------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQ 238
                      +S K    A+IL+P+RELA Q  +  K F+  + +R  ++ GG  + +Q
Sbjct: 236 PSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQ 295

Query: 239 FGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL--AS 296
              + +  D+++ATPGR   L     + L +I Y V DEADR+ +MGF+ Q+ +++  + 
Sbjct: 296 MREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSD 355

Query: 297 LP--SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
           +P    RQTL+FSAT P  +   A+  L + + + +      SEN+  + L  ++ ++ +
Sbjct: 356 MPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYS 415

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            LL LL        A+ D L                                        
Sbjct: 416 ALLDLLA-------ATTDGL---------------------------------------- 428

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                  T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR G  +ILV
Sbjct: 429 -------TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATILV 481

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI 522
            T VAARG+DIP + +VINF LP     +VHR+GRT RAGN G A S 
Sbjct: 482 ATAVAARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSF 529

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  199 bits (507), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 201/403 (49%), Gaps = 53/403 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G  ++++  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 124 TFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 183

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 184 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDL 243

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 244 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 303

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
           TL++SAT P  +   A+  L +P+ V          N+  L L+       ++ +  + E
Sbjct: 304 TLMWSATWPKEVQQLARDYLHDPIQV----------NIGSLELAA------SHTITQIVE 347

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
           VI      RD+L K                                 L  A++ P E   
Sbjct: 348 VIS-DFEKRDRLVK--------------------------------HLDIASKDP-ESKI 373

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+F  T+   + I++ LR+ G+    I+G   Q  R   L  FR G + I+V TDVAARG
Sbjct: 374 IIFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARG 433

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           +D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E
Sbjct: 434 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE 476

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  199 bits (505), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 200/409 (48%), Gaps = 63/409 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAETKISENLEMLFLSTKNDEREANLL 357
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E+L    K D    +L 
Sbjct: 294 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRDRLAKHL- 352

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
                      AS+DQ +K                                         
Sbjct: 353 ---------ETASQDQDSKI---------------------------------------- 363

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
                I+F  T+   + I++ LR  G+    I+G   Q+ R   L  FR+G + I+V TD
Sbjct: 364 -----IIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATD 418

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           VAARG+D+  +  VIN+ +P + + +VHR+GRT RAG+ G A S  +E 
Sbjct: 419 VAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFTEG 467

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  200 bits (508), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 202/412 (49%), Gaps = 72/412 (17%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI- 184
           +F S  L + ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ 
Sbjct: 146 AFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS 205

Query: 185 EKLKT-------------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTG 231
           E  KT             +  K    AVI++P+RELA Q  +  K F   + ++  ++ G
Sbjct: 206 ESFKTGPTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYG 265

Query: 232 GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLN 291
           G  + +Q   M    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+ 
Sbjct: 266 GSPIGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIR 325

Query: 292 ELLASLP----SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST 347
            ++          RQTL+FSAT P+ +   A+  L + + + +      SEN+    L  
Sbjct: 326 AIVEGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYV 385

Query: 348 KNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXX 407
           +N ++++ LL LL        AS D L                                 
Sbjct: 386 ENQDKKSALLDLLS-------ASNDGL--------------------------------- 405

Query: 408 ERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRT 467
                         T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+
Sbjct: 406 --------------TLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRS 451

Query: 468 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
           G  ++LV T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A
Sbjct: 452 GRANLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  200 bits (508), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 203/410 (49%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-E 185
           F S  L   ++ NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ E
Sbjct: 147 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSE 206

Query: 186 KLKTHSGKIGAR------------AVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
              T   +  A             AV+++P+RELA Q  +  K F   + ++  ++ GG 
Sbjct: 207 SFLTGPAEKAANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGA 266

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            + +Q   M +  D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  +
Sbjct: 267 PIGNQMREMDHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHI 326

Query: 294 L--ASLPSS--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +    +P +  RQTL+FSAT P  +   A+  L + + + +      SEN+    L  +N
Sbjct: 327 VEDCDMPPTGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVEN 386

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++ + LL LL        AS D L                                   
Sbjct: 387 RDKNSALLDLLA-------ASNDNL----------------------------------- 404

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+G 
Sbjct: 405 ------------TLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGR 452

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            +ILV T VAARG+DIP + +VIN+ LP+    +VHR+GRT RAGN G A
Sbjct: 453 ANILVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 502

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  201 bits (511), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 125/420 (29%), Positives = 222/420 (52%), Gaps = 60/420 (14%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+  I+  IT++  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ 
Sbjct: 234 WSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLR 293

Query: 186 KLKT----HSGKIGARAVILSPSRELAMQTHNVFKDF-SKGTQLRSVLLTGGDSLEDQFG 240
           ++K      SG+ G   +IL+P+RELA+Q H   + F +  ++LRS+  TGG  L+ Q  
Sbjct: 294 QIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIK 353

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    ++++ATPGRF+ L + +N    L+ + + + V DEADRLF++GF+ Q+ E++ +
Sbjct: 354 ELKKGVEIVVATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKT 412

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE-AN 355
           +   +Q +LFSAT P+ L  FA   L  P+ + +++++ I+EN+E       NDE +   
Sbjct: 413 IRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEG 472

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL +L++  +  ++S D+                                          
Sbjct: 473 LLDILRK--QTQMSSDDE------------------------------------------ 488

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
              ++  I+F+ ++   + I   L+E  Y    I+     + R   L  F+     IL+ 
Sbjct: 489 --RDEKIIVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLC 546

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELP--YLLD 533
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++   EL   Y+L+
Sbjct: 547 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLLLSDELAASYILN 606

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  202 bits (513), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 215/400 (53%), Gaps = 63/400 (15%)

Query: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHS----GKIGARAVI 200
           F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++ ++K+      G+ G   ++
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGLL 377

Query: 201 LSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHL 259
           L+P+RELA+Q H     F+    +++S+  TGG  ++ Q   +    ++I+ATPGRF+ L
Sbjct: 378 LAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRFIDL 437

Query: 260 KVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLV 315
            + +N    ++ K I + V DEADRLF++GF+ Q+N+++  +   +Q +LFSAT P+ L 
Sbjct: 438 -LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPTKLK 496

Query: 316 DFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE-ANLLYLLQEVIKIPLASRDQL 374
            FA   L NP+ + +++++ I+EN+E       ++E +  +LL+ L     +P  +R+  
Sbjct: 497 SFASKILHNPIHITINSKSLINENIEQRVEIFGDEESKFKSLLHWL-----VPTQTRE-- 549

Query: 375 AKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEY 434
                                                       ++ TI+FV ++   ++
Sbjct: 550 -------------------------------------------VDEKTIIFVSSQQICDF 566

Query: 435 ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 494
           +SN L  +G     I+     + R   L +F+     IL+ T+V +RG+++P ++ V+ +
Sbjct: 567 LSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSLVLIY 626

Query: 495 SLPASSKIFVHRVGRTARAGNRGWAYSIVSESELP--YLL 532
           +   S   +VH  GRTAR  N+G A +++  +EL   Y+L
Sbjct: 627 NAAKSFAQYVHTTGRTARGTNKGMAVTLLMNNELAASYIL 666

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  197 bits (501), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/445 (29%), Positives = 213/445 (47%), Gaps = 72/445 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-E 185
           F S  L + ++ NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 137 FTSPPLDELLLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 196

Query: 186 KLKT-----------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
             KT           +  K    AV+++P+RELA Q  +  K F   + ++  +  GG  
Sbjct: 197 SFKTGPTATHDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAP 256

Query: 235 LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
           + +Q   M    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  ++
Sbjct: 257 IGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIV 316

Query: 295 ASLP----SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
                     RQTL+FSAT P+ +   A+  L + + + +      SEN+    L  +N 
Sbjct: 317 EGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQ 376

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           ++++ LL LL        AS D L                                    
Sbjct: 377 DKKSALLDLLS-------ASEDGL------------------------------------ 393

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
                      T++FV T+   + +++ L    +  + I+G   Q  R+R L  F++G  
Sbjct: 394 -----------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAA 442

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
           ++LV T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A +  +      
Sbjct: 443 TLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIATAFFNRDNTNI 502

Query: 531 LLDLEIFLGKKILMTPMY--DSMSD 553
           +  L   L +     P +  D+M+D
Sbjct: 503 VKGLYEILTEANQEVPGFLNDAMAD 527

>KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 621

 Score =  197 bits (501), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 128/415 (30%), Positives = 204/415 (49%), Gaps = 71/415 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-- 184
           F S  L + ++ NI +  F +PTP+Q+ ++P+I   RD++  A+TGSGKT  F+ P++  
Sbjct: 151 FTSPPLDQLLLDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 185 -----------EKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
                      +    +  K    AV+L+P+RELA Q  +  K F+  + +R  ++ GG 
Sbjct: 211 SFANGPAPVPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGA 270

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +  Q   +    D+++ATPGR   L     + L +I+Y V DEADR+ +MGF+ Q+  +
Sbjct: 271 DIGSQIKELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHI 330

Query: 294 L--ASLPS--SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +    +PS   RQTL+FSAT P  +   A+  L + V + +      SEN+    L  ++
Sbjct: 331 VEGCDMPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVED 390

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++++ LL LL        AS D L                                   
Sbjct: 391 MDKKSALLDLLA-------ASDDGL----------------------------------- 408

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L       + I+G   Q  R+R L  FR+G 
Sbjct: 409 ------------TLIFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSGK 456

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS 524
            S+LV T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A + ++
Sbjct: 457 ASLLVATAVAARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATAFLN 511

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  196 bits (498), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 197/405 (48%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++S +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 139 TFDEAGFPDYVLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 198

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +          G   ++L+P+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 199 HINAQPLLGPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 258

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               ++ IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 259 QRGAEICIATPGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 318

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A+  L + + V + + E   S N+  +     + ++   L+  ++
Sbjct: 319 TLMWSATWPKEVQQLAQDYLHDYIQVNVGSLELAASHNITQVIEVVSDFDKRDRLVKHME 378

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                 +AS+D                                             +E  
Sbjct: 379 ------VASQD---------------------------------------------AESK 387

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + I+  LRE G+    I+G   Q  R   L  FR+G + I+V TDVAAR
Sbjct: 388 ILVFASTKRMCDEITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAAR 447

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  SE+
Sbjct: 448 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFSEA 492

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  196 bits (497), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/405 (30%), Positives = 203/405 (50%), Gaps = 71/405 (17%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK----- 186
           L   ++ NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +     
Sbjct: 145 LEGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNG 204

Query: 187 ---LKTHSG-----KIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQ 238
              L  +SG     K    AVI++P+REL  Q  +  K F+  + ++  ++ GG  + +Q
Sbjct: 205 PTPLPENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQ 264

Query: 239 FGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP 298
              M    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+  ++    
Sbjct: 265 MREMDRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCD 324

Query: 299 SS----RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
            +    RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L  +++++++
Sbjct: 325 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKS 384

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            LL L        LA+ D                                          
Sbjct: 385 ALLDL--------LAASD------------------------------------------ 394

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
               E  T++FV T+   + +++ L    +  + I+G   Q  R+R L  FR+G  ++LV
Sbjct: 395 ----EGLTLIFVETKRLADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLLV 450

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            T VAARG+DIP + +VINF LP+    +VHR+GRT RAGN G A
Sbjct: 451 ATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVA 495

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  198 bits (503), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 211/422 (50%), Gaps = 69/422 (16%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GLS  I+  I+ +  F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP++ 
Sbjct: 247 WSQLGLSSEIMDLISNELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVR 306

Query: 186 KLKTH-------SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQ 238
           ++K         +G IG   +IL+P+RELA+Q       F KG+ + S+   GG  L+ Q
Sbjct: 307 QIKAQPPLAPDETGPIG---LILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQ 363

Query: 239 FGMMMNNPDVIIATPGRFLHLKVEMNLDLKS---IEYAVFDEADRLFEMGFQEQLNELLA 295
              +    D+I+ATPGRF+ L    +  L S   I + V DEADRLF++GF  Q+N+++ 
Sbjct: 364 INELKRGVDIIVATPGRFIDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMG 423

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLE---MLFLSTKNDER 352
            +   +Q +LFSAT PS L  FA   L NP+ + +++++ I+EN++    +F     DE 
Sbjct: 424 CIRPDKQCVLFSATFPSKLKHFASRTLKNPIQITINSKSLINENIQQRVQIF-----DEE 478

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
                +LL+ +        D+LA    +                                
Sbjct: 479 HVKFEFLLKRL-------SDRLALHRGE-------------------------------- 499

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
                 ++ TI+FV ++   + + + L  +G     I+       R R L  F+     I
Sbjct: 500 ------DEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGI 553

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PY 530
           L+ T+V +RG+++P ++ VI ++   +   +VH VGRT R  N G A S V   EL   Y
Sbjct: 554 LICTEVLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFVMVDELASAY 613

Query: 531 LL 532
           +L
Sbjct: 614 IL 615

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  194 bits (494), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 204/410 (49%), Gaps = 71/410 (17%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F S  L   ++ NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 162 FTSPPLDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSE 221

Query: 187 -------------LKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
                         K+   K    A++L+P+RELA Q ++  K F+  + +R  ++ GG 
Sbjct: 222 SFKNGPSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGS 281

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +  Q   +    D+++ATPGR   L     + L +++Y V DEADR+ +MGF+ Q+ ++
Sbjct: 282 DIGSQIRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQI 341

Query: 294 L--ASLP--SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           +    +P    RQTL+FSAT P  +   A+  L++ + + +      SEN+    L  ++
Sbjct: 342 VDGCDMPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVED 401

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
            ++++ LL LL        AS D L                                   
Sbjct: 402 MDKKSTLLDLLS-------ASNDGL----------------------------------- 419

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                       T++FV T+   + +++ L    +  + I+G   Q  R+R L  F+ G 
Sbjct: 420 ------------TLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGN 467

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWA 519
            ++LV T VAARG+DIP + +V+N+ LP+    +VHR+GRT RAGN G A
Sbjct: 468 ANLLVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 223/419 (53%), Gaps = 48/419 (11%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL   I++ IT++  + +PT IQ + IP I+  RD++G+++TGSGKT ++ILPM+ 
Sbjct: 278 WSQLGLPTDIMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLR 337

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSLEDQFG 240
           ++K        + G   +IL+P+RELA+Q +   + F+K  + +R++  TGG  ++ Q  
Sbjct: 338 QIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQIN 397

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    ++++ATPGR + + + +N    +  K I + V DEADRLF+MGF+ Q+ +++ +
Sbjct: 398 DLKRGVEIVVATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKT 456

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN- 355
           +   +Q +LFSAT P+ L  FA   LT+P+ V +++   ++EN+   F    N+  + N 
Sbjct: 457 VRPDKQCVLFSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNR 516

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           L+ +L           D   K N +NI                         ER    ++
Sbjct: 517 LVNIL-----------DGFYKVN-KNI--------------------TSNSEER--EIDE 542

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
             S+K  I+FV ++   + + + L   GY    I+       R   L  F+T   SIL+ 
Sbjct: 543 EVSDKKIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLC 602

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR  ++G A +++   EL   Y+L
Sbjct: 603 TEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLLLPDELAAAYIL 661

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  194 bits (492), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 202/408 (49%), Gaps = 71/408 (17%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI-EKLKT- 189
           L   ++ NI    F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  K+ 
Sbjct: 192 LDDLLLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSEAFKSG 251

Query: 190 -----------HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQ 238
                      +S K    ++IL+P+RELA Q     K F+  + ++  ++ GG  + +Q
Sbjct: 252 PSPTPEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQ 311

Query: 239 FGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL--AS 296
              + +  D+++ATPGR   L     + L++I+Y V DEADR+ +MGF+ Q+  ++    
Sbjct: 312 MREIDHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVD 371

Query: 297 LP--SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
           +P    RQTL+FSAT P  +   A+  L + V + +      S+N+    L  ++ ++ +
Sbjct: 372 MPQVGERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYS 431

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            LL LL        A+ D L                                        
Sbjct: 432 ALLDLLS-------ATSDGL---------------------------------------- 444

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                  T++FV T+   + +++ L    +  + I+G   Q  R+R L  F+ G  ++LV
Sbjct: 445 -------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLLV 497

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI 522
            T VAARG+DIP + +VINF LP+    +VHR+GRT RAGN G A S 
Sbjct: 498 ATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSF 545

>KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]
           {ON} similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 504

 Score =  189 bits (480), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 188/385 (48%), Gaps = 50/385 (12%)

Query: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGA-RAVILSP 203
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  + T   K  + + +++SP
Sbjct: 112 FPKPTPIQAVSWPYLLAGKDVIGIAETGSGKTFAFGVPAINNIVTSGDKSSSVKVLVISP 171

Query: 204 SRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEM 263
           +RELA Q ++     +    LRS  + GG   +DQ    +    V++ATPGR L L  E 
Sbjct: 172 TRELASQIYDNLIVLTDACGLRSCCVYGGVP-KDQQREDLRRSQVVVATPGRLLDLIEEG 230

Query: 264 NLDLKSIEYAVFDEADRLFEMGFQEQLNELL-ASLPSSRQTLLFSATLPSSLVDFAKAGL 322
           ++DL  + Y V DEADR+ E GF+E + +++  +  +SRQTL+F+AT P  + + A +  
Sbjct: 231 SVDLSHVNYLVLDEADRMLEKGFEEDIKKIIRQTRSTSRQTLMFTATWPKEVRELASS-- 288

Query: 323 TNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNI 382
                                                + E +K+ + +RD+L+     N 
Sbjct: 289 ------------------------------------FMSEPVKVSIGNRDELS----ANK 308

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRES 442
                                       P  N        ++F   +     +   L+ +
Sbjct: 309 RITQIVEVVDPFRKEKKLLELLKKYHSGPTKND-----KVLIFALYKKEASRVERNLKYN 363

Query: 443 GYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKI 502
           GY ++ I+G L Q  R + L  F+ G  ++L+ TDVAARG+DIP +  VIN + P + + 
Sbjct: 364 GYDVAAIHGDLSQQQRTQALNEFKAGKCNLLLATDVAARGLDIPNVKTVINLTFPLTVED 423

Query: 503 FVHRVGRTARAGNRGWAYSIVSESE 527
           +VHR+GRT RAG  G A+++ +E E
Sbjct: 424 YVHRIGRTGRAGQYGTAHTLFTEQE 448

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  187 bits (474), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 132/429 (30%), Positives = 196/429 (45%), Gaps = 68/429 (15%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F + G+SK+++  +      QPT IQ+  IP ILQ +D +G A+TGSGKT AF  PM+ K
Sbjct: 5   FATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTK 64

Query: 187 LKTH-SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
                SG  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ DQ   +   
Sbjct: 65  WSEDPSGMFG---VVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRK 121

Query: 246 PDVIIATPGRFLHLKVEMNLD----LKSIEYAVFDEADRLFEMGFQEQLNELLASLP--S 299
           P  I+ATPGR  H  +    D    LK  ++ V DEAD L    F E L   ++ LP   
Sbjct: 122 PHFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKE 181

Query: 300 SRQTLLFSATLPSSL--VDFAKAGLTNPVLVRLDAET----KISENLEMLFLSTKNDERE 353
            RQTLLF+AT+   +  +  A A    P L   + E+     I   L+  +L      +E
Sbjct: 182 KRQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKE 241

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
           A L  +L              A +N                                   
Sbjct: 242 AYLYQILTN------------ATYN----------------------------------- 254

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                E S I+FV      E +   L++    ++ ++  + Q  R   L+ FR     +L
Sbjct: 255 -----ESSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVL 309

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TDVA+RG+DIP +  VIN+ + ++   F+HR GRTARAG  G +   V+  ++  +  
Sbjct: 310 IATDVASRGLDIPTVQLVINYDISSNPDTFIHRAGRTARAGRSGESICFVAPRDVSRIEA 369

Query: 534 LEIFLGKKI 542
           +E  + KK+
Sbjct: 370 IEERINKKM 378

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  190 bits (482), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/413 (31%), Positives = 207/413 (50%), Gaps = 78/413 (18%)

Query: 131 GLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLK-- 188
           GL + I S +    +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + +L   
Sbjct: 178 GLVEIISSKLK---YREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKL 234

Query: 189 ---THSGKI-GARAVILSPSRELAMQTH----NVFKDFSKGTQLRSVLLTGGDSLEDQFG 240
                  K+ G   +IL+P+RELA Q       V   +S+ T++ S++  GG S+E+   
Sbjct: 235 PPLNDITKLDGPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISY 292

Query: 241 MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP-- 298
            + +  D+++ATPGR +       L LK +   V DEADR+ + GF++QL  +LA     
Sbjct: 293 SLSDGCDILVATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESV 352

Query: 299 SSRQTLLFSATLPSSLVDFAKAGLTNPVLVRL---DAETKISENLEMLFLSTKNDEREAN 355
           S RQT++F+AT+ +++   A   LT P  VR+   D + +I + +E              
Sbjct: 353 SGRQTMMFTATMSNTVEKIANGYLTKPAYVRVGSDDTKAQIKQIVE-------------- 398

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
             YL  E  +    +RD L KF A                                    
Sbjct: 399 --YLPSEEQRFQKMARDILPKFRA------------------------------------ 420

Query: 416 LPSEKSTILFVPTRHHVEY-ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                  ++F+  +   ++ +S    E+ + ++ ++G+  Q  R+  L   RTG   I++
Sbjct: 421 -----PIMIFINYKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMI 475

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
            TDVA RG+DIP ++ V+NF +  + + +VHR+GRT RAG  G A + + + +
Sbjct: 476 ATDVAGRGIDIPDVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFLGDKD 528

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  187 bits (476), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/419 (30%), Positives = 212/419 (50%), Gaps = 68/419 (16%)

Query: 124 KGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPM 183
           +GSF    LS   +  I + GF Q T +Q +TIP +L  +D++G A+TGSGKT AF++P 
Sbjct: 33  EGSFSDLKLSDGTMKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPA 92

Query: 184 IEKLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQF 239
           IE L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   + 
Sbjct: 93  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEA 150

Query: 240 GMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP 298
             +M   +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP
Sbjct: 151 DKLMKGVNILIATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILP 210

Query: 299 SS-RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREA 354
           +  RQ++LFSAT  + + D A+  L   P+ + +D+E  T  ++ LE  ++  ++D+R  
Sbjct: 211 NEDRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFL 270

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            L   L+         R+Q                                         
Sbjct: 271 LLFSFLK---------RNQ----------------------------------------- 280

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
               +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV
Sbjct: 281 ----KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILV 336

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
            TDVAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 337 CTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPTELGFL 394

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  189 bits (479), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/405 (28%), Positives = 198/405 (48%), Gaps = 55/405 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G  ++++  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDL 234

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 235 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A+  L +P+ V + + E   S  +  L     + ++   L+  L+
Sbjct: 295 TLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQLGEVVSDFDKRDRLVKHLE 354

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                 + S+D+ +K                                             
Sbjct: 355 ------IGSKDKDSKI-------------------------------------------- 364

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            I+   T+   + I++ LR+ G+    I+G          L ++RTG + I+V TDV AR
Sbjct: 365 -IILHSTKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVAR 423

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           G+D+  +  VIN+ +P + + +VHR+GRT RAG  G A S  +E+
Sbjct: 424 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEA 468

>KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {ON}
           Anc_3.249 YDR021W
          Length = 398

 Score =  183 bits (465), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 213/432 (49%), Gaps = 61/432 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S GL + ++  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + M++
Sbjct: 22  AFESMGLDRKLLQGIYAYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQ 81

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
                 G+   + +ILSP+RELA Q ++V  +      ++SV L GG+ +  Q    + N
Sbjct: 82  --ACSFGQNDLQCLILSPTRELAGQINSVVGNLGSFLNVKSVALVGGNKMAKQDSQKLQN 139

Query: 246 PD--VIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF--EMGFQEQLNELLASLPSSR 301
               V+  TPGR L L     L +K  +  V DEAD L    +GF++Q+ ++   LP + 
Sbjct: 140 GQVHVVSGTPGRVLDLIKRHVLVVKKCKMLVLDEADELLGESLGFKQQIYDIFTKLPKNC 199

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQ 361
           Q ++ SAT+   +++  K  +T PV + +  E    E ++  ++    ++ + + L  L 
Sbjct: 200 QVVVVSATMSKDIIEVTKKFMTTPVKILVKQEEISLEKIKQYYVDVDKEDWKFDTLCDLY 259

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           + + I                                                       
Sbjct: 260 DSLTIT-----------------------------------------------------Q 266

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+  V++++  L +S + ++ ++G + Q  R + + +FR+G + +L+ TDV AR
Sbjct: 267 CVIFCNTKRKVDWLAIKLTQSNFSVASMHGDMKQEERDKVMSDFRSGKSRVLISTDVWAR 326

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKK 541
           G+D+  ++ V+N+ LP   + ++HR+GR+ R G +G A + V++++L +L  +E F   K
Sbjct: 327 GIDVQQVSLVVNYDLPDIMENYIHRIGRSGRFGRKGIAINFVTKADLSHLKQIEKFY--K 384

Query: 542 ILMTPMYDSMSD 553
           I + PM  + +D
Sbjct: 385 IRIKPMPANFAD 396

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  182 bits (463), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 194/430 (45%), Gaps = 68/430 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F + G+SK++   +       PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ 
Sbjct: 4   TFSNLGVSKWLTEALRAMKIDHPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLT 63

Query: 186 KLKTH-SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
           K     SG  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ DQ   +  
Sbjct: 64  KWSEDPSGMFG---VVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQR 120

Query: 245 NPDVIIATPGRFLHLKVEMNLD----LKSIEYAVFDEADRLFEMGFQEQLNELLASLP-- 298
            P  IIATPGR  H  +    D    LK +++ V DEAD L    F E L   +  LP  
Sbjct: 121 KPHFIIATPGRLAHHVMNSGEDTIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPK 180

Query: 299 SSRQTLLFSATLPSS--LVDFAKAGLTNPVLVRLDAET----KISENLEMLFLSTKNDER 352
             RQ LLF+AT+     ++  A A    P L   + E+     I   L+  +L      +
Sbjct: 181 ERRQNLLFTATVTDQVKMLQNAPATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVK 240

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
           EA L  +L     I                                              
Sbjct: 241 EAYLYQILTSAAYI---------------------------------------------- 254

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
                 + S I+FV      E +   L++    ++ ++  + Q  R   L+ FR     +
Sbjct: 255 ------DSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARV 308

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLL 532
           L+ TDVA+RG+DIP +  V+N+ + A+   F+HR GRTARAG +G +   V++ ++  + 
Sbjct: 309 LIATDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICFVAQRDVSRIQ 368

Query: 533 DLEIFLGKKI 542
            +E  + KK+
Sbjct: 369 AIEERINKKM 378

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  190 bits (483), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 127/437 (29%), Positives = 226/437 (51%), Gaps = 59/437 (13%)

Query: 116 NLDKSKHKKGSFPS-------FGLSKFIISNITR-KGFRQPTPIQRKTIPLILQNRDIVG 167
           NLD  K K    P+        GL+  I+++I     F++ TPIQ + +P I+  RD++G
Sbjct: 242 NLDNIKIKGHGCPNPITRWSQLGLNTSIMNSIKNVMKFQELTPIQAQALPAIMSGRDVIG 301

Query: 168 MARTGSGKTAAFILPMIEKLKTH----SGKIGARAVILSPSRELAMQTHN-VFKDFSKGT 222
           +++TGSGKT +++LP++ ++K+     + + G   ++L+P+RELA+Q H  + K  +   
Sbjct: 302 ISKTGSGKTISYLLPLLRQVKSQRDLSNSETGPIGLVLAPTRELALQIHEEINKLINDDA 361

Query: 223 QLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEA 278
            L  +  TGG  L+DQ   +     +++ATPGRF+ L + +N    L    I + V DEA
Sbjct: 362 SLNCICCTGGSELKDQISSVKRGVKIVVATPGRFIDL-LTINSGKLLSTGRITFVVMDEA 420

Query: 279 DRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISE 338
           DRLF+MGF+ Q+ +++ ++   +Q +LFSAT  + +  FA   L NP+ + +++   ++E
Sbjct: 421 DRLFDMGFEPQVTQIMKAIRPDKQCVLFSATFSNKIRSFAMRVLKNPITITINSNNIVNE 480

Query: 339 NLEMLFLSTKNDEREAN-LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXX 397
           N+   F   ++D ++ + L+ LL+E          +  K  AQ                 
Sbjct: 481 NVSQNFRVCESDTQKFDELISLLKE----------RNDKHEAQ----------------- 513

Query: 398 XXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHA 457
                     E    ++ L   K TI+FV ++   + +   L  SG+ I  I+       
Sbjct: 514 ----------EGFEESDNLQDNK-TIIFVASQQICDILETNLVSSGFEIFSIHAGKPYQE 562

Query: 458 RKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRG 517
           R   L  +R    S+L+ T+V +RG+++P ++ VI ++   +   ++H  GRTAR  ++G
Sbjct: 563 RVLNLEKYRRTRNSLLLCTEVLSRGLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKG 622

Query: 518 WAYSIVSESEL--PYLL 532
            A S + + EL   Y+L
Sbjct: 623 KAVSFLLKDELAAAYIL 639

>KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {ON}
           similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 589

 Score =  186 bits (471), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 207/413 (50%), Gaps = 76/413 (18%)

Query: 141 TRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTH------SGKI 194
           T+  + +PTPIQR TIP +L  RD VG+A TGSGKT AF++P + +L         +   
Sbjct: 203 TKLKYLEPTPIQRATIPNVLNGRDFVGVAATGSGKTLAFLIPPLCQLNNTPPLNDITKMD 262

Query: 195 GARAVILSPSRELAMQ----THNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVII 250
           G  A+IL+P+RELA Q     + V K   + T++  V L GG S+E+    + +  D+++
Sbjct: 263 GPSALILAPTRELAQQIEAEANKVVKFLHRPTKV--VSLVGGHSVEEISYSLSHGCDILV 320

Query: 251 ATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS--SRQTLLFSA 308
           ATPGR +       L L+ +   + DEADR+ + GF++QL  +LA   S   RQT++F+A
Sbjct: 321 ATPGRLIDCLESNILVLQQVRTLILDEADRMIDFGFEDQLTTILARTESVKGRQTMMFTA 380

Query: 309 TLPSSLVDFAKAGLTNPVLVRL---DAETKISENLEMLFLSTKNDEREANLLYLLQEVIK 365
           T+ S++   A   L  P  VR+   D + +I + ++                YL  E  +
Sbjct: 381 TMSSTIERIANGYLNKPAYVRVGSQDTKAQIKQVVQ----------------YLPSEEQR 424

Query: 366 IPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILF 425
                RD L +F                               R P           ++F
Sbjct: 425 FSRLCRDVLPRF-------------------------------RSP----------IMIF 443

Query: 426 VPTRHHVEYI-SNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVD 484
           +  +   +++ +    E+ Y ++ ++G+  Q  R+  L   R+G   I++ TDVA RG+D
Sbjct: 444 INYKRTADWLAAKFSSETRYRVTTLHGSKSQEQREHSLNLLRSGKADIMIATDVAGRGID 503

Query: 485 IPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIF 537
           IP ++ V+NF +  S + ++HR+GRT RAG  G A + ++E + P +++ E+F
Sbjct: 504 IPNVSLVVNFQMCTSFEGYIHRIGRTGRAGKSGCALTFLTERDEPKVVE-ELF 555

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  183 bits (464), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 126/417 (30%), Positives = 211/417 (50%), Gaps = 68/417 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS+  +  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE
Sbjct: 35  TFKELNLSQPTLKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
            L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 95  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 152

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           +M   +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+ 
Sbjct: 153 LMKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 212

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D A+  L   P+ + + +E  +  ++ LE  ++  ++D+R   L
Sbjct: 213 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLL 272

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 273 FSFLK---------RNQ------------------------------------------- 280

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV T
Sbjct: 281 --KKKIIVFLSSCNSVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 338

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ SEL +L
Sbjct: 339 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLAPSELGFL 394

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  188 bits (478), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 214/413 (51%), Gaps = 48/413 (11%)

Query: 127 FPSFGLSKFIISN-ITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+  I S  I    F  PT IQ + IP I+  RD++G+++TGSGKT +++LP+I 
Sbjct: 242 WSQLGLTSDITSVLINDLKFENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIR 301

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFS-KGTQLRSVLLTGGDSLEDQFG 240
            +K      S + G   ++L+P+RELA+Q +     F+ K   + SV  TGG  L++Q  
Sbjct: 302 HIKAQRHLASDESGPLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIR 361

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    ++++ATPGRF+ L + +N    L  + I + + DEADRLF+MGF+ Q+ +++ +
Sbjct: 362 KLKKGIEIVVATPGRFIDL-LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKT 420

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN- 355
           +   +Q +LFSAT P+ L +FA   L  P+ + +++++ ++EN+   F    +DE + N 
Sbjct: 421 IRPDKQCVLFSATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNT 480

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL +L++  +       Q    +++N                                  
Sbjct: 481 LLRILEKHEESSNGVPMQQDWNDSEN---------------------------------- 506

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
              ++  I+FV ++   + +   L   GY I  I+       R   L NF++   SIL+ 
Sbjct: 507 --KDEKAIIFVSSQQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLC 564

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
           T+V +RG+++P ++ V+ ++   +   +VH  GRTAR  + G A +++   E+
Sbjct: 565 TEVLSRGLNVPEVSLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLLLNDEI 617

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  182 bits (462), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 207/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F   GLSK  +  I + GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P IE 
Sbjct: 38  FDELGLSKQTLKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEM 97

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 98  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 155

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS- 300
               ++IIATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  
Sbjct: 156 SKGVNLIIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 215

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAETKIS--ENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +D+E + S  + LE  ++  ++D+R   L 
Sbjct: 216 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLF 275

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+              KF  + I                                   
Sbjct: 276 TFLK--------------KFQTKKI----------------------------------- 286

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
                I+F+ + + V Y + LL      +  ++G   Q  R    + F      ILV TD
Sbjct: 287 -----IVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTD 341

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 342 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 396

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  182 bits (462), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 210/416 (50%), Gaps = 66/416 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF S  LS+  +  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE
Sbjct: 30  SFKSLNLSQPTMRAIEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPTIE 89

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
            L  HS K     G   +I++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 90  LL--HSLKFKPRNGTGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 147

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           +M   ++++ATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+ 
Sbjct: 148 LMKGVNLLVATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 207

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D ++  L   P+ + + +E  +  ++ LE  ++  ++D+R   L
Sbjct: 208 DRQSMLFSATQTTKVEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVVCESDKRFLLL 267

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 268 FSFLK---------RNQ------------------------------------------- 275

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ T
Sbjct: 276 --KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICT 333

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGN-RGWAYSIVSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR  N +G +   +  +EL +L
Sbjct: 334 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTNGKGKSLMFLIPNELGFL 389

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  182 bits (461), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 125/417 (29%), Positives = 209/417 (50%), Gaps = 68/417 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS+  +  I + GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 38  TFKELNLSQQTVKAIEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
            L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           ++   +++IATPGR L HL+       K+++    DEADR+ E+GF++++ +++  LP+ 
Sbjct: 156 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDA--ETKISENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D A+  L   P+ + +D+  ET   E LE  ++  ++D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCESDKRFLLL 275

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 276 FSFLK---------RNQ------------------------------------------- 283

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV T
Sbjct: 284 --KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 341

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 342 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 397

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  187 bits (474), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 203/400 (50%), Gaps = 60/400 (15%)

Query: 144 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTH----SGKIGARAV 199
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LPMI  +K      +G+ G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 200 ILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHL 259
           I +P+RELA+Q +   +       + S+  TGG  L+ Q   +    ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 260 KVEMNLDLKS---IEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVD 316
                 +L S   I + V DEADRLF+ GF+ Q+  +L ++   RQ +LFSAT PS + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 317 FAKAGLTNPVLVRLDAETKISENLEMLF-LSTKNDEREANLLYLLQEVIKIPLASRDQLA 375
           FA   L +P+ + ++AE  ++E +   F + +   ++   LL LL+              
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKFTICSDESDKFKELLSLLK-------------- 496

Query: 376 KFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYI 435
            FN++ +                                    ++ TI+FV ++   + I
Sbjct: 497 VFNSETV------------------------------------DEKTIIFVSSQQICDII 520

Query: 436 SNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFS 495
              L +    +  I+     + R++ L  F+    SIL+ T+V +RG+++P ++ VI ++
Sbjct: 521 EKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILYN 580

Query: 496 LPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLLD 533
              +   +VH  GRTAR    G + S++  +EL   Y+L+
Sbjct: 581 SAKTFAQYVHSTGRTARGTREGTSISLLLPNELSSAYILN 620

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  182 bits (462), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 123/396 (31%), Positives = 197/396 (49%), Gaps = 67/396 (16%)

Query: 144 GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK------LKTHSGKIGAR 197
           G+ +PTPIQR TIP +  NRD +G+A TGSGKT AF++P+  K      L   + + G +
Sbjct: 182 GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLPPLNVITRQDGPQ 241

Query: 198 AVILSPSRELAMQTHNVFKDFSKGTQLRSVLLT---GGDSLEDQFGMMMNNPDVIIATPG 254
           A+IL+P+RELA Q     K F    + R  L+T   GG +LE+    + +  ++++ATPG
Sbjct: 242 ALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNLQDGCNILVATPG 300

Query: 255 RFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS--SRQTLLFSATLPS 312
           R +       L LK +   V DEADR+ + GF++QL  +LA       +QTL+F+AT+ S
Sbjct: 301 RLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILEKQTLMFTATMSS 360

Query: 313 SLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRD 372
           S+   A   L NP  V +       +                     +Q++I+  +A+ +
Sbjct: 361 SIERIANGYLRNPGFVTIGGSGSAPQ---------------------IQQIIEY-VATDE 398

Query: 373 QLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHV 432
           Q  K   Q+I                           LP  N  P     I+F+  +   
Sbjct: 399 QRFKMLTQDI---------------------------LP--NYRP---PVIIFINYKVTA 426

Query: 433 EY-ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANV 491
           ++ +     ES + ++ ++G+  Q  R+  L  FR G   I+V TDVA RG+DIP ++ V
Sbjct: 427 DWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATDVAGRGIDIPNVSLV 486

Query: 492 INFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           +NF +P+    ++HR+GRT RA  +G   + + + +
Sbjct: 487 VNFQMPSKLDDYIHRIGRTGRANQKGTTLTFLGDKD 522

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  187 bits (474), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 213/418 (50%), Gaps = 47/418 (11%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   G+S  ++  +T+   +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+I 
Sbjct: 283 WSQLGISSDVMYLLTKTLQYDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIR 342

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGDSLEDQFG 240
            +K      + + G   +I++P+RELA+Q +   + F K    +RS+  TGG  L++Q  
Sbjct: 343 HVKAQRPLSNSETGPLGLIIAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIY 402

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
                 ++++ATPGRF+ L + +N    L+ K I   + DEADRLF+MGF+ Q+ +++ +
Sbjct: 403 EFKRGIEIVVATPGRFIDL-LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKT 461

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANL 356
           +   +Q +LFSAT P  L  F K  L NP+ + +D++T ++EN+   F    ND  +   
Sbjct: 462 IRPDKQCVLFSATFPIKLQAFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEK--- 518

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
            + L E++   +  R+      ++ +                                  
Sbjct: 519 FFKLIEILDNFVEKRESSQSKGSEQVEDEI------------------------------ 548

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+FV ++   + ++  L +  Y +  I+       R   L  F+    SIL+ T
Sbjct: 549 -IDKKIIIFVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCT 607

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
           +V +RG+++P ++ VI ++       +VH  GRTAR   RG A +++   EL   Y+L
Sbjct: 608 EVLSRGLNVPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLLLSDELDAAYIL 665

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  181 bits (458), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 122/415 (29%), Positives = 208/415 (50%), Gaps = 64/415 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    LS+  +  I + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF+LP IE
Sbjct: 35  SFADLKLSEPTMKAIEKMGFENMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 186 KLKT--HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
            L +  +  + G   ++++P+RELA+Q   V ++  +       ++ GG +   +   ++
Sbjct: 95  MLHSLKYKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLV 154

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP-SSR 301
              +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP   R
Sbjct: 155 KGVNMLIATPGRLLDHLQNTKGFVYKNLKALIIDEADRILEIGFEDEMKQIIRILPKEDR 214

Query: 302 QTLLFSATLPSSLVDFAKAGL-TNPVLVRL--DAETKISENLEMLFLSTKNDEREANLLY 358
           Q++LFSAT  + + D A+  L   P+ + +  D +T  ++ LE  ++  ++D+R   L  
Sbjct: 215 QSMLFSATQTTKVEDLARMSLRKGPLFINVVTDKDTSTADGLEQGYVVCESDKRFLLLFS 274

Query: 359 LLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 418
            L+         R+Q                                             
Sbjct: 275 FLK---------RNQ--------------------------------------------- 280

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV TDV
Sbjct: 281 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S+  ++  EL +L
Sbjct: 341 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPHELGFL 394

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  186 bits (472), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 118/416 (28%), Positives = 215/416 (51%), Gaps = 48/416 (11%)

Query: 130 FGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLK 188
            GLS   ++ IT +  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMNLITSELQFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 189 TH----SGKIGARAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLEDQFGMMM 243
                   + G   +IL+P+RELA+Q H     F++    +RSV  TGG  ++ Q   + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLK 379

Query: 244 NNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS 299
              ++++ATPGRF+ + + +N    L  K I + + DEADRLF++GF+ Q+ +++ ++  
Sbjct: 380 RGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRP 438

Query: 300 SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF-LSTKNDEREANLLY 358
            +Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +    DE+  NL+ 
Sbjct: 439 DKQFVLFSATFPNKLRSFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQ 498

Query: 359 LLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 418
           +L++        R++L      ++                                    
Sbjct: 499 ILRK--------RNELLDEVQSDVDGETSDLEEV-------------------------- 524

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           +   I+FV ++   ++IS  L   G +   I+       R   L  F+    SIL+ T+V
Sbjct: 525 DAKAIIFVSSQQICDFISKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEV 584

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
            +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++   EL   Y+L
Sbjct: 585 LSRGLNVPEVSLVIIYNSVKTFAQYVHTTGRTARGSRSGTAITLLLNDELSGAYIL 640

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  185 bits (470), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 127/418 (30%), Positives = 203/418 (48%), Gaps = 54/418 (12%)

Query: 116 NLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 175
           N D    K   F    +S   +  ++   F + T IQR++IP+ L+  D++G A+TGSGK
Sbjct: 32  NYDPKTAKTTFFKDLPISNATLKGLSEAAFLKLTDIQRESIPVSLKGYDVLGSAKTGSGK 91

Query: 176 TAAFILPMIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
           T AF++P++EKL  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG 
Sbjct: 92  TLAFLIPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLIKIGSHTSFSAGLVIGGK 151

Query: 234 SLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
            ++ +   + +  +++I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ 
Sbjct: 152 DVKFELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDA 210

Query: 293 LLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER 352
           ++ +LP SRQTLLFSAT   SL D A+  LT+   V             M   + K+D  
Sbjct: 211 IVGNLPPSRQTLLFSATQSQSLADLARLSLTDYKSVGT-----------MDKANEKSDAE 259

Query: 353 EANLLYLLQEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLP 411
            A    L Q  I++ LA + D L  F   ++                             
Sbjct: 260 AATPATLEQSYIEVELADKLDVLFSFIKTHL----------------------------- 290

Query: 412 PANQLPSEKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                  +   I+F+ +   V ++    R  + G  + +++G   Q AR   L  F    
Sbjct: 291 -------KAKMIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQ 343

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              L  TDV ARG+D P +  VI    P  +  ++HRVGR+AR G +G +  +++ +E
Sbjct: 344 QVCLFATDVVARGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKGKSLIMLTPTE 401

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  179 bits (455), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 127/418 (30%), Positives = 203/418 (48%), Gaps = 66/418 (15%)

Query: 124 KGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPM 183
           K  F    LS   +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFAELNLSPPTMKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 184 IEKLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQF 239
           IE L  HS K     G   ++++P+RELA+Q   V K   +       ++ GG +   + 
Sbjct: 87  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEA 144

Query: 240 GMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP 298
             +    +++IATPGR L HL+   +   K+++  V DEADR+ E+GF++++ +++  LP
Sbjct: 145 DKLAKGVNLLIATPGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILP 204

Query: 299 S-SRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREA 354
           S  RQT+LFSAT  + + D A+  L   P+ + +D+E  T  ++ LE  ++   +D+R  
Sbjct: 205 SEERQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFL 264

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            L   L+         R+Q                                         
Sbjct: 265 LLFSFLK---------RNQ----------------------------------------- 274

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
               +K  I+F+ + + V Y + LL      +  ++G   Q  R    + F       LV
Sbjct: 275 ----KKKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLV 330

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAG-NRGWAYSIVSESELPYL 531
            TDVAARG+DIP +  +I F  P   + ++HRVGRTAR    +G +   ++ +EL +L
Sbjct: 331 CTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGSKGKGKSLMFLTPNELGFL 388

>TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.249
           YDR021W
          Length = 387

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/413 (25%), Positives = 205/413 (49%), Gaps = 58/413 (14%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF S  L   ++  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + M++
Sbjct: 24  SFESMKLKDDLLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQ 83

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQF-GMMMN 244
            +   +  +  +A+ILSP+RELA Q H V  +      ++S  +TGG +++D    +  N
Sbjct: 84  AIDLKNKDL--QALILSPTRELASQIHQVVSNLGDYMNVQSFAITGGKTMKDDIKKIQRN 141

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFE--MGFQEQLNELLASLPSSRQ 302
              V+  TPGR L +     L  ++I+  + DEAD L    +GF++Q+ ++   LP S Q
Sbjct: 142 GCQVVSGTPGRVLDMFKRQMLKSRNIKMLILDEADELLSETLGFKQQIYDIFTKLPPSCQ 201

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            ++ SAT+   +++  K  + +PV + +  +    E ++  +++ + +E + + L  L +
Sbjct: 202 VVVVSATMNKDILEITKKFMNDPVKILVKRDEISLEGIKQYYVNVEREEWKFDTLCDLYD 261

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
            + I                                                        
Sbjct: 262 SLTIT-----------------------------------------------------QC 268

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           ++F  ++  V+++S  L ++ + I  ++G ++Q  R R +  FRTG + +LV TDV ARG
Sbjct: 269 VIFCNSKKKVDWLSQKLIQNNFAIVSMHGDMEQDERDRVMNEFRTGQSRVLVSTDVWARG 328

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLE 535
           +D+  ++ VIN+ L  + + ++HR+GR+ R G +G A + ++++++  L  +E
Sbjct: 329 IDVQQVSLVINYDLCENLENYIHRIGRSGRFGRKGIAINFITKNDVLLLKQIE 381

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  179 bits (453), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 206/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS   +  + + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE+
Sbjct: 23  FSGLNLSDATMKAVEKMGFSSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIER 82

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 83  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKL 140

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-S 300
               +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+  
Sbjct: 141 AKGVNMLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDD 200

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + + +E     ++ LE  ++   +D+R   L 
Sbjct: 201 RQSMLFSATQTTKVEDLARISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLF 260

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 261 SFLK---------RNQ-------------------------------------------- 267

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ TD
Sbjct: 268 -KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTD 326

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ SEL +L
Sbjct: 327 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPSELGFL 381

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  181 bits (459), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 130/415 (31%), Positives = 207/415 (49%), Gaps = 76/415 (18%)

Query: 137 ISNITRKG--FRQPTPIQRKTIPLILQ-NRDIVGMARTGSGKTAAFILPMIEKLKTH--- 190
           ++NI ++   F  PTP+QR TIP I++ NRD VG+A TGSGKT AF+LPM+ +L T+   
Sbjct: 185 LTNILQRDLKFDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVP 244

Query: 191 -------SGKIGARAVILSPSRELAMQTH----NVFKDFSKGTQLRSVLLTGGDSLEDQF 239
                  +G IG   ++L P+RELA Q       V     +   ++   + GG SLE+  
Sbjct: 245 PIALKKMNGPIG---LVLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEIS 301

Query: 240 GMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASL-- 297
             +    D++IATPG+ +       L + ++ Y V DEAD++ ++GF++QL  +L +L  
Sbjct: 302 SNLNEGCDILIATPGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEV 361

Query: 298 -----PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER 352
                 S  +TL+F+ATL S L   A   L NP+   + AE                   
Sbjct: 362 NNSNVSSLYRTLMFTATLSSPLEKIASGYLRNPIYASIKAEG------------------ 403

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
            A+ +  +Q+V++    + DQ  KF A                              L  
Sbjct: 404 -ADAMPQIQQVVQY-CPTDDQ--KFKA--------------------------IESILRE 433

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
            N + + +  I F+  +   ++++N    + Y ++ ++G+  Q  R+  +   R+G   I
Sbjct: 434 KNTMDNPRVII-FINYKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQI 492

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           L+ T+VAARG+DIP +A VINF  P     +VHR+GRT RAGN G A +++ + E
Sbjct: 493 LIATNVAARGLDIPNVALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLIGDEE 547

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  184 bits (467), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 209/413 (50%), Gaps = 46/413 (11%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+   ++ IT+   +   TPIQ + IP I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 292 WSQLGLNTDTMNLITKNLRYETLTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLR 351

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDF-SKGTQLRSVLLTGGDSLEDQFG 240
            +K        + G   +IL+P+RELA+Q H+  + F      +RS+  TGG  L+ Q  
Sbjct: 352 HIKAQRPLSKNETGPLGLILAPTRELALQIHDEIERFIVHDENIRSICCTGGSELKKQIN 411

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +     +++ATPGRF+ L + +N    +  + I + + DEADRLF++GF+ Q+ +++ +
Sbjct: 412 DLKRGVQIVVATPGRFIDL-LTLNTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKT 470

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE-AN 355
           +   +Q +LFSAT P+ L +FA   L +P+ + +++   ++EN+E      + D  +   
Sbjct: 471 IRPDKQCVLFSATFPNKLRNFAMRILNSPLSITINSNNLVNENVEQKVAICETDSAKFQE 530

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL +LQ   K     +DQ      +                                   
Sbjct: 531 LLTILQNQNK----QQDQCENDEDEEREDETTL--------------------------- 559

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
              +K TI+FV ++   + + + L   GY +  I+       R   L  F+    SIL+ 
Sbjct: 560 ---DKKTIIFVASQQICDLLYSQLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILIC 616

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
           T+V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++  SEL
Sbjct: 617 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGNLHGIAITLLLPSEL 669

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  182 bits (463), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 208/424 (49%), Gaps = 58/424 (13%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS   +  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSPPTLKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEK 102

Query: 187 L--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
           L  +  +   G  A+++SP+RELAMQ + V       T L + L+ GG  ++ +    ++
Sbjct: 103 LYREKWTEFDGLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLS 161

Query: 245 NPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQT 303
             +++I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ ++++LP+SRQT
Sbjct: 162 KINILIGTPGRILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
           LLFSAT   SL D A+  LT+   V     +K            K DE  A    L Q  
Sbjct: 222 LLFSATQSQSLGDLARLSLTDYKTVGTMDPSK-----------DKTDEGAATPKTLEQSY 270

Query: 364 IKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
           ++  LA + D L  F   ++                                    +   
Sbjct: 271 VETELADKLDILYSFIKSHL------------------------------------KHKM 294

Query: 423 ILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
           I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL-PYLLDL---EI 536
           RG+D P +  VI    P  +  ++HRVGR AR G +G +  +++  E  P+L  L   +I
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKGKSLIMLTPQECEPFLKRLASKKI 414

Query: 537 FLGK 540
            LGK
Sbjct: 415 KLGK 418

>KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {ON}
           Anc_8.469 YDR243C
          Length = 568

 Score =  179 bits (454), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 119/395 (30%), Positives = 203/395 (51%), Gaps = 66/395 (16%)

Query: 145 FRQPTPIQRKTIP-LILQNRDIVGMARTGSGKTAAFILPMIEKL--KTHSGKI--GARAV 199
           F++PTPIQR  IP  I  NRD +G+A TGSGKT AFI+P++ +L  +  S KI  G +++
Sbjct: 185 FQEPTPIQRVAIPNTIKTNRDFLGVASTGSGKTLAFIIPILIRLPQRPKSLKILDGPKSL 244

Query: 200 ILSPSRELAMQTHNVFKDFSK---GTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRF 256
           I+ P+RELA Q     K+ +K     +   + + GG S+E     +    D+++ATPG+ 
Sbjct: 245 IIVPTRELAQQIETSAKEITKRWKSNECNVLSIVGGHSIEKITLDLSIGCDILVATPGKL 304

Query: 257 LHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP---SSRQTLLFSATLPSS 313
           +       L L  ++  V DEAD++ ++GF++Q+  +LA L    SS QT++F+ATL  S
Sbjct: 305 IECLQSHILTLNQVDTLVMDEADKMIDLGFEDQITAILARLSMERSSLQTMMFTATLSQS 364

Query: 314 LVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQ 373
           +   +   L +P++V++ +E      ++     ++N+E         +++IK        
Sbjct: 365 IEKISNNYLNSPIIVKIGSEEDQVPKIQQTVEYSENEENR------FKQIIK-------- 410

Query: 374 LAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVE 433
                 +N                             PP     + KST          +
Sbjct: 411 ----TLKNCS---------------------------PPIIIFINYKST---------AD 430

Query: 434 YISNLLR-ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVI 492
           Y++   R E+ +  + ++G+ +Q  R+  +   RTG   +L+ T+VAARG+DIP ++ VI
Sbjct: 431 YLTKKFRNETNFKFTILHGSKNQEQREHSINLLRTGAVQVLIATNVAARGIDIPNVSLVI 490

Query: 493 NFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           NF +P   + ++HR+GRT RAGN G + + +  +E
Sbjct: 491 NFQMPKHFEDYIHRIGRTGRAGNLGASVTYMDGTE 525

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  178 bits (451), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 207/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS   +  I + GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE 
Sbjct: 46  FQDLTLSPPTLKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEL 105

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 106 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKL 163

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-S 300
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  
Sbjct: 164 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 223

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + + +E  T  ++ LE  ++   +D+R   L 
Sbjct: 224 RQSMLFSATQTTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVCDSDKRFLLLF 283

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 284 SFLK---------RNQ-------------------------------------------- 290

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ TD
Sbjct: 291 -KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICTD 349

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S+  ++ SEL +L
Sbjct: 350 VAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPSELGFL 404

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  183 bits (465), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/402 (27%), Positives = 203/402 (50%), Gaps = 57/402 (14%)

Query: 136 IISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTH----S 191
           +I N+ +  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++  +K       
Sbjct: 318 LIENVFK--FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSK 375

Query: 192 GKIGARAVILSPSRELAMQTHN-VFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVII 250
            + G  A+I++P+RELA+Q +    +       LR++  TGG  L+ Q   +    ++++
Sbjct: 376 NETGPLALIIAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVV 435

Query: 251 ATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLF 306
           ATPGRF+ L + MN    +  K I + V DEADRLF+MGF+ Q+ +++ ++   +Q +LF
Sbjct: 436 ATPGRFIDL-LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLF 494

Query: 307 SATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKI 366
           SAT P+ L +FA   L +P+ + +++ T ++EN+        N+  + ++L  L E  + 
Sbjct: 495 SATFPNKLRNFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQA 554

Query: 367 PLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFV 426
            L S +Q                                             ++  I+FV
Sbjct: 555 KLVSPEQ---------------------------------------------DEKVIIFV 569

Query: 427 PTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIP 486
            ++   + +   L    Y +  I+       R   L  F+    SIL+ T+V +RG+++P
Sbjct: 570 ASQQICDTLYAKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVP 629

Query: 487 MLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
            ++ V+ F+   +   +VH  GRTAR  N G A +++ + +L
Sbjct: 630 EVSLVVIFNAIKTFAQYVHTTGRTARGNNHGDAITLLLKDDL 671

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  177 bits (450), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 124/417 (29%), Positives = 207/417 (49%), Gaps = 68/417 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS   +  I + GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 38  NFKDLKLSDPTLKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
            L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           ++   ++++ATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+ 
Sbjct: 156 LIKGVNMLVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D A+  L   P+ + +  E  T  ++ LE  ++  ++D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCESDKRFLLL 275

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 276 FSFLK---------RNQ------------------------------------------- 283

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V Y + LL      +  ++G   Q  R    + F      ILV T
Sbjct: 284 --KKKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 341

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 342 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 397

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  175 bits (444), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 123/423 (29%), Positives = 187/423 (44%), Gaps = 54/423 (12%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G++K++   +      QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   TFKDLGVAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLT 66

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           K    +   G   ++L+P+RELAMQ    F        +R  L+ GG+ +  Q   +   
Sbjct: 67  KWS--ADPCGMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRK 124

Query: 246 PDVIIATPGRFLHLKVEMNLD----LKSIEYAVFDEADRLFEMGFQEQLNELLASLP--S 299
           P  IIATPGR  H  +    D    LK + Y V DEAD L    F + L   +  LP   
Sbjct: 125 PHFIIATPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKE 184

Query: 300 SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYL 359
            RQ LLF+            A +T+ VL   DA                           
Sbjct: 185 KRQNLLFT------------ATMTDQVLALKDAP-------------------------- 206

Query: 360 LQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
                  P + +  L  F+ +N+                          ++  + +  S 
Sbjct: 207 -------PTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKEAYLYQVLSSEEYKS- 258

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KS I+FV      E +  +L +    ++ ++  + Q  R   L  FR     +L+ TDVA
Sbjct: 259 KSAIVFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVLIATDVA 318

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           +RG+DIP +  V+N+ +PA+   ++HR GRTARAG  G A S ++  ++  +  +E  +G
Sbjct: 319 SRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQAIEERIG 378

Query: 540 KKI 542
           KK+
Sbjct: 379 KKM 381

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  177 bits (448), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 126/426 (29%), Positives = 206/426 (48%), Gaps = 66/426 (15%)

Query: 116 NLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 175
           N  ++   K  F    LS   I  + + GF   T +Q +TIP +L  RD++G A+TGSGK
Sbjct: 19  NAPEAPEYKEKFSELNLSSPTIKAVEKLGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGK 78

Query: 176 TAAFILPMIEKLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTG 231
           T AF+LP +E L  HS K     G   V+++P+RELA+Q   V K   +       ++ G
Sbjct: 79  TLAFLLPAVEML--HSLKFKPRNGTGVVVITPTRELALQIFGVAKSLMEFHSQTFGIVIG 136

Query: 232 GDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           G +   +   +    +++IATPGR L HL+       K+++  + DEADR+ E+GF++++
Sbjct: 137 GANRRQEADKLAKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEM 196

Query: 291 NELLASLPSS-RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAETKIS--ENLEMLFLS 346
            +++  LP+  RQT+LFSAT  + + D A+  L   P+ + +D+E + S  + LE  ++ 
Sbjct: 197 RQIVKILPNEDRQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKENSTVDGLEQGYVV 256

Query: 347 TKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXX 406
            ++D+R   L   L+         R+Q                                 
Sbjct: 257 CESDKRFLLLFSFLK---------RNQ--------------------------------- 274

Query: 407 XERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFR 466
                       +K  I+F+ + + V Y + LL      +  ++G   Q  R    + F 
Sbjct: 275 ------------KKKVIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFC 322

Query: 467 TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAG-NRGWAYSIVSE 525
                 LV TDVAARG+DIP +  +I F  P   + ++HRVGRTAR    +G +   ++ 
Sbjct: 323 NAERGTLVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGSKGKGKSLMFLTP 382

Query: 526 SELPYL 531
           +EL +L
Sbjct: 383 NELGFL 388

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  176 bits (447), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 207/416 (49%), Gaps = 66/416 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS+  +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 31  TFGELELSQPTLKAIDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 90

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
           +L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 91  RL--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADK 148

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           ++   +++IATPGR L HL+       K+++  + DEADR+ E+GF+E++ +++  LP+ 
Sbjct: 149 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQIIKILPNE 208

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAETKIS--ENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D A+  L   P+ + + +E   S  E LE  ++   +D+R   L
Sbjct: 209 DRQSMLFSATQTTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCDSDKRFLLL 268

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 269 FSFLK---------RNQ------------------------------------------- 276

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV T
Sbjct: 277 --KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVST 334

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTAR-AGNRGWAYSIVSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR A  +G +   ++ +EL +L
Sbjct: 335 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGAKGKGKSLMFLTPNELGFL 390

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  176 bits (446), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 205/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS   +  I + GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP IE 
Sbjct: 41  FDELNLSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEM 100

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 101 L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 158

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS- 300
               +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+  
Sbjct: 159 AKGVNLLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNED 218

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDA--ETKISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +D+  ET  ++ LE  ++   +D+R   L 
Sbjct: 219 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLF 278

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+              KF  + I                                   
Sbjct: 279 TFLK--------------KFQNKKI----------------------------------- 289

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
                I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV TD
Sbjct: 290 -----IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTD 344

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTA+ G +G   S+  ++  EL +L
Sbjct: 345 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLMFLTPHELGFL 399

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  180 bits (456), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 199/411 (48%), Gaps = 56/411 (13%)

Query: 123 KKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 182
           K   F    +S+  +  +    F + T IQR++IPL L+  D++G A+TGSGKT AF++P
Sbjct: 39  KANLFQDLPISEQTLKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIP 98

Query: 183 MIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFG 240
           +IEKL  +  +   G  A+I+SP+RELAMQ + V     K T   + L+ GG  +  +  
Sbjct: 99  VIEKLYREKWTDMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFE-K 157

Query: 241 MMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS 299
             ++  +++I TPGR L H+   +  +  +++  V DEADR  +MGF+  L+ ++ +LP+
Sbjct: 158 ERISRINILIGTPGRILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPA 217

Query: 300 SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYL 359
           SRQTLLFSAT   SL D A+  LT+          K    +E+L  ++ +   E+    L
Sbjct: 218 SRQTLLFSATQSQSLDDLARLSLTD---------YKQVGTMEVLNANSSSATPES----L 264

Query: 360 LQEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 418
            Q  I++PL  + D L  F   ++                                    
Sbjct: 265 QQSYIEVPLPDKLDILFSFIKSHL------------------------------------ 288

Query: 419 EKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
           +   I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       L  T
Sbjct: 289 KSKLIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFST 348

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           DV ARG+D P +  VI    P     ++HRVGR AR G  G +  +++  E
Sbjct: 349 DVVARGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEGKSLIMLTPEE 399

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  176 bits (447), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 206/413 (49%), Gaps = 82/413 (19%)

Query: 144 GFRQPTPIQRKTIPLILQN-----RDIVGMARTGSGKTAAFILPMIEKLKTHSGKI---- 194
           GF +PT IQR TIP  + +     RDI+G+A TGSGKT AF +P++ +L     +     
Sbjct: 190 GFDEPTAIQRITIPNAISSNKSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLK 249

Query: 195 ---GARAVILSPSRELAMQT----HNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPD 247
              G  A++L P+RELA Q     + +   +     L +V + GG S+ D    + N  D
Sbjct: 250 TLDGPLALVLVPTRELAQQISQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCD 309

Query: 248 VIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP----SSRQT 303
           ++IATPGR L +     + L  I+  V DEADR+ ++GF++Q+  +L+ L     ++RQT
Sbjct: 310 ILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQT 369

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLV----RLDAETKISENLEMLFLSTKNDEREANLLYL 359
           +LF+ATL SS+   AK  L NP+ V    R D++  +   +  +   T +D+++ + L  
Sbjct: 370 MLFTATLSSSVESIAKGYLKNPLHVSVGSRWDSDKPL---ITQVVRHTGDDDKKLSFL-- 424

Query: 360 LQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
                      +D L K                                     N LP+ 
Sbjct: 425 -----------KDDLIK-------------------------------------NGLPA- 435

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
              I+F+  +   ++++  L +  + I  ++G+  Q  R+  +   ++G  ++L+ T+VA
Sbjct: 436 ---IIFINYKETADWLTLRLSDR-FNIVTLHGSKSQSQRESAIQKLKSGTANVLIATNVA 491

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLL 532
           ARG+DIP +A V+NF +      ++HR+GRT RAG  G A + ++  E P L+
Sbjct: 492 ARGLDIPDVALVVNFQMSKKFDDYIHRIGRTGRAGKTGIAVTYLTGEEDPQLI 544

>TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa]
           {ON} Anc_5.40 YMR290C
          Length = 496

 Score =  174 bits (442), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 123/417 (29%), Positives = 208/417 (49%), Gaps = 68/417 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS+  +  I +  F + T +Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 33  AFADLNLSEPTLKAIGKLDFTEMTAVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 92

Query: 186 KLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGM 241
            L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   
Sbjct: 93  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADK 150

Query: 242 MMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           ++   +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+ 
Sbjct: 151 LVKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 210

Query: 301 -RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANL 356
            RQ++LFSAT  + + D A+  L   P+ + +  E  T  ++ LE  ++  ++D+R   L
Sbjct: 211 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVPENDTSTADGLEQGYVVCESDKRFLLL 270

Query: 357 LYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQL 416
              L+         R+Q                                           
Sbjct: 271 FSFLK---------RNQ------------------------------------------- 278

Query: 417 PSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 476
             +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV T
Sbjct: 279 --KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCT 336

Query: 477 DVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           DVAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 337 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 392

>TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3.249
           YDR021W
          Length = 400

 Score =  172 bits (435), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 199/406 (49%), Gaps = 58/406 (14%)

Query: 125 GSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 184
            +F +  L   ++  +   GF  P+ IQ + I  I+   D++  A++G+GKTA F + M+
Sbjct: 24  ATFEAMDLKDDLLKGVYLYGFEAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGML 83

Query: 185 EKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM-M 243
           + +      +  +A+ILSP+RELA Q + V  +      ++S  +TGG +++D    M  
Sbjct: 84  QVIDLKRKDL--QALILSPTRELATQINQVVTNLGDYMNVQSYAMTGGKTMKDDLKKMNK 141

Query: 244 NNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF--EMGFQEQLNELLASLPSSR 301
           +   V+  TPGR L +     +  ++++  + DEAD L    +GF++Q+ E+ A LPS+ 
Sbjct: 142 SGCQVVSGTPGRVLDMIKRQLISTRNVQMLILDEADELLGEHLGFKQQIYEIFAKLPSAC 201

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQ 361
           Q ++ SAT+   +++  K  +++P  + +  +    E ++  +++   ++ + + L  L 
Sbjct: 202 QVVVVSATMSKDIIEVTKKFMSDPTKILVKRDEISLEGIKQFYVNVSKEDWKFDTLCDLY 261

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           + + I                                                       
Sbjct: 262 DSLTIT-----------------------------------------------------Q 268

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+  V+++S  L  S + +  ++G + Q  R + + +FRTG + +L+ TDV AR
Sbjct: 269 CVIFCNTKKKVDWLSQKLTRSNFSVIAMHGDMKQEDRDKVMNDFRTGTSRVLISTDVWAR 328

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+D+  ++ VIN+ LP + + ++HR+GR+ R G +G + + V++ +
Sbjct: 329 GIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKGVSINFVTDED 374

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  179 bits (454), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 202/418 (48%), Gaps = 56/418 (13%)

Query: 116 NLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGK 175
           + D    +  +F    +S   +  +    F + T IQ+ +IP+ L+  D++G A+TGSGK
Sbjct: 32  DYDPKTSRATTFDDLPISGNTLKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGK 91

Query: 176 TAAFILPMIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
           T AF++P+IEKL  +  +   G  A+I+SP+RELAMQT+ V     + T   + L+ GG 
Sbjct: 92  TLAFLIPVIEKLYREKWTEHDGLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGK 151

Query: 234 SLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
            ++ +   + +  +V+I TPGR L H+   + L+   ++  V DEADR  +MGF+  L+ 
Sbjct: 152 DVKFELERI-SKINVLIGTPGRILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDA 210

Query: 293 LLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER 352
           ++++LP +RQTLLFSAT   SL D A+  LT+          K    +++L  +    + 
Sbjct: 211 IVSNLPPTRQTLLFSATQSQSLADLARLSLTD---------YKSVGTMDVLNPA----DT 257

Query: 353 EANLLYLLQEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLP 411
            A    L Q  I++PLA + D L  F   ++                             
Sbjct: 258 PATPETLQQSYIQVPLADKLDVLFSFIKTHL----------------------------- 288

Query: 412 PANQLPSEKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGL 469
                  +   I+F+ +   V ++    R  + G  + +++G   Q AR   L  F    
Sbjct: 289 -------KSKMIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQ 341

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              L  TDV ARG+D P +  V+    P     ++HR GR+AR G +G +  +++  E
Sbjct: 342 QVCLFATDVVARGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQGKSLIMLTLQE 399

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  175 bits (443), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 119/415 (28%), Positives = 207/415 (49%), Gaps = 64/415 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    LS   +  I + GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 52  NFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 111

Query: 186 KLKTHSGKI--GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
            L +   K   G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +M
Sbjct: 112 LLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 171

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-R 301
              +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  R
Sbjct: 172 KGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDR 231

Query: 302 QTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAE--TKISENLEMLFLSTKNDEREANLLY 358
           Q++LFSAT  + + D A+  L   P+ + +++E  T  ++ LE  ++   +D+R   L  
Sbjct: 232 QSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFS 291

Query: 359 LLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPS 418
            L+         R+Q                                             
Sbjct: 292 FLK---------RNQ--------------------------------------------- 297

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           ++ ++ F  + + V+Y + LL      +  ++G   Q  R    + F      ILV TDV
Sbjct: 298 KRKSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDV 357

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           AARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 358 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 411

>Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  174 bits (441), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 124/430 (28%), Positives = 214/430 (49%), Gaps = 69/430 (16%)

Query: 113 STTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTG 172
           +T+  D++ + + +F    LS+  +  I + GF   T +Q +TIP +L  RD++G A+TG
Sbjct: 31  ATSEADQTTYVE-TFAELNLSEPTLKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTG 89

Query: 173 SGKTAAFILPMIEKLKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVL 228
           SGKT AF++P IE L  HS K     G   ++++P+RELA+Q   V ++  +       +
Sbjct: 90  SGKTLAFLIPAIELL--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGI 147

Query: 229 LTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQ 287
           + GG +   +   +M   +++IATPGR L HL+       K+++  + DEADR+ E+GF+
Sbjct: 148 VIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFE 207

Query: 288 EQLNELLASLPS-SRQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAET--KISENLEML 343
           +++ +++  LP+  RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  
Sbjct: 208 DEMRQIIKILPNDDRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQG 267

Query: 344 FLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXX 403
           ++   +D R   L   L+         R+Q                              
Sbjct: 268 YVVCDSDNRFLLLFSFLK---------RNQ------------------------------ 288

Query: 404 XXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLY 463
                          +K  I+F+ + + V+Y + LL      +  ++G   Q  R    +
Sbjct: 289 ---------------KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFF 333

Query: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI- 522
            F      IL+ TDVAARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S+ 
Sbjct: 334 EFCNAERGILICTDVAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

Query: 523 -VSESELPYL 531
            ++ +EL +L
Sbjct: 393 FLTPNELGFL 402

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score =  176 bits (446), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 123/406 (30%), Positives = 199/406 (49%), Gaps = 77/406 (18%)

Query: 145 FRQPTPIQRKTIPLIL---QNRDIVGMARTGSGKTAAFILPMIEKL-----KTHSGKI-- 194
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ K+     +  S KI  
Sbjct: 194 FPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIID 253

Query: 195 GARAVILSPSRELAMQ----THNVFKDFSKGTQ--LRSVLLTGGDSLEDQFGMMMNNPDV 248
           G +A+IL+P+REL  Q    T  V K +SK +    + + + GG SLE+    +    D+
Sbjct: 254 GPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDI 313

Query: 249 IIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL------ASLPSSRQ 302
           ++ATPGR +       L +K +E  V DEAD++ ++GF++Q+  +L      A    +RQ
Sbjct: 314 LVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQ 373

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
           TL+F+AT+   +   A   +  PV   +  ET     ++ +     NDE +   L  +  
Sbjct: 374 TLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPI-- 431

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                      +AK++                                PP          
Sbjct: 432 -----------VAKYD--------------------------------PP---------I 439

Query: 423 ILFVPTRHHVEYISN-LLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           I+F+  +   ++++    +E+   ++ ++G+  Q  R+  L  FRT    I++ T+VAAR
Sbjct: 440 IIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAAR 499

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+DIP ++ V+NF +      ++HR+GRT RA N G A S VS +E
Sbjct: 500 GLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAE 545

>YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON}
           HAS1ATP-dependent RNA helicase; localizes to both the
           nuclear periphery and nucleolus; highly enriched in
           nuclear pore complex fractions; constituent of 66S
           pre-ribosomal particles
          Length = 505

 Score =  174 bits (440), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 206/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS+  +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE 
Sbjct: 44  FEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS- 300
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAET--KISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++   +D+R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKRFLLLF 281

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 282 SFLK---------RNQ-------------------------------------------- 288

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ TD
Sbjct: 289 -KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTD 347

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 348 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 402

>KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {ON}
           Anc_5.40 YMR290C
          Length = 476

 Score =  173 bits (438), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 201/406 (49%), Gaps = 66/406 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F S  LS   +  I + GF + T +Q +TIP +L  +D++G A+TGSGKT AF++P IE 
Sbjct: 11  FSSLELSAPTMKAIEKMGFTKMTTVQERTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIET 70

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  H+ K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 71  L--HALKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKL 128

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-S 300
               +++IATPGR L HL+       K+++  V DEADR+ E+GF++++ +++  LP+  
Sbjct: 129 AKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIRILPNEE 188

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAET--KISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++  ++D+R   L 
Sbjct: 189 RQSMLFSATQTTKVEDLARISLRKGPLFINVVPETDHSTADGLEQGYVVCESDKRFLLLF 248

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 249 SFLK---------RNQ-------------------------------------------- 255

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      ILV TD
Sbjct: 256 -KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTD 314

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523
           VAARG+DIP +  ++ F  P   + ++HRVGRTAR G +G   S++
Sbjct: 315 VAARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 359

>Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  173 bits (439), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 205/416 (49%), Gaps = 68/416 (16%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS+  +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE 
Sbjct: 44  FEELKLSQPTLKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS- 300
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAET--KISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++   +D R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLF 281

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 282 SFLK---------RNQ-------------------------------------------- 288

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ TD
Sbjct: 289 -KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTD 347

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI--VSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTAR G +G   S+  ++ +EL +L
Sbjct: 348 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLMFLTPNELGFL 402

>Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  173 bits (439), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 121/415 (29%), Positives = 204/415 (49%), Gaps = 66/415 (15%)

Query: 127 FPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEK 186
           F    LS+  +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE 
Sbjct: 44  FEELKLSQPTLKAIEKLGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 187 LKTHSGKI----GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
           L  HS K     G   ++++P+RELA+Q   V ++  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 243 MNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS- 300
           M   +++IATPGR L HL+       K+++  + DEADR+ E+GF++++ +++  LP+  
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 301 RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDAET--KISENLEMLFLSTKNDEREANLL 357
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++   +D+R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDDRFLLLF 281

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
             L+         R+Q                                            
Sbjct: 282 SFLK---------RNQ-------------------------------------------- 288

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            +K  I+F+ + + V+Y + LL      +  ++G   Q  R    + F      IL+ TD
Sbjct: 289 -KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTD 347

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAG-NRGWAYSIVSESELPYL 531
           VAARG+DIP +  +I F  P   + ++HRVGRTAR    +G +   ++ +EL +L
Sbjct: 348 VAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTEGKGKSLMFLTPNELGFL 402

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  177 bits (449), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 140/231 (60%), Gaps = 3/231 (1%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D  K    +F S  LS+ ++  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 219 DAKKQTYANFNSLSLSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTA 278

Query: 178 AFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-LRSVLLTGGDSL 235
           AF++P+IE+L   S KI A R ++L+P+RELA+Q  +V K   K    +   L  GG +L
Sbjct: 279 AFMIPVIERLLFKSAKIAATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVGGLNL 338

Query: 236 EDQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             Q   +   PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQE+LNE++
Sbjct: 339 RQQEQELKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIM 398

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFL 345
             LP+ RQTLLFSAT+ S +       L  PV + +D   + +  L   F+
Sbjct: 399 QLLPNKRQTLLFSATMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFV 449

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 66/108 (61%)

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           +K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD+
Sbjct: 474 QKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDL 533

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG  G + S V E+
Sbjct: 534 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFVGET 581

>Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON}
           YDR243C (REAL)
          Length = 589

 Score =  174 bits (441), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 120/406 (29%), Positives = 198/406 (48%), Gaps = 77/406 (18%)

Query: 145 FRQPTPIQRKTIPLIL---QNRDIVGMARTGSGKTAAFILPMIEKL-----KTHSGKI-- 194
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AFI+P++ ++     +  S KI  
Sbjct: 195 FHLPTPIQRITIPNVCRKKQYRDFLGVASTGSGKTLAFIVPILIRMSRSSPRPRSLKIMD 254

Query: 195 GARAVILSPSRELAMQTH----NVFKDFS--KGTQLRSVLLTGGDSLEDQFGMMMNNPDV 248
           G +A+IL+P+REL  Q       V K +S       + V + GG SLE+    +    D+
Sbjct: 255 GPKALILAPTRELVQQIQAEAEKVTKKWSIENNYDCKVVSIVGGHSLEEISFSLSEGCDI 314

Query: 249 IIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS------RQ 302
           ++ATPGR +       L +K +E  V DEAD++ ++GF++Q+  +L  +  S      RQ
Sbjct: 315 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVSADSSINRQ 374

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
           T++F+AT+ S +   A   +  PV   +  +T     ++ +   + ND+++   L     
Sbjct: 375 TMMFTATMTSVIEKIAAGYMKKPVYATIGVDTGSEPLIQQIVEYSDNDDQKFKKL----- 429

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                   R  + K+                                 PP          
Sbjct: 430 --------RSVVTKYE--------------------------------PP---------I 440

Query: 423 ILFVPTRHHVEYISNLLR-ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           I+F+  +   ++++   + E+   ++ ++G+  Q  R+  L  FR+G   I+V T+VAAR
Sbjct: 441 IVFINYKQTADWLAEKFQNETNMKVTILHGSKSQEQREHSLKLFRSGKVQIMVATNVAAR 500

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+DIP ++ V+NF +P     ++HR+GRT RA   G A S V ++E
Sbjct: 501 GLDIPNVSLVVNFQIPKKIDDYIHRIGRTGRAAKEGTAISYVGDTE 546

>Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  176 bits (447), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 198/415 (47%), Gaps = 63/415 (15%)

Query: 128 PSFGLSKFI----ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAA 178
           P    +KF     IS  T KG R+      T IQ  +IP+ LQ  DI+  A+TGSGKT A
Sbjct: 35  PKITTAKFFKDLPISEPTLKGLRESSFMKLTEIQADSIPVSLQGHDILAAAKTGSGKTLA 94

Query: 179 FILPMIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           F++P+IE+L  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++
Sbjct: 95  FLIPVIERLYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVK 154

Query: 237 DQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
            +    ++  +++I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ +++
Sbjct: 155 FEL-ERISRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVS 213

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
           +L  SRQTLLFSAT   S+ D A+  LT+   V  +     S+N           +  + 
Sbjct: 214 NLSPSRQTLLFSATQSQSVADLARLSLTDYKSVGTNDVMDGSDN-----------KGPST 262

Query: 356 LLYLLQEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
              L Q  I++PLA + D L  F   ++                                
Sbjct: 263 PDTLQQSYIEVPLADKLDTLFSFIKSHL-------------------------------- 290

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
               +   I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       
Sbjct: 291 ----KSKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVC 346

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           L  TDV ARG+D P +  V+    P     ++HRVGR AR G +G +  +++  E
Sbjct: 347 LFATDVVARGIDFPAVEWVVQIDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQE 401

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  176 bits (447), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 128/416 (30%), Positives = 199/416 (47%), Gaps = 65/416 (15%)

Query: 128 PSFGLSKFI----ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAA 178
           P    +KF     IS+ T KG R+      T IQ  +IP+ LQ  D++  A+TGSGKT A
Sbjct: 35  PKITKAKFFKDLPISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLA 94

Query: 179 FILPMIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           F++P+IEKL  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++
Sbjct: 95  FLVPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVK 154

Query: 237 DQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
            +   + +  +++I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ +++
Sbjct: 155 FELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVS 213

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
           +L  SRQTLLFSAT   S+ D A+  LT+   V        S N            +EA+
Sbjct: 214 TLSPSRQTLLFSATQSQSVADLARLSLTDYKTVGTHDVMDGSVN------------KEAS 261

Query: 356 LLYLLQEV-IKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
               LQ+  I++PLA + D L  F   ++                               
Sbjct: 262 TPETLQQFYIEVPLADKLDILFSFIKSHLKC----------------------------- 292

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTS 471
                    I+F+ +   V ++    R  + G  + +++G   Q AR   L  F      
Sbjct: 293 -------KMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQV 345

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
            L  TDV ARG+D P +  V+    P     ++HRVGR AR G +G +  +++  E
Sbjct: 346 CLFATDVVARGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQE 401

>Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  173 bits (438), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 118/417 (28%), Positives = 208/417 (49%), Gaps = 68/417 (16%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+   GF +PTPIQ + IP+ L NRDI+    TGSGKT AF+
Sbjct: 119 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQNECIPVALNNRDILACGPTGSGKTLAFL 178

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTGG 232
           +P+++++       G + +I+SP++ELA Q        +H +F +  +  Q+  +  + G
Sbjct: 179 IPLVQQIIDDKHTSGLKGLIISPTKELASQIFIECFKLSHKIFLEKKRPLQVALLSKSLG 238

Query: 233 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
             L+++  +     D+II+TP R + +  +  LDL  +++ +FDEAD+LF+  F EQ ++
Sbjct: 239 AKLKNKV-ISDKKYDIIISTPLRLIDVVKKEALDLSRVKHLIFDEADKLFDKTFVEQSDD 297

Query: 293 LLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           +L++   P+ R+  +FSAT+PSS+ + A++ + +P+ V +  +   + N+E   +   N+
Sbjct: 298 ILSACKEPALRKA-MFSATIPSSVEEIAQSIMMDPIRVIIGHKEAANTNIEQKLIFCGNE 356

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
             E  L+ + Q V         Q  +F                                 
Sbjct: 357 --EGKLIAIRQLV---------QEGEFK-------------------------------- 373

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PP          I+F+ +    + + + L      +  I+       R R +  F++G  
Sbjct: 374 PP---------IIIFLESIARAKALYHELMYDRINVDVIHAERTVLQRDRIIERFKSGEL 424

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
             L+ TDV ARG+D   +  VIN+ +P SS+ +VHR+GRT RAG  G A +  ++ +
Sbjct: 425 WCLICTDVLARGIDFKGVNLVINYDVPESSQAYVHRIGRTGRAGRSGKAVTFYTKQD 481

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  167 bits (424), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/367 (29%), Positives = 176/367 (47%), Gaps = 63/367 (17%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   ++++ +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 186 KLKTHS---GKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +   +      G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 171 HINAQALLQPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 230

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 NRGSEIVIATPGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAETKISENLEMLFLSTKNDEREANLL 357
           TL++SAT P  +   A   L++P+ V+     L A   I++ +E++    K         
Sbjct: 291 TLMWSATWPKEVKQLAADYLSDPIQVQIGSLELAASHTITQRVEVVSGFEK--------- 341

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
                        RD+LAK                                 +  A+Q P
Sbjct: 342 -------------RDRLAK--------------------------------HVETASQNP 356

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
            E   ++F  T+   + I+  LRE G+    I+G  DQ  R   L  FRTG + I+V TD
Sbjct: 357 -ESKILVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATD 415

Query: 478 VAARGVD 484
           VAARG+D
Sbjct: 416 VAARGID 422

>Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  174 bits (440), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 196/402 (48%), Gaps = 59/402 (14%)

Query: 137 ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL--KT 189
           IS+ T KG R+      T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  ISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 190 HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVI 249
            +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++ +   + +  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERV-SRINIL 166

Query: 250 IATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSA 308
           I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ ++++L  SRQTLLFSA
Sbjct: 167 IGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSA 226

Query: 309 TLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPL 368
           T   S+ D A+  LT       D +T  + ++    +S ++   E     L Q  I++ L
Sbjct: 227 TQSQSVADLARLSLT-------DYKTVGTHDVMDGSVSNESSTPET----LQQSYIEVTL 275

Query: 369 ASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVP 427
           A + D L  F   ++                                        I+F+ 
Sbjct: 276 ADKLDILFSFIKSHLKC------------------------------------KMIVFLS 299

Query: 428 TRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDI 485
           +   V ++    R  + G  + +++G   Q AR   L  F       L  TDV ARG+D 
Sbjct: 300 SSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDF 359

Query: 486 PMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           P +  V+    P     ++HRVGR AR G +G +  +++  E
Sbjct: 360 PAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQE 401

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  171 bits (434), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/459 (28%), Positives = 218/459 (47%), Gaps = 84/459 (18%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL-- 187
           + L  +I + I   GF   TP+Q  TIP+   N+D+V  + TGSGKT AF +P++EK+  
Sbjct: 12  YELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVK 71

Query: 188 KTHSGKIGAR----AVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSL--- 235
           +  SG    R    ++I+SP+REL+ Q  +V + F     S+   ++S L+ G  S    
Sbjct: 72  EVLSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    + N P ++I TPGR L       +   S    V DEADRL ++ F++ +  +L 
Sbjct: 132 DDVSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILG 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+     + G+ NPV + + ++ +  E+L++ ++  K +E+  +
Sbjct: 192 MLPKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHH 251

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL ++                                                     N 
Sbjct: 252 LLNII-----------------------------------------------------NN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYL--------ISYIYGTLDQHARKRQLYNFRT 467
           +   K  + F PT   V Y  + L+    +        +  ++G L  ++R   L  F T
Sbjct: 259 MRYRKCIVYF-PTCQAVTYFYSFLKHLSDISKTRDDLEVYSLHGKLQTNSRIGTLAKFST 317

Query: 468 GLT-SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS-- 524
            L  ++L+ TDVAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + ++  
Sbjct: 318 SLNIAVLLTTDVAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFINCG 377

Query: 525 --ESELPYLLDLEIFLGK-KILMTPMYDSMSDIMLKKWI 560
             E  + +L    I LG+ +I   P+ D +  ++ K W+
Sbjct: 378 REEDYIDFLGVKNISLGELEISFRPV-DELG-VIFKSWV 414

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  173 bits (439), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 150/243 (61%), Gaps = 5/243 (2%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F S  LS+ ++  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 232 TFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSK-GTQLRSVLLTGGDSLEDQFGMMM 243
           +L     K+ + R ++L+P+RELA+Q  +V K   K  + L   L  GG +L  Q   + 
Sbjct: 292 RLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELK 351

Query: 244 NNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             PD++IATPGRF+ H++   + ++ S+E  V DEADR+ E GFQE+LNE+L  LPS RQ
Sbjct: 352 TRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQ 411

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDE--REANLLYLL 360
           TLLFSAT+ S +       L  PV + ++   + +  L   F+  +  +  + A L YL+
Sbjct: 412 TLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLI 471

Query: 361 QEV 363
           +++
Sbjct: 472 RKL 474

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 67/108 (62%)

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           +K  ++FV  +     +  +L   G  +  ++G+L Q  R + + NF++    +L+ TD+
Sbjct: 479 QKRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDL 538

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           A+RG+DIP +  VINF +P S +I++HRVGRTARAG  G + + V ES
Sbjct: 539 ASRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFVGES 586

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  172 bits (436), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 134/424 (31%), Positives = 219/424 (51%), Gaps = 67/424 (15%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIEKLKT 189
           +S+ +  +I+R GF Q TP+Q+KTI  I+ N   DI+  A+TG+GKT AF+LP+ + L  
Sbjct: 166 ISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLL- 224

Query: 190 HSGKIGA----RAVILSPSRELAMQTHN-VFKDFSKGTQLRS---VLLTGGDSLEDQFGM 241
            + KI +    ++VI++P+R+LA+Q  + V K  SK  +L++   V L GG + +     
Sbjct: 225 -NTKIDSQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRY 283

Query: 242 MMN-NPDVIIATPGRFLHLKVEM-NLDLKSIEYAVFDEADRLFEMGFQEQL---NELLAS 296
           +   +P ++I TPGR + +  +  N   K +++ V DEADRL E+GF+E L   N++L +
Sbjct: 284 IEKVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNT 343

Query: 297 LPSSR----QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDER 352
           L ++     +TLLFSATL     D     L+N ++             E L++ T  DE 
Sbjct: 344 LNTNSTEHIRTLLFSATL-----DHKVQSLSNDIM----------NKEECLYIDTI-DEN 387

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
           E      + + + +     D L     ++I                              
Sbjct: 388 EPQAHEKIDQTLVVGETFADNLYA-AIEHIREF--------------------------- 419

Query: 413 ANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISY-IYGTLDQHARKRQLYNFRTGLTS 471
             + P+ KS ILF+PT    ++++ +L+    L  Y  +G +DQ  R R +  F+T    
Sbjct: 420 GTKTPNYKS-ILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNEFKTMKKG 478

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 531
           +LV TDV ARG+D P +  V+   LP+    ++HR+GRTAR+G  G + + +S+ ELP+ 
Sbjct: 479 LLVCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTFISKEELPFF 538

Query: 532 LDLE 535
             LE
Sbjct: 539 EILE 542

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  173 bits (438), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 128/443 (28%), Positives = 218/443 (49%), Gaps = 38/443 (8%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIEKLKT 189
           + K + + + R GF+  TP+Q+KTI  IL++   D++  A+TG+GKT AF+LP+ +KL  
Sbjct: 170 IDKKLFTAVHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIE 229

Query: 190 HSGKIGARAVILSPSRELAMQTHN----VFKDFSKGTQLRSVLLTGGDSLEDQFG-MMMN 244
                  ++VI++P+R+LA+Q       ++K+ S   Q   + + GG +       +   
Sbjct: 230 SPNSAMVKSVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRE 289

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKS-IEYAVFDEADRLFEMGFQEQLNELLASLPSSR-- 301
            P++I+ATPGR L +  +      S +++ V DEADRL E+GF+E L  +  SL S    
Sbjct: 290 RPNIIVATPGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSN 349

Query: 302 -----QTLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ETKISENLEMLFLSTKNDER 352
                +TLLFSATL   +   A   +     + LD     E +  EN+    + +   + 
Sbjct: 350 GADHIRTLLFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVS---DA 406

Query: 353 EANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPP 412
            ++ +Y + E I+  L   +         I                         +   P
Sbjct: 407 FSHSIYAVIEHIRSRLHPTELP-------IAEVTTEEETKVEAGVESVEETEVITKATKP 459

Query: 413 ANQLPSEK-STILFVPTRHHVEYISNLLRE----SGYLISYIYGTLDQHARKRQLYNFRT 467
            ++  ++    ILF PT    +++S L++      G  I   +G +DQ+ R R +  F+ 
Sbjct: 460 FDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRTRIVEKFKR 519

Query: 468 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
             + ILV TDV ARG+D P +  V+   +P+    +VHR+GRTARAG +G + + +S+ E
Sbjct: 520 ANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGISTAFLSKDE 579

Query: 528 LPYLLDLE----IFLGKKILMTP 546
           LP++  LE    I++  ++   P
Sbjct: 580 LPFVRCLEKSKKIYIENQVDYVP 602

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  166 bits (420), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 104/364 (28%), Positives = 176/364 (48%), Gaps = 55/364 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G  ++++S +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 113 SFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 172

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++LSP+RELA+Q       F K +++R+  + GG     Q   +
Sbjct: 173 HINAQPLLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 232

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 233 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 292

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A+  L +P+ V + + E   S N++ +       ++   LL  L+
Sbjct: 293 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE 352

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                  AS D+ +K                                             
Sbjct: 353 ------TASEDKDSKI-------------------------------------------- 362

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + ++ +LR+ G+    I+G   Q+ R   L  FR+G + I+V TDVAAR
Sbjct: 363 -LIFASTKRTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAAR 421

Query: 482 GVDI 485
           G+ +
Sbjct: 422 GIGM 425

>Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 125/415 (30%), Positives = 199/415 (47%), Gaps = 63/415 (15%)

Query: 128 PSFGLSKFI----ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAA 178
           P    +KF     IS+ T KG R+      T IQ  +IP+ LQ  D++  A+TGSGKT A
Sbjct: 35  PKITKAKFFKDLPISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLA 94

Query: 179 FILPMIEKL--KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           F++P+IEKL  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++
Sbjct: 95  FLVPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSRTSFSAGLVIGGKDVK 154

Query: 237 DQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
            +   + +  +++I TPGR L HL   + L+  +++  V DEADR  +MGF++ L+ ++ 
Sbjct: 155 FELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVD 213

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
           +L  SRQTLLFSAT   S+ D A+  LT       D +T  + ++    +    ++  + 
Sbjct: 214 TLSPSRQTLLFSATQSQSVADLARLSLT-------DYKTVGTYDV----MDGSVNKGPST 262

Query: 356 LLYLLQEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
              L Q  I++PLA + D L  F   ++                                
Sbjct: 263 PETLQQSYIEVPLADKLDILFSFIKSHLKC------------------------------ 292

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSI 472
                   I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       
Sbjct: 293 ------KMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVC 346

Query: 473 LVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           L  TDV ARG+D P +  V+    P     ++HRVGR AR G +G +  +++  E
Sbjct: 347 LFATDVVARGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKGKSLIMLTPQE 401

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  171 bits (432), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 136/442 (30%), Positives = 210/442 (47%), Gaps = 78/442 (17%)

Query: 140 ITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIEKL---KTHSGKI 194
           I+R GF   T +Q+KTI  IL+N  RD++  A+TG+GKT AF++P+ E L   +  S  +
Sbjct: 130 ISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPDM 189

Query: 195 GARAVILSPSRELAMQ----THNVFKDFSKGTQLRSVLLTGGDSL-EDQFGMMMNNPDVI 249
             +AV+L+P+R+LA+Q     H +  +     +   + + GG    +  F +    P++I
Sbjct: 190 -VKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNII 248

Query: 250 IATPGRFLHLKVEMNLD-LKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSR------- 301
           IATPGRF+     +  +  K +++ V DEADRL E+GF++ L  +  SL           
Sbjct: 249 IATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDHI 308

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST--KND----EREAN 355
           +TLLFSATL   +   A                 +    E LFL T  KN+    E+   
Sbjct: 309 RTLLFSATLDEKVQTLAD---------------DVMNKSECLFLDTVDKNEPESHEKIEQ 353

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
            L + Q   +   A  D L                                   L     
Sbjct: 354 SLVVSQNFAESTYAVIDHL-----------------------------------LKQTKN 378

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRES--GYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
           +P+ K+ ILF PT    +++SNLL++S   Y +   +G +DQ  R R + +F+     +L
Sbjct: 379 VPNYKA-ILFTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGLL 437

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           V TDV ARG+D P +  V+   +P+    +VHR+GRTAR G  G +   +S+SEL  + +
Sbjct: 438 VCTDVGARGMDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGASVIFLSDSELGLIEN 497

Query: 534 LEIFLGKKILMTPMYDSMSDIM 555
           LE      I     Y+  S+IM
Sbjct: 498 LEKEKNISIENKSNYEPSSEIM 519

>Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {ON}
           complement(17289..19106) [1818 nt, 606 aa]
          Length = 605

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/417 (28%), Positives = 206/417 (49%), Gaps = 79/417 (18%)

Query: 145 FRQPTPIQRKTIPLILQ------NRDIVGMARTGSGKTAAFILPMIEKL-----KTHSGK 193
           F  P+PIQR +IP I Q      NRD++G+A TGSGKT AF++P++ KL     +  S K
Sbjct: 203 FISPSPIQRISIPNICQKNGHSTNRDLMGIASTGSGKTLAFVIPILIKLLGTAIRPLSLK 262

Query: 194 I--GARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSLEDQFGMMMNNP 246
           +  G +A+IL+P+RELA Q     K       ++ T++ S+ + GG S+E+    +    
Sbjct: 263 VIEGPKALILAPTRELAQQIQAEIKKILSLSSNELTKITSICIVGGHSIEEISYDLSKGC 322

Query: 247 DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASL-----PSSR 301
           D+++ATPGR +       + + ++   V DEAD++ + GF++Q+  +L+ L       + 
Sbjct: 323 DILVATPGRLIDCLESHLIVIDNVNTIVLDEADKMIDFGFEDQVTTILSKLQINEMKDNL 382

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQ 361
           Q ++F+AT+  ++   A   L N   V +    +   ++  L   + N   E +    L+
Sbjct: 383 QKIMFTATMTPTIERIANGYLRNASYVSIGNSEEFVPHINQLVYYSPN---ENSKFRKLK 439

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           +V+                                           E  PP         
Sbjct: 440 QVL-------------------------------------------ELYPPP-------- 448

Query: 422 TILFVPTRHHVEYISNLLR-ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
            I+F+  +   ++++  L+ E+ + ++ ++G+  Q  R+  L   RTG   I++ T+VAA
Sbjct: 449 VIIFINYKKTADWLATKLQEETNFKVTTLHGSKSQDQREYSLNLLRTGRVQIMIATNVAA 508

Query: 481 RGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIF 537
           RG+DIP +  V+N+ +  S + ++HR+GRT RAG  G A S V + E P ++ +E+F
Sbjct: 509 RGIDIPNVGLVVNYQISDSFEDYIHRIGRTGRAGKEGTAISFVGDDEDPKVI-IELF 564

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  166 bits (419), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 170/362 (46%), Gaps = 55/362 (15%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPDYVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++L+P+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIREL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDA-ETKISENLEMLFLSTKNDEREANLLYLLQ 361
           TL++SAT P  +   A   L +P+ V++ + E   S N+  L     + E+   LL  L+
Sbjct: 294 TLMWSATWPKEVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE 353

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
                  AS D+ +K                                             
Sbjct: 354 ------TASEDKDSKI-------------------------------------------- 363

Query: 422 TILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
            ++F  T+   + ++  LRE G+    I+G  DQ  R   L  FR G + I+V TDVAAR
Sbjct: 364 -LVFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAAR 422

Query: 482 GV 483
           G+
Sbjct: 423 GI 424

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 192/411 (46%), Gaps = 59/411 (14%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           + L  +I   I   GF   TP+Q  TIP+  +N+D+V  + TGSGKT AF++P++EK+ +
Sbjct: 12  YELQPWIKKAINVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIIS 71

Query: 190 HS------GKIGARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGD--SLE 236
                    K    ++IL+P+REL+MQ  NV   F          +RS L+ G +  S+ 
Sbjct: 72  EGINNSKFKKGHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVR 131

Query: 237 DQFGMMMNN-PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           D    +++  P ++I TPGR L      ++   S    V DEADRL ++ F + + ++L 
Sbjct: 132 DDVNTLLDERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILN 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+     K GL NPV + ++++ K +     LF S    E +  
Sbjct: 192 VLPKQRRTGLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEK-- 249

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
               LQ +I I              NI                                 
Sbjct: 250 ----LQNLIHI------------MNNIRFKKCIVY------------------------- 268

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT-SILV 474
             +  S   F     +++     LRE   +IS I+G L   +R++ L  F   L+  IL+
Sbjct: 269 FSTCVSVTFFYQYLKYLQQTDKTLREDLQVIS-IHGKLTTQSRRKALSTFTESLSDCILL 327

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
            TDVAARG+DIP +  V+    P  + IF+HR GRT RA   G A   ++E
Sbjct: 328 TTDVAARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRAIVFLNE 378

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  171 bits (432), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 197/410 (48%), Gaps = 76/410 (18%)

Query: 137 ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL--KT 189
           IS+ T KG ++      T IQR++IP+ L+  D++G A+TGSGKT AF++P++EKL  + 
Sbjct: 48  ISDATLKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEKLYREK 107

Query: 190 HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVI 249
            +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++ +   + +  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-SRINIL 166

Query: 250 IATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSA 308
           + TPGR L H+   + L+  +++  V DEADR  +MGF++ L+ ++++LP SRQTLLFSA
Sbjct: 167 VGTPGRILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQTLLFSA 226

Query: 309 TLPSS--------LVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360
           T   S        L D+   G T   +   D+E    E L+                   
Sbjct: 227 TQSQSLADLARLSLTDYKSVG-TADTVNGGDSEVSTPETLQ------------------- 266

Query: 361 QEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
           Q  I + LA + D L  F   ++                                    +
Sbjct: 267 QSYIVVELADKLDTLFSFIKTHL------------------------------------K 290

Query: 420 KSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
              I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       L+ TD
Sbjct: 291 SKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATD 350

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           V ARG+D P +  V+    P     ++HRVGR+AR G +G +  +++ +E
Sbjct: 351 VVARGIDFPAVDWVVQVDCPEDVDTYIHRVGRSARYGKQGKSLIMLTPTE 400

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  164 bits (416), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 173/366 (47%), Gaps = 63/366 (17%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F   G   +++  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 NFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      S   G   ++LSP+RELA+Q       F + +++R+  + GG     Q   +
Sbjct: 175 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDL 234

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
           +   +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 235 IRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVR-----LDAETKISENLEMLFLSTKNDEREANLL 357
           TL++SAT P  +   A+  L +P+ V+     L A   I++ +E++    K D    +L+
Sbjct: 295 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELSASHTITQLVEVVSDFEKRDRLNKHLV 354

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
                      AS D+ +K                                         
Sbjct: 355 ----------TASEDKESKI---------------------------------------- 364

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
                ++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + I+V TD
Sbjct: 365 -----LIFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATD 419

Query: 478 VAARGV 483
           VAARG+
Sbjct: 420 VAARGI 425

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 123/429 (28%), Positives = 204/429 (47%), Gaps = 81/429 (18%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL-- 187
           + +  +I S +   GF   TP+Q  TIPL  +N+D+V  + TGSGKT +F++P+ EK+  
Sbjct: 12  YPIQPWIRSAVDVMGFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQ 71

Query: 188 ----KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQ-----LRSVLLTGGDS---L 235
                T   K    ++I+SP++ELA Q H+VF+ F +        +RS LL G +     
Sbjct: 72  EEANTTKMKKGHFHSLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    M N P ++I TPGR L      ++        + DEADRL ++ F + +  ++ 
Sbjct: 132 DDVSDFMENKPQILIGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMN 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  +  K GL NPV V ++++++   +L++     + D++   
Sbjct: 192 ILPKQRRTGLFSATITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK--- 248

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
               L++VI I                                               N 
Sbjct: 249 ----LEQVISI----------------------------------------------INN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNLLR---ESGYL-----ISYIYGTLDQHARKRQLYNFRT 467
              +K  I + PT H V Y  + ++   + G +     I  ++G L   AR + L  F  
Sbjct: 259 YKFKKC-IAYFPTCHSVTYFYSFMQYLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTE 317

Query: 468 GLT-SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS-- 524
            ++ ++L+ TDVAARG+DIP +  V+    P   ++F+HR GRT RA   G A + ++  
Sbjct: 318 TISNAVLLTTDVAARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLTPG 377

Query: 525 --ESELPYL 531
             E  +P++
Sbjct: 378 REEDYIPFM 386

>TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  167 bits (424), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 112/406 (27%), Positives = 196/406 (48%), Gaps = 78/406 (19%)

Query: 145 FRQPTPIQRKTIPLILQ--NRDIVGMARTGSGKTAAFILPMIEKLKTHSGKI-------G 195
           +++PTPIQR  IP I +  +RD +G+A TGSGKT AF++P++ K+ +   +        G
Sbjct: 186 YKEPTPIQRIAIPNICKRGSRDFLGVASTGSGKTLAFVIPILIKMISSEPRPPALKSIEG 245

Query: 196 ARAVILSPSRELAMQTHNVFKDFSK-------GTQLRSVLLTGGDSLEDQFGMMMNNPDV 248
            +A+IL+P+RELA Q     +  +K           R V + GG SLE+    +    D+
Sbjct: 246 PKALILAPTRELAQQIQAESEKITKLWNVKNPEYSCRVVSVVGGHSLEETTYNLQKGCDI 305

Query: 249 IIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSR-----QT 303
           ++ATPGR +       L +K +E  V DEADR+ ++GF+EQ+ ++   L S+      Q 
Sbjct: 306 LVATPGRLIDSLESHILTIKQVETLVLDEADRMIDLGFEEQVTKIFNILESTSEQGKIQK 365

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLD-AETKISENLEMLFLSTKNDEREANLLYLLQE 362
           L+F+AT+  S+   A   L  P    +   E  I +  ++++ S   + R   +  LL++
Sbjct: 366 LMFTATMSGSIERIANGYLQKPSYATIGRGEGSIPQIQQLVYYSGSEERRFRRVKSLLEQ 425

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
                                                          +PP          
Sbjct: 426 Y----------------------------------------------MPP---------I 430

Query: 423 ILFVPTRHHVEY-ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAAR 481
           I+FV  +   ++ +    +E+ + ++ ++G+  Q  R+  L   R+G   +++ T+VAAR
Sbjct: 431 IVFVTYKKTADWLVQKFNQETSFRVTVLHGSKSQDQREHSLQLLRSGKAQVMIATNVAAR 490

Query: 482 GVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           G+DIP ++ V+NF +    + ++HR+GRT RAG +G A + + + E
Sbjct: 491 GLDIPNVSLVVNFQISKQFEDYIHRIGRTGRAGMKGTAITFLGDDE 536

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  164 bits (416), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 178/376 (47%), Gaps = 63/376 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF   G   +++  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 SFEEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 186 KLKTH---SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +      +   G   ++LSP+RELA+Q       F   +++R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
               +++IATPGR + +      +LK + Y V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
           TL++SAT P  +   A   L +P+ V++ +          L LS           + + +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGS----------LELSAS---------HTITQ 334

Query: 363 VIKI--PLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
           V+++      RD+L K                                 L  A+Q   E 
Sbjct: 335 VVEVVSDFEKRDRLNK--------------------------------HLETASQ-DDEY 361

Query: 421 STILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAA 480
            T++F  T+   + I+  LRE G+    I+G  DQ  R   L  FR G + ++V TDVAA
Sbjct: 362 KTLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVAA 421

Query: 481 RGVDIPMLANVINFSL 496
           RG+       ++NFS 
Sbjct: 422 RGI------GMLNFSF 431

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score =  167 bits (423), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 118/406 (29%), Positives = 198/406 (48%), Gaps = 77/406 (18%)

Query: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT-----HSGKI-GARA 198
           + +PTPIQR TIP +   RD +G+A TGSGKT AF++P+I KL T        K+ G  +
Sbjct: 184 YTEPTPIQRVTIPNVDNGRDFLGVAVTGSGKTLAFLIPIIIKLNTLPPLTEITKLNGPYS 243

Query: 199 VILSPSRELAMQTHNVFKDFSKGTQLRS-----VLLTGGDSLEDQFGMMMNNPDVIIATP 253
           +IL+P+RELA Q   +  +  K TQ  S     V + GG ++E+    +    ++++ATP
Sbjct: 244 LILAPTRELAQQ---IEAEARKLTQYWSRPCNVVSIVGGHAIEEISYNLSRGCEILVATP 300

Query: 254 GRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS--RQTLLFSATLP 311
           GR +       L L+ +   V DEADR+ + GF++QL  +L+   SS  RQT++F+AT+ 
Sbjct: 301 GRLIDCLENHVLVLEQVNILVLDEADRMIDYGFEDQLTTILSKTSSSNKRQTMMFTATMS 360

Query: 312 SSLVDFAKAGLTNPVLVRLDAET---KISENLEMLFLSTKNDEREANLLYLLQEVIKIPL 368
            ++   A   L  P  V +  E    +I++ LE                YL  E  +   
Sbjct: 361 PTIEKIADGYLNKPAYVTIGGEETKPQITQILE----------------YLPSEEKRFLK 404

Query: 369 ASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTILFVPT 428
            S+D L  + A                                           I+F+  
Sbjct: 405 LSKDILPHYPA-----------------------------------------PIIIFINY 423

Query: 429 RHHVEYISNLLR-ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPM 487
           +   ++++   + E+ Y  + ++G+  Q  R+  L   R+G   I++ T+VA RG+DIP 
Sbjct: 424 KRTADWLAKKFQDETKYRTTTLHGSKSQEQRENSLNLLRSGKADIMIATNVAGRGIDIPN 483

Query: 488 LANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           ++ V+NF +    + ++HR+GRT RAG  G++ + + + +   L+D
Sbjct: 484 VSLVVNFQMATKLEDYIHRIGRTGRAGKEGYSITFLGDEDENKLVD 529

>Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar to
           Ashbya gossypii ADL024C
          Length = 569

 Score =  167 bits (422), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 127/482 (26%), Positives = 234/482 (48%), Gaps = 86/482 (17%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F L K +++N+ +  F  PTPIQ + I + L  RDI+  A TGSGKT AF+
Sbjct: 112 GSFEDLITRFELDKRLLNNMIQNYFTNPTPIQCEAISMCLNERDIIACAPTGSGKTLAFL 171

Query: 181 LPMIEKLKTHSGKI--GARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLT 230
           +P+I+++   +G++  G + +I+SP++ELA Q        +H +F    K   L   LL+
Sbjct: 172 IPLIQQV-ISAGEVDSGVKGLIISPTKELASQIFTECSKLSHRIF--LEKRRPLNVALLS 228

Query: 231 GGDSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQ 289
              S + +  ++ +   D+I++TP R + L  E  LDL  +++ +FDEAD+LF+  F EQ
Sbjct: 229 KSLSGKLKNKVVSDKKYDIIVSTPLRLIDLVKERALDLSCVKHLIFDEADKLFDKTFLEQ 288

Query: 290 LNELLASLPSSR-QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTK 348
            +++L+S  +++ Q  +FSAT+PS + + A++ + +P+ + +  +   + N+E   +   
Sbjct: 289 TDDILSSCSNNKLQKSMFSATIPSHVEEIAQSIMMDPIRIIIGHKEAANTNIEQKLVFCG 348

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
           N+  E  L+ + Q +++                                          E
Sbjct: 349 NE--EGKLIAIRQLIME-----------------------------------------GE 365

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
             PP          I+F+ +    + + + L      +  I+    Q  R + +  F++G
Sbjct: 366 FRPP---------VIIFLESITRAKALFHELVYDKLNVDVIHAERTQMQRDKIIERFKSG 416

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
               L+ TDV ARGVD   +  VIN+ +P S++ +VHR+GRT R G +G A ++ ++ + 
Sbjct: 417 DLWCLICTDVLARGVDFKGVNLVINYDIPRSAQAYVHRIGRTGRGGMKGKAVTLYTKQDA 476

Query: 529 PYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGH----DEINFKPPKVSYTNRMILGS 584
                    +  K ++  M  S  D++  +W+ +       E N      +++NR  + +
Sbjct: 477 ---------IAIKPIVNVMKQSGCDVV--EWLDKASRMSKKEKNMIKKGSAFSNRKQIST 525

Query: 585 AP 586
            P
Sbjct: 526 VP 527

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  165 bits (417), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 121/409 (29%), Positives = 196/409 (47%), Gaps = 68/409 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 183
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 184 IEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
           + ++         +A+ L+PSRELA QT +V ++  K T++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIVP-DSFEKNKQI-- 207

Query: 244 NNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQLNELLASLPSSRQ 302
            N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQ 266

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            +LFSAT   ++  +AK               KI  N   L L T     E N+      
Sbjct: 267 LVLFSATFAEAVRQYAK---------------KIVPNANTLELQT----NEVNV----DA 303

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
           + ++ +  +++  KF                              E L     L +  S+
Sbjct: 304 IKQLYMDCKNEADKF------------------------------EVLTELYGLMTIGSS 333

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+FV T+     +   L+  G+ +S ++G L    R R + +FR G + +L+ T+V ARG
Sbjct: 334 IIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARG 393

Query: 483 VDIPMLANVINFSLP------ASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           +DIP ++ V+N+ LP      A    ++HR+GRT R G +G A S V +
Sbjct: 394 IDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHD 442

>YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON}
           DBP5Cytoplasmic ATP-dependent RNA helicase of the
           DEAD-box family; involved in mRNA export from the
           nucleus; involved in translation termination; ATP/ADP
           cycling is regulated by Gle1p and Nup159p
          Length = 482

 Score =  164 bits (416), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 121/409 (29%), Positives = 195/409 (47%), Gaps = 68/409 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 183
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 184 IEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
           + ++         +A+ L+PSRELA QT  V ++  K T++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSFEKNKQI-- 207

Query: 244 NNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQLNELLASLPSSRQ 302
            N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            +LFSAT   ++  +AK               KI  N   L L T     E N+  + Q 
Sbjct: 267 LVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEVNVDAIKQ- 306

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
              + +  +++  KF+                               L     L +  S+
Sbjct: 307 ---LYMDCKNEADKFDV------------------------------LTELYGLMTIGSS 333

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+FV T+     +   L+  G+ +S ++G L    R R + +FR G + +L+ T+V ARG
Sbjct: 334 IIFVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARG 393

Query: 483 VDIPMLANVINFSLP------ASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           +DIP ++ V+N+ LP      A    ++HR+GRT R G +G A S V +
Sbjct: 394 IDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHD 442

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 217/455 (47%), Gaps = 86/455 (18%)

Query: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTH---- 190
           +I + I   G+   TP+Q  TIPL   N+D+V  + TGSGKT AF++P++EK+       
Sbjct: 17  WIRTAIDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIING 76

Query: 191 -SGKIGA-RAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTG--GDSLEDQFGM 241
            S K G   ++I+SP+REL+ Q  +VF  F     S    ++S LL G    S+ D    
Sbjct: 77  VSLKKGHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNA 136

Query: 242 MMNN-PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
              N P +++ TPGR         +   S    + DEADRL ++ F++++  +L  LP  
Sbjct: 137 FTENKPQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQ 196

Query: 301 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360
           R+T LFSAT+ S+     + G+ NPV + + A+ +  E+L++ +L  K +++       L
Sbjct: 197 RRTGLFSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDK-------L 249

Query: 361 QEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
           Q+++ I       L  F                                          +
Sbjct: 250 QQLLNI-------LNNFRY----------------------------------------R 262

Query: 421 STILFVPTRHHVEYISNLLR---ESGYL-----ISYIYGTLDQHARKRQLYNFRTGL-TS 471
             I++ PT   V Y  + ++   E G +     I  ++G L  ++R   L  F   L +S
Sbjct: 263 KCIVYFPTCQAVTYFYSFIKHLCELGIIGASLQIFSLHGKLQTNSRLGTLTKFSQSLDSS 322

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV-SESELPY 530
           +L+ TDVAARG+DIP +  V+ F  P ++++F+HR GRT RA   G A + + S  E  Y
Sbjct: 323 VLLTTDVAARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVTFLNSGREEDY 382

Query: 531 LLDLEIFLGKKILMTPMYDSMSDI-----MLKKWI 560
           +  LE+   K I +  M  + + I     + +KWI
Sbjct: 383 VDFLEV---KNIELKEMTCAFTPIDQFESLFRKWI 414

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  164 bits (415), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 197/417 (47%), Gaps = 68/417 (16%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGK 175
           D   +   SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GK
Sbjct: 85  DSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGK 144

Query: 176 TAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSL 235
           TAAF L M+ ++         +A+ L+PSRELA QT  V ++  K T++ S L+   DS 
Sbjct: 145 TAAFSLTMLTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSF 201

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQLNELL 294
           E    +   N  VI+ TPG  L L     + L+ I+  V DEAD +  + G  +Q   + 
Sbjct: 202 EKNKQI---NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVK 258

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
             LP   Q +LFSAT   ++  +AK               KI  N   L L T     E 
Sbjct: 259 RFLPKDTQLVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEV 299

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
           N+      + ++ +  +++  KF                              E L    
Sbjct: 300 NV----DAIKQLYMDCKNEADKF------------------------------EVLTELY 325

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
            L +  S+I+FV T+     +   L+  G+ +S ++G L    R R + +FR G + +L+
Sbjct: 326 GLMTIGSSIIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLI 385

Query: 475 VTDVAARGVDIPMLANVINFSLP------ASSKIFVHRVGRTARAGNRGWAYSIVSE 525
            T+V ARG+DIP ++ V+N+ LP      A    ++HR+GRT R G +G A S V +
Sbjct: 386 TTNVLARGIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFVHD 442

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  164 bits (414), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 119/409 (29%), Positives = 195/409 (47%), Gaps = 68/409 (16%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPM 183
           SF   GL+  ++  I    F++P+ IQ + +PL+L N  R+++  +++G+GKTAAF L M
Sbjct: 88  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 147

Query: 184 IEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
           + ++         +A+ L+PSRELA QT  V ++  K T++ S L+   DS E    +  
Sbjct: 148 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVP-DSFEKNKQI-- 202

Query: 244 NNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQLNELLASLPSSRQ 302
            N  +I+ TPG  L L     + L+ I+  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 203 -NSQIIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 261

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            +LFSAT   ++  +AK               KI  N   L L T     E N+      
Sbjct: 262 LVLFSATFADAVRQYAK---------------KIVPNANTLELQT----NEVNV----DA 298

Query: 363 VIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKST 422
           + ++ +  +++  KF+                               L     L +  S+
Sbjct: 299 IKQLYMDCKNEADKFDV------------------------------LTELYGLMTIGSS 328

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+FV T+     +   L+  G+ +S ++G L    R R + +FR G + +L+ T+V ARG
Sbjct: 329 IIFVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARG 388

Query: 483 VDIPMLANVINFSLP------ASSKIFVHRVGRTARAGNRGWAYSIVSE 525
           +DIP ++ V+N+ LP      A    ++HR+GRT R G +G A S V +
Sbjct: 389 IDIPTVSMVVNYDLPTLANGKADPATYIHRIGRTGRFGRKGVAISFVHD 437

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/463 (28%), Positives = 212/463 (45%), Gaps = 75/463 (16%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL-- 187
           F L  +I + +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 188 -KTHSGKIGA---RAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSL--- 235
            + +S K       ++I++P+REL+ Q  +V   F     S    +R  LL G +     
Sbjct: 72  EEANSSKFKKAQFHSLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    + N P ++I TPGR L       +   +    V DEADRL ++ F + +  +L 
Sbjct: 132 DDVSDFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILR 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L+M +      E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEKLQL 251

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           L+ +L               KF    +                                 
Sbjct: 252 LVSILNNY------------KFKKSIVY-------------------------------- 267

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT-SILV 474
            P+  S   F     H+     L+ E    +  ++G L   AR + L  F   L+ S+L 
Sbjct: 268 FPTCVSVSYFYSFVQHLAKRKTLINEVE--VFSLHGKLQTSARTKTLAAFTNSLSNSVLF 325

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS----ESELPY 530
            TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++    E  +P+
Sbjct: 326 TTDVAARGIDIPQVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLNRGREEDFVPF 385

Query: 531 L----LDL-EIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEIN 568
           +    ++L E+ L  K +    Y+   D     WI E  D  +
Sbjct: 386 MQVKNVELEEVDLKIKGITANFYEDFKD-----WILEDRDRFD 423

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 129/456 (28%), Positives = 215/456 (47%), Gaps = 68/456 (14%)

Query: 129 SFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL- 187
           ++ +  +I + I   GF   TP+Q  TIP+  +N+D+V  + TGSGKT AF++P++EK+ 
Sbjct: 11  NYQVQPWIKAAIDVMGFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKII 70

Query: 188 ----KTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQ-----LRSVLLTGGD--SL 235
                T + K G   ++I++P+REL+ Q  +V + F +        +RS LL G +  S+
Sbjct: 71  AEEANTPNLKKGHFHSLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSV 130

Query: 236 EDQFG-MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
            D     + N P +++ TPGR L       +  KS    V DEADRL ++ F   + ++L
Sbjct: 131 RDDLANFLQNRPQILVGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKIL 190

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
            +LP  R+T LFSAT+ S+     K GL NPV + + ++TK   +L + +   + + +  
Sbjct: 191 KTLPKQRRTGLFSATIGSAGSQIFKTGLRNPVKITVSSKTKAPTSLGLFYTVIEPEAKIQ 250

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
            LL ++               KF    +                                
Sbjct: 251 QLLSIMNNY------------KFKKCIVY------------------------------- 267

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL-TSIL 473
             P+  S   F     +++    LL E     S ++G L   +R++ L +F      ++L
Sbjct: 268 -FPTCISVTYFYSFMQYLQRDKKLLDEEVEFFS-LHGKLQTSSRQKTLDSFGKSFGKAVL 325

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS----ESELP 529
             TDVAARG+DIP +  VI    P+ + +F+HR GRT RA   G A + ++    E  +P
Sbjct: 326 FTTDVAARGIDIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLNKGREEDYIP 385

Query: 530 YLLDLEIFLGK---KILMTPMYDSMSDIMLKKWIAE 562
           +L    + L +   KI+  P  +   +I  K W+ +
Sbjct: 386 FLEVKNVELKEMPLKIIDLPTKEPFYEI-FKNWVLQ 420

>TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.241
           YJL033W
          Length = 775

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 194/410 (47%), Gaps = 75/410 (18%)

Query: 137 ISNITRKGFRQP-----TPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL--KT 189
           ISN T +G ++      T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++EKL  + 
Sbjct: 49  ISNATLRGLKEASFVKLTEIQKNSIPISLKGYDVLGAAKTGSGKTLAFLIPVLEKLYREN 108

Query: 190 HSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVI 249
            +   G  A+I+SP+RELA+Q + V       T   + L+ GG  ++ +    ++  +++
Sbjct: 109 WTEFDGLGALIISPTRELAIQIYEVLLKIGSRTSFSAGLVIGGKDVKFE-SERISRINIL 167

Query: 250 IATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSA 308
           I TPGR L H+   + L+L +++  V DEADR  +MGF++ L+ ++ +LP SRQTLLFSA
Sbjct: 168 IGTPGRILQHMDQAVGLNLNNLQMLVLDEADRCLDMGFKKTLDAIVNNLPISRQTLLFSA 227

Query: 309 TLPSS--------LVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360
           T   S        L D+   G  + V    + ET  S   E L                 
Sbjct: 228 TQSQSLDDLARLSLTDYKSIGTLDIVK---ENETGASATPETL----------------Q 268

Query: 361 QEVIKIPLASR-DQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
           Q  I +PL  + D L  F   ++                                    +
Sbjct: 269 QSYIDVPLQDKLDTLFSFIKTHL------------------------------------K 292

Query: 420 KSTILFVPTRHHVEYISNLLR--ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
              I+F+ +   V ++    R  + G  + +++G   Q AR   L  F       L  TD
Sbjct: 293 NKMIIFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATD 352

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
           V ARG+D P +  V+    P     ++HRVGR AR G +G +  +++ +E
Sbjct: 353 VVARGIDFPSVDWVVQVDCPEDVDTYIHRVGRCARYGKQGKSLIMLTPTE 402

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  165 bits (418), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 134/475 (28%), Positives = 211/475 (44%), Gaps = 99/475 (20%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           F L  +I + +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVK 71

Query: 190 HSG------KIGARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSL--- 235
                    K    ++I++P+REL+ Q  +V   F     S    ++  LL G +     
Sbjct: 72  EEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    + N P ++I TPGR L       +   +    V DEADRL +M F +   ++L 
Sbjct: 132 DDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILR 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++ +      E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCVVNPAEK--- 248

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
               LQ ++ I                                               N 
Sbjct: 249 ----LQLLVSI----------------------------------------------LNN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESG--------YLISYIYGTLDQHARKRQLYNFRT 467
              +K  + F PT   V Y  + ++  G          I  ++G L   AR + L  F  
Sbjct: 259 YKFKKCIVYF-PTCVSVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTD 317

Query: 468 GLT-SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
            L+ S+L  TDVAARG+DIP +  VI    P ++ +F+HR GRT RA   G A + ++E 
Sbjct: 318 SLSNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLNEG 377

Query: 527 E----LPYL---------LDLEIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEIN 568
                +P++         LDLE+    K + T  Y+       + WI E  D  +
Sbjct: 378 REEDFIPFMQVKNVELEELDLEV----KGITTNFYED-----FRNWILEDRDRFD 423

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  165 bits (417), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 214/468 (45%), Gaps = 91/468 (19%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           F L  +I + +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 190 HSG------KIGARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGD--SLE 236
                    K    ++I++P+REL+ Q   V   F     S    ++  LL G +  S+ 
Sbjct: 72  EEANTFKFKKAHFHSLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVR 131

Query: 237 DQFGMMMNN-PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           D   + + N P +++ TPGR L       +   +    + DEADRL +M F + +  +L 
Sbjct: 132 DDVSIFLENRPQILVGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILR 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++       D    N
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKL-------DYCVVN 244

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
            L  LQ ++ I                                               N 
Sbjct: 245 PLEKLQLLVSI----------------------------------------------LNN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNL---LRESGYLIS-----YIYGTLDQHARKRQLYNFRT 467
              +K  + F PT   V Y  +    L +   LIS      ++G L   AR + L +F  
Sbjct: 259 YKFKKCIVYF-PTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFTE 317

Query: 468 GL-TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS-- 524
            L  S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++  
Sbjct: 318 SLNNSVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLNRG 377

Query: 525 --ESELPYL----LDL-EIFLGKKILMTPMYDSMSDIMLKKWIAEGHD 565
             E  +P++    ++L E  L  K ++   YD     + K+W+ E  D
Sbjct: 378 REEDFVPFMQVKNVELEEADLKVKGMVKNFYD-----IFKEWVLEDRD 420

>KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.124
           YGL171W
          Length = 560

 Score =  164 bits (414), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 120/419 (28%), Positives = 203/419 (48%), Gaps = 72/419 (17%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+    F +PTPIQ ++IPL L NRDI+    TGSGKT AF+
Sbjct: 117 GSFEDLITRFSFDKRLLNNLVENHFTEPTPIQCESIPLALNNRDILACGPTGSGKTLAFL 176

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTG- 231
           +P+++++       G + +I+SP++ELA Q        +H +F    K   LR  LL+  
Sbjct: 177 VPLVQQVIDDKEVEGLKGLIISPTKELANQIFIECTKLSHKIF--HGKKKPLRVALLSKS 234

Query: 232 -GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
            G  L+++  +     DVII+TP R + +     LDL  +++ +FDEAD+LF+  F EQ 
Sbjct: 235 LGAKLKNKV-VSDKKYDVIISTPLRLIDVVKNEALDLSRVKHLIFDEADKLFDKTFVEQT 293

Query: 291 NELLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTK 348
           +++L+S   PS R+ + FSAT+PS + + A   + +PV V +  +   + ++E   +   
Sbjct: 294 DDILSSCTDPSLRKAM-FSATIPSGVEEIAHTIMMDPVRVIIGHKEAANSSIEQKLVYCG 352

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
           N+  E  L+ + Q V         Q  +F A                             
Sbjct: 353 NE--EGKLIAIRQMV---------QEGEFKA----------------------------- 372

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+F+ +    + + + L      +  I+       R + +  F++G
Sbjct: 373 ------------PIIIFLESITRAKALYHELMYDRMNVDVIHAERTPVQRTKIIERFKSG 420

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
               L+ TDV ARG+D   +  VIN+ +P +++ +VHR+GRT RAG  G A +  ++ +
Sbjct: 421 DLWCLICTDVLARGIDFKGVNLVINYDVPRTAQAYVHRIGRTGRAGRSGKAVTFYTKQD 479

>Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii AGL004C
          Length = 597

 Score =  164 bits (415), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 128/453 (28%), Positives = 208/453 (45%), Gaps = 68/453 (15%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           + L  +I   +   GF   TP+Q  TIPL   N+D+V  + TGSGKT AF++P++EK+  
Sbjct: 12  YELQPWIKLAVEAMGFEAMTPVQASTIPLFAGNKDVVVESVTGSGKTVAFVIPILEKIIK 71

Query: 190 HSGKIGA------RAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSL--- 235
                 A       ++I+SP+RELA Q   V + F          +RS ++ G + +   
Sbjct: 72  DGANSAAFRKGHFHSLIVSPTRELASQIQLVVQSFLNYYPDNCYPIRSQIIVGTNQVTVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    M N P ++I TPGR L     + +   S    V DEAD+L +  F + ++ +L 
Sbjct: 132 DDVAEFMQNRPQILIGTPGRLLDFLKMVGVKTTSCGIVVLDEADKLLDYNFGKDVDNILK 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  +  K G+ NPV + + +  K  ++L+M ++  + +++   
Sbjct: 192 FLPKQRRTGLFSATISSAGDEVFKTGMRNPVKISVKSHKKAPQSLKMNYVVVEPEKKFEL 251

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL +L               +F    +                                 
Sbjct: 252 LLSIL------------NYYRFKKCIVY-------------------------------- 267

Query: 416 LPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT-SILV 474
           LP+  S   F     H+  +  +  +    I  ++G L   +R + L  F   L  S+L+
Sbjct: 268 LPTCISVTYFYAIIQHLTKLGQM--DEDLKIYSLHGKLQTTSRMKTLEKFTQDLNKSVLL 325

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS----ESELPY 530
            TDVAARG+DIP +  V+    P  + IF+HR GRT RA   G A  +++    E  +P+
Sbjct: 326 TTDVAARGIDIPNIDLVLQMDPPTDTDIFLHRCGRTGRANRVGKAIVLLNAGREEDYIPF 385

Query: 531 LLDLEIFLGK-KILMTPMYDSMSDIMLKKWIAE 562
           L    I L + +I   P+     + ++K WI E
Sbjct: 386 LHVKNIELERTEISCKPI--PGFNTIIKDWILE 416

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  167 bits (422), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 155/246 (63%), Gaps = 12/246 (4%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GL+  I+  IT++  F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++ 
Sbjct: 252 WSQLGLTTDIMDLITKEFKFVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLR 311

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGDSLEDQFG 240
           ++K        + G   +IL+P+RELA+Q +     F+ G+  +RS+  TGG  L+ Q  
Sbjct: 312 QIKAQRPLSKTETGPMGLILAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQIN 371

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    +V++ATPGRF+ L + +N    L  + I + V DEADRLF++GF+ Q+ +++ +
Sbjct: 372 DLKKGVEVVVATPGRFIDL-LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKA 430

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEM-LFLSTKNDEREAN 355
           +   +Q +LFSAT P+ L +FA   L  P+ + +++++ I+EN+E  L +   ++E+ A 
Sbjct: 431 VRPDKQCVLFSATFPNKLKNFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAA 490

Query: 356 LLYLLQ 361
           +L +L+
Sbjct: 491 MLEVLE 496

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 65/116 (56%), Gaps = 2/116 (1%)

Query: 419 EKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
           ++ TI+FV ++   + I N L E GY+   I+     + R   L  F+     IL+ T+V
Sbjct: 519 DEKTIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEV 578

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELP--YLL 532
            +RG+++P ++ VI ++   +   +VH  GRTAR  N+G A +++ E EL   Y+L
Sbjct: 579 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTMLLEGELAASYIL 634

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  165 bits (418), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 123/427 (28%), Positives = 197/427 (46%), Gaps = 81/427 (18%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIEKL--- 187
           +   +  +I R GF   TP+Q+KTI P++    D++  A+TG+GKT AF++PM E L   
Sbjct: 127 IDNMLYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLAN 186

Query: 188 KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQFGMMM 243
           +T S  +  + V+++P+R+LA+Q  +  +   K      + +SV L GG + +     M 
Sbjct: 187 RTDSQYM-VKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMF 245

Query: 244 NN-PDVIIATPGRFLHLKVEMNLD-LKSIEYAVFDEADRLFEMGFQE-------QLNELL 294
              P++I+ATPGR   +  + +    K +++ + DEADRL E+GF++       QLN + 
Sbjct: 246 KERPNIIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSIN 305

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLD--------AETKISENLEMLFLS 346
              P   +TLLFSATL   + + A   +     + LD        A  KI ++L +    
Sbjct: 306 EKGPEHIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVI---- 361

Query: 347 TKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXX 406
               E+ A+ LY   E IK  LA  + L                                
Sbjct: 362 ---SEKFAHNLYAPIEEIKSQLAENENL-------------------------------- 386

Query: 407 XERLPPANQLPSEKSTILFVPTRHHVEYISNLLRE--SGYLISYIYGTLDQHARKRQLYN 464
                           ILFVPT    ++    L +    + I   +G ++Q  R R +  
Sbjct: 387 --------------KAILFVPTVKFAKFFCRSLEQILPDFPILEFHGKIEQRRRTRIVQE 432

Query: 465 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS 524
           F+     +LV TDV ARG+D P +  V    +P+    ++HR+GRTAR G  G A   + 
Sbjct: 433 FKRAKRGLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRATIYLC 492

Query: 525 ESELPYL 531
           + ELP++
Sbjct: 493 KDELPFV 499

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score =  163 bits (413), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 115/411 (27%), Positives = 203/411 (49%), Gaps = 68/411 (16%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+    F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 116 GSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSCAPTGSGKTLAFL 175

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQT--------HNVFKDFSKGTQLRSVLLTGG 232
           +P+++++       G + +I+SP++ELA QT          +F D  K   L+  +L+  
Sbjct: 176 IPLLQQIIDSKDVQGLKGLIISPTKELASQTFVECVKLSRKIFLD--KKRPLQVAILSKS 233

Query: 233 DSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLN 291
            S + +  ++ +   D+II+TP R + L     LDL ++ + VFDEAD+LF+  F EQ +
Sbjct: 234 LSAKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEADKLFDKTFVEQTD 293

Query: 292 ELLASLPSSR-QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           ++L++    R +  +FSAT+PS++ + A++ +T+PV V +  +   + N++   +   N+
Sbjct: 294 DILSACSDPRLRKSMFSATIPSNVEEIAQSIMTDPVRVIIGHKEGANANIDQRLVYCGNE 353

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
             E  L+ + + V         Q  +F                                 
Sbjct: 354 --EGKLIAIRRMV---------QEGEFK-------------------------------- 370

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PP          I+F+ +    + + + L   G  +  ++    Q  R + +  F+TG  
Sbjct: 371 PP---------VIIFLESITRAKALYHELMYDGLNVDVLHAERTQMQRDKIIERFKTGDL 421

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYS 521
             L+ TDV ARG+D   +  V+N+ +P +++ +VHR+GRT R   +G A +
Sbjct: 422 WCLICTDVLARGIDFKGINLVVNYDVPQTAQAYVHRIGRTGRNNRQGKAVT 472

>Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar to
           Ashbya gossypii AGL112C
          Length = 658

 Score =  165 bits (417), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 127/424 (29%), Positives = 202/424 (47%), Gaps = 84/424 (19%)

Query: 140 ITRKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIEKL----KTHSGKI 194
           +  + F   TP+Q++TI P+++ + D+V  A+TG+GKT AF++PM ++L      +S K+
Sbjct: 130 VKMQNFESLTPVQQRTIKPILMTSNDVVARAKTGTGKTMAFLIPMFQRLFMTQNEYSDKV 189

Query: 195 GARAVILSPSRELAMQTH-NVFKDFSKGTQLR---SVLLTGGDSLEDQFGMM-MNNPDVI 249
             + V+++P+R+LA Q    V K       LR   S+ L GG SL +    M  + P ++
Sbjct: 190 --KCVVVAPTRDLAEQIQFEVLKLQKANKALRKFSSICLIGGTSLVNSMRRMDRHAPSIV 247

Query: 250 IATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ------ 302
           IATPGR L  +    +    ++++ V DEAD L ++GF+  L  + ++L S  Q      
Sbjct: 248 IATPGRLLDVMGNSGDKYFNAVDFKVLDEADTLLDIGFKADLQRISSTLNSLNQKGAEHI 307

Query: 303 -TLLFSATLPSSLVDFAKAGLTNPVLVRLD--------AETKISENLEMLFLSTKNDERE 353
            TLLFSAT+ S++ + A   +     + +D        A  KI++NL +        E  
Sbjct: 308 RTLLFSATISSNVQELANNIMNGDTCLFIDTVHKDEPEAHEKITQNLIV-------SESY 360

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
           A+ L    E I+  L  R    KF A                                  
Sbjct: 361 AHNLVAPVETIEKHLKKR----KFKA---------------------------------- 382

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRE--SGYLISYIYGTLDQHARKRQLYNFRTGLTS 471
                    ILF+PT   VE+  NLL++      IS  +G + Q  R R +  F+     
Sbjct: 383 ---------ILFLPTVKSVEFYGNLLKKLFRSLPISLFHGKVSQQRRSRLVKEFKASKHG 433

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 531
           + + TDV ARG+D P + +V    +P+    +VHR+GRTAR G  G A   + + ELP++
Sbjct: 434 LFICTDVGARGMDFPEVDHVYQLGVPSGLSNYVHRIGRTARGGREGEATIFLCKQELPFI 493

Query: 532 LDLE 535
            +LE
Sbjct: 494 NELE 497

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  164 bits (414), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 139/455 (30%), Positives = 210/455 (46%), Gaps = 90/455 (19%)

Query: 140 ITRKGFRQPTPIQRKTIPLILQNR--DIVGMARTGSGKTAAFILPMIEKL--KTHSGKIG 195
           I   GF   TP+Q+K I  IL+N+  D++  A+TG+GKT AF++PM + L          
Sbjct: 93  IVNIGFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRENPSA 152

Query: 196 ARAVILSPSRELAMQ----------THNVFKDFSKGTQLRSVLLTGGDSLEDQF-GMMMN 244
            + VI++P+R+LA+Q           H V K F       S+ L GG +       ++  
Sbjct: 153 VKYVIVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTDLIRR 206

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASL------- 297
            P V+IATPGR L +        K ++  V DEADRL E+GFQ+ L ++ + L       
Sbjct: 207 KPQVVIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKINETG 266

Query: 298 PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST--KND----E 351
           P   +TLLFSATL + + D +++               I    E LFL T  KN+    E
Sbjct: 267 PDHIRTLLFSATLDAKVQDLSQS---------------IMGKDECLFLDTVDKNEPQAHE 311

Query: 352 REANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLP 411
           + +    + + +    LA+ D +                                 +R  
Sbjct: 312 KISQSAVIAENLGHSILATMDHV---------------------------------KRQV 338

Query: 412 PANQLPSEKSTILFVPTRHHVEYISNLL---RESGYLISYIYGTLDQHARKRQLYNFRTG 468
            AN  P+ K+ ILF PT      IS LL   ++    I   +G   Q+ R + +  F+  
Sbjct: 339 LAN--PNYKA-ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKRD 395

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL 528
            + ILV TDVAARG+D P +  V+   +PA    ++HR+GRTARAG  G A   +S+ E+
Sbjct: 396 RSGILVCTDVAARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKAVLFMSKEEV 455

Query: 529 PYLLDLEIFLGKKILMTPMYDSMSDIMLKKWIAEG 563
           P+L  L    G +I++    D   D+   +  A G
Sbjct: 456 PFLQKLA--KGAQIIIKDQEDYEPDMSTIEEFASG 488

>SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {ON}
           highly similar to gnl|GLV|KLLA0E14410g Kluyveromyces
           lactis KLLA0E14410g and similar to YFL002C
           uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA ATP-
           dependent RNA helicase
          Length = 598

 Score =  162 bits (410), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 131/463 (28%), Positives = 210/463 (45%), Gaps = 86/463 (18%)

Query: 129 SFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL- 187
           ++ +  +I + I   GF   TP+Q  TIP+   N+D+V  + TGSGKT +F++P++EK+ 
Sbjct: 11  NYKIQPWIRTAIDTMGFETMTPVQASTIPMFSGNKDVVVESVTGSGKTVSFVIPILEKII 70

Query: 188 --KTHSGKIGA---RAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDS--- 234
             + H+ K+      ++I+SP+REL+ Q   V + F      +   + S LL G +    
Sbjct: 71  ADEAHTAKLKKGHFYSLIISPTRELSSQIQTVIESFLNHYPEENCPISSQLLIGTNKSTV 130

Query: 235 LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
            +D    M N P +++ TPGR L       +   S    V DEAD+L +  F++ +  +L
Sbjct: 131 RDDVNSYMENRPQILVGTPGRILDFLNMPTVKSSSCGVVVLDEADKLLDASFEKDVETIL 190

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
             LP  R+T LFSAT+ S+     K G+ NPV +                 S K+  +  
Sbjct: 191 KLLPKQRRTGLFSATINSAGTQIFKTGMRNPVKI-----------------SVKSKHQAP 233

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
           + L +   V+K  L  +  L   N  N                                 
Sbjct: 234 SSLKIKCAVVKPELKFQLLLTVLNHYNY-------------------------------- 261

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYL--------ISYIYGTLDQHARKRQLYNFR 466
                K  I++ PT   V Y    ++    L        I  ++G L  ++R + L  F 
Sbjct: 262 -----KKCIVYFPTCVSVTYFYAFMQHLLKLGLINEDLDIFSLHGKLQTNSRMKTLERFT 316

Query: 467 TGL-TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
             L T++L+ TDVAARG+DIP +  V+ F  P  + +F+HR GRT RA   G A + ++E
Sbjct: 317 ESLNTAVLLTTDVAARGIDIPDVDLVLQFDPPTDADMFLHRCGRTGRASRVGRAITFLNE 376

Query: 526 S-ELPYLLDLEIFLGKKILMTPMYDSMSDI-----MLKKWIAE 562
             E  Y+  LE+   K I +  +   + +I     + +KWI E
Sbjct: 377 GREEDYIPFLEV---KNIELEEVEIKVKEIPDFQDVFRKWILE 416

>KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081)
           [1320 bp, 439 aa] {ON} similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 439

 Score =  158 bits (400), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 111/419 (26%), Positives = 193/419 (46%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 45  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 104

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 105 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 162

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  +  +DL S++  V DE D++  E+G ++ 
Sbjct: 163 PITKDAELLKNKETAPHIVVATPGRLKALVRDKIIDLSSVKNFVIDECDKVLEELGMRKD 222

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 223 VQDIFRATPRDKQVMMFSATLSQEMRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 282

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 283 EREKNRKLAQLLDDL------------EFN------------------------------ 300

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV + +    ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 301 ------------QVIIFVKSTNRANELTKLLNASNFPAITVHGGMKQEERIARYKAFKEF 348

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ LP+ +  ++HRVGR  R G +G A S V+ SE
Sbjct: 349 EKRICVSTDVFGRGIDIERINLAINYDLPSEADQYLHRVGRAGRFGTKGLAISFVATSE 407

>KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa]
           {ON} Anc_8.402 YDR194C
          Length = 623

 Score =  161 bits (408), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 206/424 (48%), Gaps = 66/424 (15%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTI-PLILQNR-DIVGMARTGSGKTAAFILPMIEKLKT 189
           + K +  +I R GF   TP+Q+KTI P I+ N  DI+  A+TG+GKT AF++P+ + L  
Sbjct: 84  IDKMLHKSIDRMGFPNLTPVQQKTIKPTIMNNENDIIARAKTGTGKTFAFLIPIFQHLIN 143

Query: 190 H--SGKIGARAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQFGMMM 243
                +   +++I++P+R+LA+Q  +  K   K      + + V L GG +L +    M 
Sbjct: 144 TKLDSQYMVKSIIITPTRDLALQIEDEAKKLYKNNYGLKKFQCVSLIGGTNLNESIRRMK 203

Query: 244 N-NPDVIIATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLP--S 299
              P++IIATPGR +  L    N   + +++ V DEADRL E+GF+E L E+   L   S
Sbjct: 204 KLRPNIIIATPGRLIDVLNRYGNEFFRFVDFKVLDEADRLLEIGFKEDLREISNILNEIS 263

Query: 300 SR-----QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN-DERE 353
            R     +T+LFSATL  ++       L+N ++             + LF+ T + +E E
Sbjct: 264 ERDENHIRTMLFSATLDENV-----QNLSNDIM----------NKEKCLFIDTIDKNEPE 308

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
           A       E I   +   D      A NI                          RL   
Sbjct: 309 A------HEKIDQSMVLSDHF----AHNI-----------------YAAANHIQSRLSQD 341

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRE---SGYL---ISYIYGTLDQHARKRQLYNFRT 467
           +++      ILF PT    ++I+ +L +   S Y    I   +G +DQ  R R +  F+ 
Sbjct: 342 SEMKDNYKAILFTPTVKFTKFITGVLYDKLHSKYRDLPIIEFHGQIDQKKRTRLVEQFKR 401

Query: 468 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
             + IL+ TDV ARG+D P +  V+   +P+    ++HR+GRTAR+G  G +   +S+ E
Sbjct: 402 LKSGILICTDVGARGMDFPDVKEVLQIGVPSELSNYIHRIGRTARSGKDGISTLFISKYE 461

Query: 528 LPYL 531
           L +L
Sbjct: 462 LSFL 465

>Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii ADR260C
          Length = 438

 Score =  157 bits (397), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 111/423 (26%), Positives = 191/423 (45%), Gaps = 70/423 (16%)

Query: 119 KSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMAR 170
           K   KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A+
Sbjct: 40  KDTDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAK 99

Query: 171 TGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLL 229
           +G GKTA F+L  +++L   +G++    V+L  +RELA Q  N +  FSK    +++ + 
Sbjct: 100 SGLGKTAVFVLSTLQQLDPVAGEVS--VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVF 157

Query: 230 TGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMG 285
            GG        ++ N    P +++ATPGR   L  + N+DL  ++  V DE D++  E+ 
Sbjct: 158 YGGTDTRKDIELLKNKETAPHIVVATPGRLKALVRDNNIDLSHVKNFVIDECDKVLEELD 217

Query: 286 FQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLF 344
            +  + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  +
Sbjct: 218 MRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYY 277

Query: 345 LSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXX 404
           +  +  E+   L  LL ++            +FN                          
Sbjct: 278 IKLEEREKNRKLAQLLDDL------------EFN-------------------------- 299

Query: 405 XXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYN 464
                             I+FV +      ++ LL  S +    ++G + Q  R  +   
Sbjct: 300 ----------------QVIIFVKSTLRANELTKLLNASNFPAITVHGHMKQEKRIARYKA 343

Query: 465 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS 524
           F+     I V TDV  RG+DI  +   IN+ +P+ +  ++HRVGR  R G +G A S+VS
Sbjct: 344 FKEFEKRICVSTDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

Query: 525 ESE 527
             E
Sbjct: 404 SKE 406

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  163 bits (412), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/247 (34%), Positives = 150/247 (60%), Gaps = 12/247 (4%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GLS   +  IT K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 257 WSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 186 KLKTH----SGKIGARAVILSPSRELAMQTHNVFKDFSKG-TQLRSVLLTGGDSLEDQFG 240
           ++K        + G   +IL+P+RELA+Q H     F++  T +RSV  TGG  ++ Q  
Sbjct: 317 QVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQIT 376

Query: 241 MMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
            +    ++++ATPGRF+ + + +N    L  K I + V DEADRLF++GF+ Q+ +++ +
Sbjct: 377 DLKRGTEIVVATPGRFIDI-LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKT 435

Query: 297 LPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF-LSTKNDEREAN 355
           +   +Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +    DE+  N
Sbjct: 436 VRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDN 495

Query: 356 LLYLLQE 362
           L+ L+ E
Sbjct: 496 LVQLIHE 502

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 2/112 (1%)

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+FV +++  ++IS  L  +G +   I+       R   L  F+    SIL+ T+V +RG
Sbjct: 529 IIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRG 588

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
           +++P ++ VI ++   +   +VH  GRTAR    G A +++   EL   Y+L
Sbjct: 589 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLHDELSGAYIL 640

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 130/239 (54%), Gaps = 4/239 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       + +PTPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 68  SFTELNLVPELIQACKNLNYEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILN 127

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L     ++   A ILSP+RELA Q    F        +R+V + GG ++ DQ   +M  
Sbjct: 128 SL--WHDQLPYYACILSPTRELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRK 185

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      L+ + Y V DEADRL +M F   L+ +L  LP+  R T
Sbjct: 186 PHIIIATPGRLMDHLENTRGFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTT 245

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQE 362
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E
Sbjct: 246 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score =  105 bits (261), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 540 KKI 542
           KK+
Sbjct: 428 KKL 430

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  160 bits (405), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 201/412 (48%), Gaps = 66/412 (16%)

Query: 140 ITRKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIEKL---KTHSGKIG 195
           ++R  F   TP+Q+KTI P++    D++  A+TG+GKT AF++P+ E L   +T S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 196 ARAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQFGMMM-NNPDVII 250
            + VI++P+R+LA+Q  +  +   K      + +S+ L GG + +     M  + P++++
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 251 ATPGRFLHLKVEMNLD-LKSIEYAVFDEADRLFEMGFQEQ-------LNELLASLPSSRQ 302
           ATPGR + +  + +    K +++ V DEADRL E+GF E        LN + A+ P   +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN-DEREANLLYLLQ 361
           TLLFSATL  ++   A AG+ N                E LFL T + +E EA+     +
Sbjct: 297 TLLFSATLGDNVQKLA-AGIMN--------------RKESLFLDTVDVNEPEAHEKIDQR 341

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
            VI    AS +  A  +A                             RL   N+ P +  
Sbjct: 342 LVISENFAS-NLYAPISA--------------------------IKNRLATNNE-PFK-- 371

Query: 422 TILFVPTRHHVEYISNLLRE--SGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
            ILFVPT    ++   +L        +   +G +DQ  R + +  F+     I V TDV 
Sbjct: 372 AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTDVG 431

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 531
           ARG+D P +  V+   +P+    ++HR+GRTAR G  G A   + + ELP++
Sbjct: 432 ARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKATIYLFKDELPFI 483

>TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {ON}
           Anc_8.87 YFL002C
          Length = 604

 Score =  159 bits (402), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 131/461 (28%), Positives = 212/461 (45%), Gaps = 83/461 (18%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           + L  +I + I   GF + TP+Q  TIP++  N+D+V  + TGSGKT AF++P++EK+ +
Sbjct: 12  YELQPWIRTAIDVMGFERMTPVQASTIPMLAGNKDVVVDSVTGSGKTIAFVIPVLEKIIS 71

Query: 190 HSG------KIGARAVILSPSRELAMQTHNVFKDF----SKGTQ-LRSVLLTGGDS--LE 236
                    K     +I++P+REL+ Q   V   F     +G   +RS LL G ++  + 
Sbjct: 72  EQANNVKFKKGHFHTLIIAPTRELSKQIQAVIDSFLDHYPEGLYPIRSKLLVGTNTRTVR 131

Query: 237 DQFGMMMNN-PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           D     +++ P +++ TPGR L       +   S    + DEADRL +  F   +  +L 
Sbjct: 132 DDVAQFLDDRPQILVGTPGRILDFLGNPTVKTSSCSMVILDEADRLLDGSFLGDVENILG 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  +  K GL NP+ + ++++    ++L + +   K +++   
Sbjct: 192 ILPKQRRTGLFSATINSAGENIFKTGLRNPIKITVNSKQSAPQSLNIDYAVVKLEKKLEY 251

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
           LL LL                                                     N 
Sbjct: 252 LLTLL-----------------------------------------------------NN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNLLR--------ESGYLISYIYGTLDQHARKRQLYNF-R 466
              +K  + F PT   V YI N  +        ES   I  ++G L   +R + L +F +
Sbjct: 259 YKFKKCIVYF-PTCIFVNYIYNFFQHLQKSKVIESKLSIFSLHGKLQTSSRMKTLDSFTQ 317

Query: 467 TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSES 526
           T   +IL+ TDVAARG+DIP +  VI    P  S +F+HR GRT RA   G A   +SE 
Sbjct: 318 TFDNAILLTTDVAARGIDIPDVDLVIQVDPPTDSDVFLHRCGRTGRANRIGKAIVFLSEG 377

Query: 527 E----LPYLLDLEIFLGKKIL-MTPMYDSMSDIMLKKWIAE 562
                +P++    + L +  L ++ + ++  DI  K W+ E
Sbjct: 378 REEDFVPFMKVKNVELQRTDLKISNLPNNFYDI-FKTWVLE 417

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  157 bits (396), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       F +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ 
Sbjct: 73  SFNDLNLVPELIEACKNLNFDKPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILN 132

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L     K    A +L+P+RELA QT   F        +RS  + GG ++ DQ   +M  
Sbjct: 133 RL--WEDKQPYYACVLAPTRELAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRK 190

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQT 303
           P +IIATPGR + HL+      L+ + + V DEADRL +M F   L+++L  +P+  R T
Sbjct: 191 PHIIIATPGRLMDHLENTKGFSLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTT 250

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LT PV   +  + +  + L    +   +  +   L+YLL E 
Sbjct: 251 YLFSATMTSKIDKLQRASLTEPVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNEN 310

Query: 364 I 364
           I
Sbjct: 311 I 311

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 540 KKI 542
           KK+
Sbjct: 433 KKL 435

>ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL138C
           (TIF2) and YKR059W (TIF1)
          Length = 396

 Score =  154 bits (390), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 110/428 (25%), Positives = 201/428 (46%), Gaps = 58/428 (13%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  HK   F    L + ++  I   GF  P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKIVHK---FDELKLKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++   S K   +A+IL+P+RELA+Q   V    +    ++     GG  
Sbjct: 72  KTGTFSIAALQRID-ESIK-APQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTD 129

Query: 235 LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             +    +     +++ TPGR   +    N     I+  + DEAD +   GF+EQ+ ++ 
Sbjct: 130 PREDAEALRAGAQIVVGTPGRVFDMIERRNFKTDHIKMFILDEADEMLSSGFKEQIYKIF 189

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
             LP + Q +L SAT+P  ++D     +  PV + +  +    E ++  +++ +++E + 
Sbjct: 190 TMLPPTTQVVLLSATMPKEVLDVTDKFMNKPVRILVKKDALTLEGIQQYYINVESEEYKY 249

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
           + L  L + I +  A                                             
Sbjct: 250 DCLSDLYDSISVTQA--------------------------------------------- 264

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                   ++F  TR  VE ++  L +  + +S IY  L Q  R   +  FRTG + IL+
Sbjct: 265 --------VIFCNTRRKVEELTKRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILI 316

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDL 534
            TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A ++V++ ++  + +L
Sbjct: 317 STDLLARGIDVQQVSLVINYDLPNNKENYIHRIGRGGRFGRKGVAINLVTDRDVGDMREL 376

Query: 535 EIFLGKKI 542
           E F   +I
Sbjct: 377 ERFYSTQI 384

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  157 bits (396), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    L   +I       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 85  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 144

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
            L  H  +    A IL+P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 145 SL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRK 202

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P VIIATPGR + HL+      L+ ++Y V DEADRL +M F   L+ +L  LP+  R T
Sbjct: 203 PHVIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 262

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 263 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEY 322

Query: 364 I 364
           I
Sbjct: 323 I 323

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KSTI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 540 KKI 542
           KK+
Sbjct: 445 KKL 447

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  159 bits (401), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 200/416 (48%), Gaps = 61/416 (14%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQN-RDIVGMARTGSGKTAAFILPMIEKLKTH 190
           LS  +   +  +GF + TP+Q+KT+  ILQ   D+V  A+TG+GKT AF++P+ ++L   
Sbjct: 133 LSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEG 192

Query: 191 SGKIGARAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQF-GMMMNN 245
                 +AV+++P+R+LA Q  N   +         +  +V++ GG S  + F  +    
Sbjct: 193 PPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRR 252

Query: 246 PDVIIATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQ---EQLNELLASL---- 297
           P++++ATPGR +  L+         +++ V DEAD L E+GF+   EQ+N++L  L    
Sbjct: 253 PNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKG 312

Query: 298 PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLL 357
            +  +TLL SATL   +   A +               I  + + LF+ T +   +A   
Sbjct: 313 TTHIRTLLVSATLDDKVQSLANS---------------IMNHAKCLFIDTVDPNEQATNE 357

Query: 358 YLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLP 417
            + Q+V+         ++K  A NI                              A+  P
Sbjct: 358 NIAQKVV---------ISKDFADNITASLYKIREE--------------------ASANP 388

Query: 418 SEKSTILFVPTRHHVEYISNLLRES--GYLISYIYGTLDQHARKRQLYNFRTGLTSILVV 475
             K+ I+F+PT   VEY   LL+    G  +   +G L Q  R   +  FR   + ILV 
Sbjct: 389 KLKA-IVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVC 447

Query: 476 TDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 531
           TDVAARG+D+  + +V    +P S   ++HR+GRT RAG +G +   ++E EL  L
Sbjct: 448 TDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKGSSTIFLAEHELCIL 503

>ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL084W
           (SUB2)
          Length = 438

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 189/420 (45%), Gaps = 70/420 (16%)

Query: 119 KSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMAR 170
           K   KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A+
Sbjct: 40  KDGDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAK 99

Query: 171 TGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLL 229
           +G GKTA F+L  +++L    G++    V+L  +RELA Q  N +  FSK    +++ + 
Sbjct: 100 SGLGKTAVFVLSTLQQLDPVPGEVS--VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVF 157

Query: 230 TGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMG 285
            GG        ++ N    P +++ATPGR   L  + N+DL  ++  V DE D++  E+ 
Sbjct: 158 YGGTDTRKDIELLKNKDTAPHIVVATPGRLKALVRDNNIDLSHVKNFVIDECDKVLEELD 217

Query: 286 FQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLF 344
            +  + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  +
Sbjct: 218 MRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYY 277

Query: 345 LSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXX 404
           +  +  E+   L  LL ++            +FN                          
Sbjct: 278 IRLEEREKNRKLAQLLDDL------------EFN-------------------------- 299

Query: 405 XXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYN 464
                             I+FV +      ++ LL  S +    ++G + Q  R  +   
Sbjct: 300 ----------------QVIIFVKSTLRANELTKLLNASNFPAITVHGHMRQEERIARYKA 343

Query: 465 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS 524
           F+     I V TDV  RG+DI  +   IN+ +P+ +  ++HRVGR  R G +G A S+VS
Sbjct: 344 FKEFEKRICVSTDVFGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON}
           YDR194C (REAL)
          Length = 665

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 198/425 (46%), Gaps = 66/425 (15%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           L K I   ITR  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + L  
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLMN 172

Query: 190 --HSGKIGARAVILSPSRELAMQTHNVFK---DFSKG-TQLRSVLLTGGDSLEDQFGMMM 243
                +   +AVI++P+R+LA+Q  +  K   D + G  +   V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIESEVKKIHDMNYGLKKYGCVSLVGGTDFRAAMNKMN 232

Query: 244 N-NPDVIIATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQ-------LNELL 294
              P+++IATPGR +  L+   N   + ++Y V DEADRL E+GF++        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTKNDERE 353
           +    + +TLLFSATL   +   A   +     + LD   K   E  E +  S    E+ 
Sbjct: 293 SKSVDNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 352

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
           AN ++   E IK  +  R+                                         
Sbjct: 353 ANSIFAAVEHIKKQIKERE----------------------------------------- 371

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLR---ESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
               S    I+F PT     ++ N+L+   +    I   +G + Q+ R   +  F+   +
Sbjct: 372 ----SNYKAIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNKRTSLVKRFKKDES 427

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
            ILV TDV ARG+D P +  V+   +P+    ++HR+GRTAR+G  G +   + + ELP+
Sbjct: 428 GILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPF 487

Query: 531 LLDLE 535
           + +LE
Sbjct: 488 IRELE 492

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  156 bits (394), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 129/222 (58%), Gaps = 4/222 (1%)

Query: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPS 204
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 205 RELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 263
           RELA Q    F        +RSV + GG ++ DQ   +M  P +II TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 264 NLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQTLLFSATLPSSLVDFAKAGL 322
              L++++Y V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 323 TNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVI 364
           TNPV   +  + +  + L    +      ++  L+YLL E I
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFI 313

 Score =  108 bits (271), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 86/137 (62%), Gaps = 3/137 (2%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KS I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 315 KSMIIFTRTKANAERISGLANLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 374

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 375 ARGLDIPSVDVVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 434

Query: 540 KKILMTPMYDSMSDIML 556
           KK+   P  +   DI+L
Sbjct: 435 KKL---PKENVDKDIVL 448

>YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}
           MSS116DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns; non-polar RNA
           helicase that also facilities strand annealing
          Length = 664

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 126/425 (29%), Positives = 197/425 (46%), Gaps = 66/425 (15%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIEKL-- 187
           L K I   ITR  F   TP+Q+KTI  IL  ++ D++  A+TG+GKT AF++P+ + L  
Sbjct: 113 LDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGTGKTFAFLIPIFQHLIN 172

Query: 188 KTHSGKIGARAVILSPSRELAMQTHNVFK---DFSKG-TQLRSVLLTGGDSLEDQFGMMM 243
                +   +AVI++P+R+LA+Q     K   D + G  +   V L GG         M 
Sbjct: 173 TKFDSQYMVKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMN 232

Query: 244 N-NPDVIIATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQ-------LNELL 294
              P+++IATPGR +  L+   N   + ++Y V DEADRL E+GF++        LNE  
Sbjct: 233 KLRPNIVIATPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGILNEKN 292

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTKNDERE 353
           +    + +TLLFSATL   +   A   +     + LD   K   E  E +  S    E+ 
Sbjct: 293 SKSADNIKTLLFSATLDDKVQKLANNIMNKKECLFLDTVDKNEPEAHERIDQSVVISEKF 352

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
           AN ++   E IK  +  RD                                         
Sbjct: 353 ANSIFAAVEHIKKQIKERD----------------------------------------- 371

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLR---ESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
               S    I+F PT     ++ ++L+   +    I   +G + Q+ R   +  F+   +
Sbjct: 372 ----SNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDES 427

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
            ILV TDV ARG+D P +  V+   +P+    ++HR+GRTAR+G  G +   + + ELP+
Sbjct: 428 GILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPF 487

Query: 531 LLDLE 535
           + +LE
Sbjct: 488 VRELE 492

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 149/243 (61%), Gaps = 12/243 (4%)

Query: 130 FGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLK 188
            GLS   ++ IT K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMTLITEKLRFESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 189 TH----SGKIGARAVILSPSRELAMQTHNVFKDFSKGTQL-RSVLLTGGDSLEDQFGMMM 243
                   + G   +IL+P+RELA+Q H   + F+    L RSV  TGG  ++ Q   + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLK 379

Query: 244 NNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS 299
              ++++ATPGRF+ + + +N    L  K I + + DEADRLF++GF+ Q+ +++ ++  
Sbjct: 380 RGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRP 438

Query: 300 SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF-LSTKNDEREANLLY 358
            +Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +   +DE+  NL+ 
Sbjct: 439 DKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLVQ 498

Query: 359 LLQ 361
           ++ 
Sbjct: 499 IVH 501

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 60/112 (53%), Gaps = 2/112 (1%)

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+FV ++   ++IS  L+ +G +   I+       R   L  F+    S+L+ T+V +RG
Sbjct: 529 IIFVSSQQICDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRG 588

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
           +++P ++ VI ++   +   +VH  GRTAR    G A +++   EL   Y+L
Sbjct: 589 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLPDELSGAYIL 640

>KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.384
           YDL084W
          Length = 449

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 190/419 (45%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 55  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 114

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 115 KTAVFVLSTLQQLDPIPGEVSV--VVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 172

Query: 234 SLEDQFGMMMN---NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFE-MGFQEQ 289
            +     ++ N   +P +++ATPGR   L  +  +DL  ++  V DE D++ E +  +  
Sbjct: 173 PINKDAELLKNKETSPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRD 232

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  +   +
Sbjct: 233 VQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYTKLE 292

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 293 EREKNRKLAQLLDDL------------EFN------------------------------ 310

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV + +    ++ LL ES +    ++G + Q  R  +   F+  
Sbjct: 311 ------------QVIIFVKSTNRANELTKLLNESNFPAITVHGHMKQEERIARYKAFKDF 358

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ LP+ +  ++HRVGR  R G +G A S +S  E
Sbjct: 359 EKRICVSTDVFGRGIDIERINLAINYDLPSEADQYLHRVGRAGRFGTKGLAISFISSKE 417

>KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059W TIF1 translation initiation factor eIF4A
          Length = 396

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 109/422 (25%), Positives = 199/422 (47%), Gaps = 57/422 (13%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L + ++  I   GF +P+ IQ++ I  I++ +D++  A++G+GKT  F    I 
Sbjct: 23  SFDDLKLKEELLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTF---SIA 79

Query: 186 KLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244
            L+    KI A + +IL+P+RELA+Q   V    +    ++     GG SL++    +  
Sbjct: 80  ALQNIDEKIKAPQGLILAPTRELALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRG 139

Query: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTL 304
              +I+ TPGR   +         +I+  + DEAD +   GF+EQ+  +   LP + Q +
Sbjct: 140 GAQIIVGTPGRVFDMIDRRIFKTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVV 199

Query: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVI 364
           L SAT+P  +++     + +PV + +  +    E +   +++ + ++ + + L  L + I
Sbjct: 200 LLSATMPGDVLEVTSKFMKDPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSI 259

Query: 365 KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKSTIL 424
            +  A                                                     ++
Sbjct: 260 SVTQA-----------------------------------------------------VI 266

Query: 425 FVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVD 484
           F  TR  VE ++  LRE+ + +S IY  L Q  R   +  FR+G + IL+ TD+ ARG+D
Sbjct: 267 FCNTRRKVEELTERLRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGID 326

Query: 485 IPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILM 544
           +  ++ VIN+ LP++ + ++HR+GR  R G +G A + V+  ++  + +LE F   +I  
Sbjct: 327 VQQVSLVINYDLPSNKENYIHRIGRGGRFGRKGIAINFVTNKDIGAMRELERFYSTQIEE 386

Query: 545 TP 546
            P
Sbjct: 387 LP 388

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 151/245 (61%), Gaps = 14/245 (5%)

Query: 127 FPSFGLSKFIISNITRK-GFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +   GLS  I++ IT K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 255 WSQLGLSTDIMTLITGKLHFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 314

Query: 186 KLKTHSG----KIGARAVILSPSRELAMQTHNVFKDFSKGT--QLRSVLLTGGDSLEDQF 239
           ++K        + G   +IL+P+RELA+Q H     F+ GT   +RSV  TGG  ++ Q 
Sbjct: 315 QVKAQRSLSKHETGPLGLILAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQI 373

Query: 240 GMMMNNPDVIIATPGRFLHLKVEMN----LDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
             +    ++++ATPGRF+ + + +N    L  K I + + DEADRLF++GF+ Q+ +++ 
Sbjct: 374 TDLKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMK 432

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLF-LSTKNDEREA 354
           ++   +Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F +   +DE+  
Sbjct: 433 TVRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFE 492

Query: 355 NLLYL 359
           NL+ +
Sbjct: 493 NLIQI 497

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 60/117 (51%), Gaps = 2/117 (1%)

Query: 418 SEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTD 477
           ++   I+FV ++   + IS  L  +G +   I+       R   L  F+    SIL+ T+
Sbjct: 522 TDAKAIIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCTE 581

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESEL--PYLL 532
           V +RG+++P ++ VI ++   +   +VH  GRTAR    G A +++   EL   Y+L
Sbjct: 582 VLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLNDELSGAYIL 638

>YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON}
           TIF2Translation initiation factor eIF4A, identical to
           Tif1p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 111/433 (25%), Positives = 204/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + +E +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR   + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LEKFYSTQIEELP 387

>YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}
           TIF1Translation initiation factor eIF4A, identical to
           Tif2p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  152 bits (385), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 111/433 (25%), Positives = 204/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + +E +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR   + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LEKFYSTQIEELP 387

>NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87
          Length = 611

 Score =  157 bits (397), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/424 (28%), Positives = 193/424 (45%), Gaps = 81/424 (19%)

Query: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSG-- 192
           +I + I   GF Q TP+Q  TIPL  +N+D+V  + TGSGKT +F++P++EK+   +   
Sbjct: 17  WIRTAIEVMGFDQMTPVQASTIPLFAKNKDVVVESVTGSGKTVSFVIPILEKVIAENANT 76

Query: 193 ----KIGARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDS---LEDQFG 240
               K     +I+SP+REL+ Q  +V   F          +R+ LL G +     +D   
Sbjct: 77  KNFKKAHFHTLIVSPTRELSKQIKSVIDQFLEHYPEDQYPIRAQLLVGTNESTVRDDVND 136

Query: 241 MMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           ++ N P +++ TPGR L       +   S    + DEADRL ++ F + +  +L+ LP  
Sbjct: 137 LIENRPQILVGTPGRILDFLQMPVVKTTSCSMVILDEADRLLDVSFVKDVERILSVLPKQ 196

Query: 301 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLL 360
           R+T LFSAT+ S+     K GL NPV + ++++     +L++ ++    + +   LL ++
Sbjct: 197 RRTGLFSATISSAGNTIFKTGLRNPVKITVNSKNHAPSSLKLNYIVVDPELKFQQLLSIV 256

Query: 361 QEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEK 420
                                                                N    +K
Sbjct: 257 -----------------------------------------------------NNYRYKK 263

Query: 421 STILFVPTRHHVEYISN---LLRESGYL-----ISYIYGTLDQHARKRQLYNFRTGL-TS 471
             + F PT   V Y  +    L+  G +     I  ++G L   +R + L  F   L  S
Sbjct: 264 CIVYF-PTCISVTYFYSFIQFLQSKGIINENLSIFSLHGKLQTVSRMKTLEKFTETLDNS 322

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS----ESE 527
           +L+ TDVAARG+DIP +  VI    P  S IF+HR GRT RA   G A + ++    E  
Sbjct: 323 VLLTTDVAARGIDIPDVDLVIQLDPPTDSDIFLHRCGRTGRANRIGKAITFLNKGREEDY 382

Query: 528 LPYL 531
           +P++
Sbjct: 383 VPFM 386

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  157 bits (398), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 123/428 (28%), Positives = 198/428 (46%), Gaps = 81/428 (18%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQN--RDIVGMARTGSGKTAAFILPMIEKL-- 187
           L K +  +I+R  F   T +Q+KTI  I+Q+  +D++  A+TG+GKT AF++P+ + L  
Sbjct: 105 LDKTLHKSISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLIN 164

Query: 188 KTHSGKIGARAVILSPSRELAMQ----THNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMM 243
                +   + VI++P+R+LA+Q     H + +      +   V L GG +    FG  M
Sbjct: 165 TRRDSQYMVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTN----FGSAM 220

Query: 244 NN-----PDVIIATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQ-------L 290
                  P+++IATPGR +  L    +   K +++ + DEADRL E+GF+E        L
Sbjct: 221 RKMSSVRPNIVIATPGRLMAVLDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDTL 280

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ETKISENLEMLFLS 346
           NE+    P   +TLLFSATL   +   A   +     V LD     E +  E +E   + 
Sbjct: 281 NEINDKSPDHIRTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMVI 340

Query: 347 TKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXX 406
           +   ER A+ +Y   + IK  + S                                    
Sbjct: 341 S---ERMAHSIYAAVDHIKQKMVSE----------------------------------- 362

Query: 407 XERLPPANQLPSEKSTILFVPTRHHVEYISNLLR---ESGYLISYIYGTLDQHARKRQLY 463
                     P+ K+ ILF PT     ++S +LR    S   +   +G +DQ  R   + 
Sbjct: 363 ----------PNYKA-ILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVN 411

Query: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523
            F+   + +LV TDV ARG+D P +  V+   +P+    ++HR+GRTAR G  G +   +
Sbjct: 412 QFKRDKSGLLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSSKIFL 471

Query: 524 SESELPYL 531
            E E+P++
Sbjct: 472 CEEEMPFV 479

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/414 (28%), Positives = 192/414 (46%), Gaps = 70/414 (16%)

Query: 140 ITRKGFRQPTPIQRKTI-PLILQNRDIVGMARTGSGKTAAFILPMIEKL-KTH-SGKIGA 196
           ++R  F   TP+Q+KT+ P++    D++  A+TG+GKT AF++P+ E L KT        
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYMV 178

Query: 197 RAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQFGMMMN-NPDVIIA 251
           + VI++P+R+LA+Q  +      K      + +S+ L GG + +     M    P++++A
Sbjct: 179 KCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVVA 238

Query: 252 TPGRFLHLKVEMNLD-LKSIEYAVFDEADRLFEMGFQEQLNELLASL-------PSSRQT 303
           TPGR + +  + + +  K +++ V DEADRL E+GF E L E+  +L       P   +T
Sbjct: 239 TPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIRT 298

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDA----ETKISENLEMLFLSTKNDEREANLLYL 359
           LLFSATL  ++   A   +     + LD     E +  E +E   + +   +  A+ +Y 
Sbjct: 299 LLFSATLGDNVQKLASGIMDRKQCLFLDTVDKNEPEAHERIEQSLVIS---DTFAHNMYA 355

Query: 360 LQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSE 419
               IK  +A  D+  K                                           
Sbjct: 356 PISAIKDRIAENDKPFK------------------------------------------- 372

Query: 420 KSTILFVPTRHHVE-YISNLLRESGYLISY-IYGTLDQHARKRQLYNFRTGLTSILVVTD 477
              ILFVPT    + Y S L R    L  Y  +G +DQ  R + +  F+     I V TD
Sbjct: 373 --AILFVPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCTD 430

Query: 478 VAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 531
           V ARG+D P +  V    +P+    ++HR+GRTAR G  G A   + + ELP++
Sbjct: 431 VGARGMDFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKASIYLCKDELPFI 484

>TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {ON}
           Anc_1.211 YJL138C
          Length = 396

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 112/433 (25%), Positives = 206/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +   +F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 16  TNYDKVVY---NFDDMNLKEELLKGVYGYGFEEPSAIQQRAILPIVEKHDVLAQAQSGTG 72

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  +E++   S     +A+IL+P+RELA+Q   V    +    ++     GG S
Sbjct: 73  KTGTFSIAALERID--SSIKSPQALILAPTRELALQIQKVVIALALHMDVKVHACIGGTS 130

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR             +I+  + DEAD +   GF+EQ+ ++
Sbjct: 131 FVEDSEGL--RDAQIVVGTPGRVSDNIQRRRFKTDNIKMFILDEADEMLSSGFREQIYQI 188

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SATLP+ +++     + NPV + +  +    E ++  +++ + D+ +
Sbjct: 189 FTMLPPTTQVVLLSATLPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYINVEEDDYK 248

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 249 FDCLTDLYDSISVTQA-------------------------------------------- 264

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L E+ + +S IY  L Q  R   +  FR+G + IL
Sbjct: 265 ---------VIFCNTRRKVEELTQKLTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRIL 315

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 316 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNQDVGAMRE 375

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 376 LEQFYSTQIEELP 388

>Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  152 bits (383), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 205/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + ++ +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LEKFYSTQIEELP 387

>Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059W
           (REAL)
          Length = 395

 Score =  152 bits (383), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 205/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + ++ +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LEKFYSTQIEELP 387

>Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}
           similar to Ashbya gossypii ACR253C
          Length = 396

 Score =  152 bits (383), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 111/428 (25%), Positives = 199/428 (46%), Gaps = 58/428 (13%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  HK   F    L + ++  I   GF  P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKIVHK---FDELKLKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++   S K   +A+IL+P+RELA+Q   V    +    ++     GG  
Sbjct: 72  KTGTFSIAALQRID-ESIK-SPQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTD 129

Query: 235 LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             +    +     +++ TPGR   +          I+  + DEAD +   GF+EQ+ ++ 
Sbjct: 130 PREDAEALRAGAQIVVGTPGRVFDMIERRFFKTDHIKMFILDEADEMLSSGFKEQIYKIF 189

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
             LP + Q +L SAT+P  ++D     +  PV + +  +    E ++  F++ +++E + 
Sbjct: 190 TMLPPTTQVVLLSATMPKEVLDVTDKFMNKPVRILVKKDALTLEGIQQYFINVESEEYKY 249

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
           + L  L + I +  A                                             
Sbjct: 250 DCLSDLYDSISVTQA--------------------------------------------- 264

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                   ++F  TR  VE ++  L E  + +S IY  L Q  R   +  FRTG + IL+
Sbjct: 265 --------VIFCNTRRKVEELTKRLTEDDFTVSAIYSDLPQAQRDTIMKEFRTGSSRILI 316

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDL 534
            TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A ++V+  ++  + +L
Sbjct: 317 STDLLARGIDVQQVSLVINYDLPNNKENYIHRIGRGGRFGRKGVAINLVTSRDVGDMREL 376

Query: 535 EIFLGKKI 542
           E F   +I
Sbjct: 377 EKFYSTQI 384

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  154 bits (389), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    +   +I       F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 67  SFRDLDIVPELIEACENLKFTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILN 126

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 127 QL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRK 184

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      L+ + + V DEADRL +M F   L+ +L ++P+  R T
Sbjct: 185 PHIIIATPGRLMDHLENTKGFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTT 244

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 245 YLFSATMTSKIDKLQRASLTNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEF 304

Query: 364 I 364
           I
Sbjct: 305 I 305

 Score =  112 bits (279), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KSTI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 540 KKI 542
           KK+
Sbjct: 427 KKL 429

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  154 bits (389), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 138/250 (55%), Gaps = 5/250 (2%)

Query: 118 DKSKHKK-GSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKT 176
           D+++H+   SF    L   ++       + +PTPIQ ++IP  L+  DI+G+A+TGSGKT
Sbjct: 74  DETEHETFESFSELDLVPELLQACKNLNYTKPTPIQSRSIPPALKGNDIIGLAQTGSGKT 133

Query: 177 AAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLE 236
           AAF +P++  L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ 
Sbjct: 134 AAFAIPILNSL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMM 191

Query: 237 DQFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           DQ   +M  P +IIATPGR + HL+      L+ ++Y V DEADRL +M F   L+ +L 
Sbjct: 192 DQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILK 251

Query: 296 SLPS-SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
            LP+  R T LFSAT+ S +    +A LTNPV   +  + +  + L    +      ++ 
Sbjct: 252 ILPTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDT 311

Query: 355 NLLYLLQEVI 364
            L+YLL E I
Sbjct: 312 YLVYLLNEFI 321

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 540 KKI 542
           KK+
Sbjct: 443 KKL 445

>KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 437

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 108/420 (25%), Positives = 188/420 (44%), Gaps = 70/420 (16%)

Query: 119 KSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMAR 170
           K   KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A+
Sbjct: 39  KDSDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAK 98

Query: 171 TGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLL 229
           +G GKTA F+L  +++L    G++    V+L  +RELA Q  N +  FSK    +++ + 
Sbjct: 99  SGLGKTAVFVLSTLQQLDPVQGEVS--VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVF 156

Query: 230 TGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMG 285
            GG   ++   ++      P +I+ATPGR   L  + ++DL  ++  V DE D++  E+ 
Sbjct: 157 YGGTEYKNDIDLLSKKETVPHIIVATPGRLKALVRDKHIDLSHVKNFVIDECDKVLEELD 216

Query: 286 FQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLF 344
            +  + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  +
Sbjct: 217 MRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYY 276

Query: 345 LSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXX 404
           +     E+   L  LL ++            +FN                          
Sbjct: 277 IKLNEKEKNRKLAQLLDDL------------EFN-------------------------- 298

Query: 405 XXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYN 464
                             I+FV +      ++ LL  S +    ++G + Q  R  +   
Sbjct: 299 ----------------QVIIFVKSTVRANELTKLLNASNFPAITVHGHMKQEERIARYKA 342

Query: 465 FRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS 524
           F+     I V TDV  RG+DI  +   IN+ +P  +  ++HRVGR  R G +G A S++S
Sbjct: 343 FKEFEKRICVSTDVFGRGIDIERINLAINYDMPNEADQYLHRVGRAGRFGTKGLAISMIS 402

>ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL171W
           (ROK1)
          Length = 569

 Score =  155 bits (392), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 201/402 (50%), Gaps = 73/402 (18%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F L K ++SN+    F +PTPIQ + IP+ LQNRDIV  A TGSGKT AF+
Sbjct: 119 GSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQNRDIVACAPTGSGKTLAFL 178

Query: 181 LPMIEKLKTHSG-KIGARAVILSPSRELAMQTHNVFKDFSKGTQ---------LRSVLLT 230
           +P+++++ +      G + +I+SP++ELA Q   +F + SK  Q         L   LL+
Sbjct: 179 IPLLQQVISDKAVGTGVKGLIISPTKELANQ---IFDECSKLAQRIFLEKKRPLSVALLS 235

Query: 231 G--GDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQE 288
                 L++Q  +     D+II+TP R + +    +LDL +++Y +FDEAD+LF+  F E
Sbjct: 236 KSLAAKLKNQI-VSDKKYDIIISTPLRLIDIVKSESLDLSAVKYLIFDEADKLFDKTFVE 294

Query: 289 QLNELLASLPSSRQT-LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLST 347
           Q +++L++      + +LFSATLPSS+ + A++ +T+PV V +  +   + N+E   +  
Sbjct: 295 QTDDILSACSHPNISKVLFSATLPSSVEELAQSIMTDPVRVIIGHKEAANTNIEQKLVFC 354

Query: 348 KNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXX 407
            N+  E  L+ + Q +         Q   F                              
Sbjct: 355 GNE--EGKLVAIRQLI---------QEGMFR----------------------------- 374

Query: 408 ERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRT 467
              PP          I+F+ +    + + + L      +  I+    Q  R++ +  F++
Sbjct: 375 ---PP---------VIIFLESITRAKALFHELLYDKLNVDVIHAERTQVQREKIIERFKS 422

Query: 468 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGR 509
           G    L+ TDV ARG+D   +  VIN+ +P S++ +VHR+GR
Sbjct: 423 GDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAYVHRIGR 464

>ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38112 Saccharomyces cerevisiae YBR142W MAK5
           Essential nucleolar protein putative DEAD-box RNA
           helicase required for maintenance of M1 dsRNA virus
           involved in biogenesis of large (60S) ribosomal subunits
          Length = 751

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 202/425 (47%), Gaps = 63/425 (14%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKL---K 188
           LS  +++ ++++GF +PT IQ++ +PL L+N DI+G A TGSGKT A+ +P++E L    
Sbjct: 192 LSFTVLNGLSQQGFTKPTDIQKEVLPLALKNEDIMGKAATGSGKTLAYGIPLLESLVHEP 251

Query: 189 THSGKIGARAVILSPSRELAMQTHNVFKDFS----KGTQLRSVLLTGGDSLEDQFGMMM- 243
            HS  IG   +I +P+RELA Q     K       + ++   + LTGG S++ Q  ++  
Sbjct: 252 DHSKSIG---LIFTPTRELAQQVTQHLKKLGQLIIQKSKFAILPLTGGLSIQKQERILKY 308

Query: 244 -NNPDVIIATPGRFLHLKVEMNLDL----KSIEYAVFDEADRLFEMGFQEQLNELLASLP 298
            N+  +++ATPGRFL L +E N+DL      I   V DEADRL + G  ++  ++L  L 
Sbjct: 309 ENSARIVVATPGRFLEL-IEKNIDLIPRFARINTLVLDEADRLLQDGHFDEFEKILKLLG 367

Query: 299 SSR--------QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
            +R        QT++FSAT   SL  F+K    +   ++ D                  D
Sbjct: 368 GARKSFDKTGWQTMIFSATFSLSL--FSKLATASWKSLKKD-----------------ED 408

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           E E  L +L+Q   KI   S+  +   N++                              
Sbjct: 409 EMEQVLKHLMQ---KIRFKSKPVIVDTNSEEKIKSQIRESLIECGPMERDLYSYYFLAMY 465

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQL-------- 462
           P         +T++F  +   V+ +             I+ ++ Q  R R L        
Sbjct: 466 P--------GTTLIFCNSIDSVKKLCAYFNNLKIDAFQIHSSMTQKNRLRSLERYLQKSA 517

Query: 463 YNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSI 522
            N      ++LV +DVAARG+DIP + +V+++ LP ++  ++HR GRTARA N G +  I
Sbjct: 518 QNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTYIHRSGRTARADNEGVSVMI 577

Query: 523 VSESE 527
            S  E
Sbjct: 578 CSPEE 582

>TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.384
           YDL084W
          Length = 438

 Score =  152 bits (385), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 190/419 (45%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 44  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 103

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK   ++++ +  GG 
Sbjct: 104 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGT 161

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +++   ++ N    P +I+ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 162 PIKNDADLLKNKETAPQIIVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRD 221

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 222 VQDIFRATPRDKQVMMFSATLSEDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIE 281

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 282 EREKNRKLAQLLDDL------------EFN------------------------------ 299

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL +S +    ++G + Q  R  +   F+  
Sbjct: 300 ------------QVIIFVKSTKRANELTKLLNDSNFPAITVHGHMKQAERIARYKAFKDF 347

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 348 EKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVSSPE 406

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  153 bits (387), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 127/222 (57%), Gaps = 4/222 (1%)

Query: 145 FRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPS 204
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 205 RELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFL-HLKVEM 263
           RELA Q    F        +RS  + GG S+ DQ   +M  P +IIATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 264 NLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQTLLFSATLPSSLVDFAKAGL 322
             +L+ ++Y V DEADRL +M F   L+ +L  +P+  R T LFSAT+ S +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 323 TNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVI 364
           TNPV   +  + +  + L    +      +   L+YLL E I
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score =  114 bits (285), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 82/123 (66%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KSTI+F  T+ + E ISNL     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 540 KKI 542
           KK+
Sbjct: 428 KKL 430

>TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {ON}
           Anc_8.124 YGL171W
          Length = 570

 Score =  155 bits (391), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 202/417 (48%), Gaps = 68/417 (16%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K ++ N+    F +PTP+Q + IPL L  RD++  A TGSGKT AF+
Sbjct: 120 GSFEDLISRFSFDKRLLRNLLENHFTEPTPVQSECIPLALHTRDMLACAPTGSGKTLAFL 179

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTGG 232
           +P+++++     +IG + +I+SP++ELA Q         + ++ D  +  Q+  +  +  
Sbjct: 180 IPLLQQVIEQKEEIGLKGLIISPTKELADQIFLECTKLANRLYLDKKRPLQIALLSKSLS 239

Query: 233 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
             L+++  +     D+II+TP R + +     LDL ++++ +FDEAD+LF+  F EQ ++
Sbjct: 240 SKLKNKV-ISDKKYDIIISTPLRLIDVVKNEALDLSTVKHLIFDEADKLFDKTFVEQTDD 298

Query: 293 LLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           +L S   PS R+  +FSAT+PS++ + A+  + +P+ V +  +   + N+E   +   N+
Sbjct: 299 ILNSCSDPSLRKA-MFSATIPSNVEEIAQTIMMDPIRVIIGHKEAANANIEQKLIFCGNE 357

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
             E  L+ + Q V         Q  +F                                 
Sbjct: 358 --EGKLIAIKQLV---------QQGEFR-------------------------------- 374

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PP          I+F+ +    + + + L      +  I+       R + +  F+TG  
Sbjct: 375 PPV---------IIFLESITRAKALYHELMYDNLNVDVIHAERTPIQRNKIIEKFKTGEL 425

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
             L+ TDV ARG+D   +  VIN+ +P +++ +VHR+GRT R    G A +  ++ +
Sbjct: 426 WCLITTDVLARGIDFKGVNLVINYDVPRTAQAYVHRIGRTGRGNRSGKAVTFYTKED 482

>Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  151 bits (381), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 109/429 (25%), Positives = 204/429 (47%), Gaps = 61/429 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + ++ +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKI 542
           LE F   +I
Sbjct: 375 LEKFYSTQI 383

>TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}
          Length = 438

 Score =  152 bits (384), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 190/419 (45%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 44  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 103

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK   ++++ +  GG 
Sbjct: 104 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGT 161

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +++   ++ N    P +I+ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 162 PIKNDADLLKNKETAPQIIVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRD 221

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 222 VQDIFRATPRDKQVMMFSATLSEDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIE 281

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 282 EREKNRKLAQLLDDL------------EFN------------------------------ 299

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL +S +    ++G + Q  R  +   F+  
Sbjct: 300 ------------QVIIFVKSTKRANELTKLLNDSNFPAITVHGHMKQAERIARYKAFKDF 347

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 348 EKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVSSPE 406

>Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  155 bits (392), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 118/419 (28%), Positives = 190/419 (45%), Gaps = 77/419 (18%)

Query: 130 FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKT 189
           + L  +I + +   GF   TP+Q  TIP++  N+D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  YSLLPWIRTGLDVMGFESMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVQ 71

Query: 190 HSG------KIGARAVILSPSRELAMQTHNVFKDF-----SKGTQLRSVLLTGGDSL--- 235
                    K    ++I++P+REL+ Q  +V   F     S    ++  LL G +     
Sbjct: 72  EEANSPKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDSFSIKCQLLIGTNEATVR 131

Query: 236 EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLA 295
           +D    + N P ++I TPGR L       +   +    + DEADRL ++ F +   ++L 
Sbjct: 132 DDVSSFLQNRPQILIGTPGRVLDFLQMPAVKSSACSMVILDEADRLLDVSFIKDTEKILR 191

Query: 296 SLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
            LP  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++ +          N
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLNYCV-------VN 244

Query: 356 LLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQ 415
            L  LQ ++ I                                               N 
Sbjct: 245 PLEKLQLLVSI----------------------------------------------LNN 258

Query: 416 LPSEKSTILFVPTRHHVEYISNLLR--------ESGYLISYIYGTLDQHARKRQLYNFRT 467
              +K  + F PT   V Y  + ++         S   +  ++G L   AR + L  F  
Sbjct: 259 YKFKKCIVYF-PTCVSVSYFYSFVQYLSKKNILTSELEVFSLHGKLQTSARMKTLAAFTD 317

Query: 468 GL-TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSE 525
            L  ++L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + +++
Sbjct: 318 SLNNAVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLNK 376

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 137/340 (40%), Gaps = 52/340 (15%)

Query: 420 KSTILFVPTRHHVEYISNLLR--------ESGYLISYIYGTLDQHARKRQLYNFRTGLT- 470
           K  I++ PT   V Y  + ++         S   +  ++G L   AR + L  F   L  
Sbjct: 262 KKCIVYFPTCVSVSYFYSFVQYLSKKNILTSELEVFSLHGKLQTSARMKTLAAFTDSLNN 321

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVS---ESE 527
           ++L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++   E +
Sbjct: 322 AVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLNKGREED 381

Query: 528 LPYLLDL------EIFLGKKILMTPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMI 581
               + +      E+    K +    YD     + K W+ E  D   F     +Y     
Sbjct: 382 FVAFMQVKNVQLEEVDFKIKGITENFYD-----VFKDWVLEDRDR--FDKGVKAYV---- 430

Query: 582 LGSAPRLELEGLGDLYQNVMKSN-FEIQLLKGVAMKAEKLYFRTRPAASPESLK----RS 636
                          Y N   S+ F +Q L  V +   K+Y   R    PE  K     +
Sbjct: 431 ----------AFIKYYSNHSASSIFRLQSLDYVGIA--KMYGLFRLPRMPEITKYLTTEN 478

Query: 637 KEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFASNPDDEMSVFMKRRRRQ 696
           +E + SG    N +        +  +  K + +  +E +   +   D +      +++  
Sbjct: 479 QEGVFSG----NWLVDPPININEYKYKDKKREKERQEALNNLSLINDKKKLKSELKKKNL 534

Query: 697 LAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDN 736
               +   KER +L +KEK++     +E+E LK +   +N
Sbjct: 535 AWSDKTSTKER-KLERKEKMSTKRKAIEEE-LKAEELNEN 572

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 82  SFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 142 RL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 364 I 364
           I
Sbjct: 320 I 320

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 540 KKI 542
           KK+
Sbjct: 442 KKL 444

>Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  152 bits (383), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 187/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 52  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 111

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 112 KTAVFVLSTLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 169

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  
Sbjct: 170 PISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRD 229

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 230 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 289

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 290 EREKNRKLAQLLDDL------------EFN------------------------------ 307

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV + +    ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 308 ------------QVIIFVKSTNRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 355

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 356 EKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKE 414

>Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059W
           (REAL)
          Length = 396

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 205/432 (47%), Gaps = 61/432 (14%)

Query: 112 FSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMART 171
            S TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++
Sbjct: 13  ISLTNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQS 69

Query: 172 GSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTG 231
           G+GKT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     G
Sbjct: 70  GTGKTGTFSVAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIG 127

Query: 232 GDS-LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           G S +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+
Sbjct: 128 GTSFVEDAEGL--KDAQIVVGTPGRVFDNMQRRRFRTDKIKMFILDEADEMLSSGFKEQI 185

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
            ++   LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + +
Sbjct: 186 YQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEE 245

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           + +   L  L + I +  A                                         
Sbjct: 246 DFKYECLTDLYDSISVTQA----------------------------------------- 264

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
                       ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G +
Sbjct: 265 ------------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSS 312

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
            IL+ TD+ ARG+D+  ++ VIN+ LP++ + ++HR+GR  R G +G A + V+  ++  
Sbjct: 313 RILISTDLLARGIDVQQVSLVINYDLPSNKENYIHRIGRGGRFGRKGVAINFVTNEDVGA 372

Query: 531 LLDLEIFLGKKI 542
           + ++E F   +I
Sbjct: 373 MREIEKFYSTQI 384

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 121/428 (28%), Positives = 200/428 (46%), Gaps = 72/428 (16%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNR--DIVGMARTGSGKTAAFILPMIEKL-- 187
           + K +  +I+R GF + T +Q+KTI  IL+++  D++  A+TG+GKT AF++P+ + L  
Sbjct: 139 IDKMLHKSISRMGFPELTSVQQKTIKPILEDKENDVIARAKTGTGKTFAFLIPIFQHLIN 198

Query: 188 KTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT----QLRSVLLTGGDSLEDQFGMMM 243
                +   ++VI++P+R+LA+Q     +          + + + L GG         M 
Sbjct: 199 TQFDSQYMVKSVIVAPTRDLALQIEAEVRKIHDNNYGLKKFQCISLVGGTDFRRAMDKMH 258

Query: 244 N-NPDVIIATPGRFLHLKVEMNLDLKS-IEYAVFDEADRLFEMGFQ---EQLNELLASLP 298
              P+++IATPGR + +  +        +++ V DEADRL E+GF+   EQ++E+L SL 
Sbjct: 259 KLRPNIVIATPGRLIDVMEKFGKKFFGWVDFKVLDEADRLLEIGFKEDLEQISEMLNSLN 318

Query: 299 SSRQ----TLLFSATLPSSLVDFAKAGLTNPVLVRLDA----ETKISENLEMLFLSTKND 350
              +    TLLFSATL   +   A   +  P  + +D     E +  E +E   + TK  
Sbjct: 319 GHSKDHIRTLLFSATLDEKVQGLANQIMNKPKCLFIDTVDKNEPETHEKIEQSLVVTK-- 376

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
               + +Y   E IK  L                                          
Sbjct: 377 -EFGHNIYAAIEHIKAELL----------------------------------------- 394

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLL-RE-SGYL-ISYIYGTLDQHARKRQLYNFRT 467
               + P     ILF PT    ++IS +L RE  G L +   +G + Q  R   +  F+ 
Sbjct: 395 ----EDPKNYKAILFTPTVKFTKFISRILDRELRGKLRVLEFHGQISQSRRTNLVKEFKQ 450

Query: 468 GLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
               +LV TDV ARG+D P +  V+   LP+    ++HR+GRTAR+G  G +   + + E
Sbjct: 451 DRPGLLVCTDVGARGMDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSGKSVIFLCKDE 510

Query: 528 LPYLLDLE 535
           LP++ +L+
Sbjct: 511 LPFITELK 518

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  152 bits (385), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    L   +I       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 82  TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 142 RL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 364 I 364
           I
Sbjct: 320 I 320

 Score =  106 bits (264), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 540 KKI 542
           KK+
Sbjct: 442 KKL 444

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ 
Sbjct: 74  SFAQLNLVPELIQACQNLNFTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILN 133

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           KL     +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 134 KL--WEDQQPYYACVLAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 191

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      LK++++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 192 PHIIIATPGRLMDHLENTKGFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTT 251

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 252 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 311

Query: 364 I 364
           I
Sbjct: 312 I 312

 Score =  107 bits (268), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 540 KKI 542
           KK+
Sbjct: 434 KKL 436

>Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa]
           {ON} complement(136863..138191) [1329 nt, 443 aa]
          Length = 442

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 188/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 48  KKGSYVGIHSTGFKDFLLKPELARAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 107

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 108 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 165

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 166 PITKDAELLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRD 225

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 226 VQDIFRATPRDKQVMMFSATLSEEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLQ 285

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
            +E+   L  LL ++            +FN                              
Sbjct: 286 ENEKNRKLAQLLDDL------------EFN------------------------------ 303

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL ES +    ++G + Q  R  +   F+  
Sbjct: 304 ------------QVIIFVKSTKRANELTKLLNESNFPAITVHGNMKQAERIARYKAFKEF 351

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 352 EKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVSSPE 410

>Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa]
           {ON} complement(135570..136760) [1191 nt, 397 aa]
          Length = 396

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 204/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L   ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 16  TNYDKVVYK---FDDMNLKDELLKGVYGYGFEEPSAIQQRAILPIVEEHDVLAQAQSGTG 72

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++   S     +A+IL+P+RELA+Q   V    +    ++     GG S
Sbjct: 73  KTGTFSIAALQRID--SSIKAPQALILAPTRELALQIQKVVIALAFHMDVKVHACIGGTS 130

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR             +I+  + DEAD +   GF+EQ+ ++
Sbjct: 131 FVEDTEGL--KDAQIVVGTPGRVSDNIQRHRFKTDNIKMFILDEADEMLSSGFREQIYQI 188

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SATLP  +++     + NP+ + +  +    E ++  +++ + ++ +
Sbjct: 189 FTMLPPTTQVVLLSATLPGDVLEVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEQYK 248

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 249 FDCLSDLYDSISVTQA-------------------------------------------- 264

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L ES + +S IY  L Q  R   +  FR+G + IL
Sbjct: 265 ---------VIFCNTRRKVEELTQKLTESNFTVSSIYSDLPQQERDVIMKEFRSGSSRIL 315

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 316 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 375

Query: 534 LEIFLGKKILMTP 546
           +E F   +I   P
Sbjct: 376 IEKFYSTQIEELP 388

>Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 52  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 111

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 112 KTAVFVLSTLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 169

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  
Sbjct: 170 PISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRD 229

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 230 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 289

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 290 EREKNRKLAQLLDDL------------EFN------------------------------ 307

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 308 ------------QVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 355

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 356 EKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKE 414

>YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Component
           of the TREX complex required for nuclear mRNA export;
           member of the DEAD-box RNA helicase superfamily and is
           involved in early and late steps of spliceosome
           assembly; homolog of the human splicing factor hUAP56
          Length = 446

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 52  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 111

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 112 KTAVFVLSTLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 169

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  
Sbjct: 170 PISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRD 229

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 230 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 289

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 290 EREKNRKLAQLLDDL------------EFN------------------------------ 307

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 308 ------------QVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 355

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 356 EKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKE 414

>Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON}
           YDR194C (REAL)
          Length = 664

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 122/417 (29%), Positives = 192/417 (46%), Gaps = 66/417 (15%)

Query: 140 ITRKGFRQPTPIQRKTIPLIL--QNRDIVGMARTGSGKTAAFILPMIEKLKTH--SGKIG 195
           ITR  F   TP+Q+KTI  IL  Q  D++  A+TG+GKT AF++P+ + L       +  
Sbjct: 120 ITRMEFPGLTPVQQKTIKPILSSQEHDVIARAKTGTGKTFAFLIPIFQHLINTKLDSQYM 179

Query: 196 ARAVILSPSRELAMQTHNVFK---DFSKG-TQLRSVLLTGGDSLEDQFGMMMN-NPDVII 250
            +AVI++P+R+LA+Q     K   D + G  +   V L GG         M    P+++I
Sbjct: 180 VKAVIVAPTRDLALQIEAEVKKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVI 239

Query: 251 ATPGRFLH-LKVEMNLDLKSIEYAVFDEADRLFEMGFQEQ-------LNELLASLPSSRQ 302
            TPGR +  L+   N   + ++Y V DEADRL E+GF++        LNE  +    + +
Sbjct: 240 GTPGRLIDVLEKYSNKFFRFVDYKVLDEADRLLEIGFRDDLETISGLLNEKNSKSADNIK 299

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTKNDEREANLLYLLQ 361
           TL+FSATL   +   A   +     + LD   K   E  E +  S    E+ AN ++   
Sbjct: 300 TLMFSATLDDKVQKLANNIMNKSECLFLDTVDKNEPEAHERIDQSVVISEKFANSIFAAV 359

Query: 362 EVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPANQLPSEKS 421
           E IK  +  R+                                             S   
Sbjct: 360 EHIKKQVKERE---------------------------------------------SNYK 374

Query: 422 TILFVPTRHHVEYISNLLR---ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDV 478
            I+F PT     ++ N+L+   +    I   +G + Q+ R   +  F+   + ILV TDV
Sbjct: 375 AIIFAPTVKFTSFLCNILQNEFKKDLPILEFHGKITQNRRTSLVKKFKKDESGILVCTDV 434

Query: 479 AARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLE 535
            ARG+D P +  V+   +P+    ++HR+GRTAR+G  G +   + + ELP++ +LE
Sbjct: 435 GARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVKELE 491

>NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384
          Length = 446

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/424 (25%), Positives = 189/424 (44%), Gaps = 70/424 (16%)

Query: 118 DKSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMA 169
           D    KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A
Sbjct: 47  DGDADKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQA 106

Query: 170 RTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVL 228
           ++G GKTA F+L  ++++    G++    V++  +RELA Q  N +  FSK    +++ +
Sbjct: 107 KSGLGKTAVFVLSTLQQMDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAV 164

Query: 229 LTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EM 284
             GG  +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+
Sbjct: 165 FYGGTPIAKDAELLKNKDTAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEEL 224

Query: 285 GFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEML 343
             +  + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  
Sbjct: 225 NMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQY 284

Query: 344 FLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXX 403
           ++  +  E+   L  LL ++            +FN                         
Sbjct: 285 YIRLEEREKNRKLAQLLDDL------------EFN------------------------- 307

Query: 404 XXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLY 463
                              I+FV + +    ++ LL +S +    ++G + Q  R  +  
Sbjct: 308 -----------------QVIIFVKSTNRANELTKLLNDSNFPAITVHGHMKQEERIARYK 350

Query: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523
            F+     I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S V
Sbjct: 351 AFKDFEKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFV 410

Query: 524 SESE 527
           S  E
Sbjct: 411 SSKE 414

>TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa]
           {ON} Anc_2.384 YDL084W
          Length = 442

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 109/424 (25%), Positives = 188/424 (44%), Gaps = 70/424 (16%)

Query: 118 DKSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMA 169
           D    KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A
Sbjct: 43  DADAEKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQSTIPQSIHGTDVLCQA 102

Query: 170 RTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVL 228
           ++G GKTA F+L  +++L    G+  A  V++  +RELA Q  N +  FSK    +++ +
Sbjct: 103 KSGLGKTAVFVLSSLQQLDPVPGE--ASVVVICNARELAYQIRNEYLRFSKYMPDVKTAV 160

Query: 229 LTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EM 284
             GG  +     ++ N    P +++ATPGR   L  +  +DL  ++  + DE D++  E+
Sbjct: 161 FYGGTPINKDAELLKNKDTAPHIVVATPGRLKALVKDKLIDLSHVKNFIIDECDKVLEEL 220

Query: 285 GFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEML 343
             +  + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  
Sbjct: 221 DMRRDVQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQF 280

Query: 344 FLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXX 403
           F+     ++   L  LL ++            +FN                         
Sbjct: 281 FIKLSESDKNRKLAQLLDDL------------EFN------------------------- 303

Query: 404 XXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLY 463
                              I+FV +      ++ LL  S +    ++G++ Q  R  +  
Sbjct: 304 -----------------QVIIFVKSTKRANELTKLLNASNFPAITVHGSMKQEERIARYK 346

Query: 464 NFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIV 523
            F+     I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S V
Sbjct: 347 AFKDFEKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFV 406

Query: 524 SESE 527
           S +E
Sbjct: 407 SSTE 410

>Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C
           (REAL)
          Length = 396

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 108/432 (25%), Positives = 205/432 (47%), Gaps = 61/432 (14%)

Query: 112 FSTTNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMART 171
            S TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++
Sbjct: 13  ISLTNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQS 69

Query: 172 GSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTG 231
           G+GKT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     G
Sbjct: 70  GTGKTGTFSVAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIG 127

Query: 232 GDS-LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQL 290
           G S +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+
Sbjct: 128 GTSFVEDAEGL--KDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQI 185

Query: 291 NELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
            ++   LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + +
Sbjct: 186 YQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEE 245

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
           + +   L  L + I +  A                                         
Sbjct: 246 DFKYECLTDLYDSISVTQA----------------------------------------- 264

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
                       ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G +
Sbjct: 265 ------------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSS 312

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPY 530
            IL+ TD+ ARG+D+  ++ VIN+ LP++ + ++HR+GR  R G +G A + V+  ++  
Sbjct: 313 RILISTDLLARGIDVQQVSLVINYDLPSNKENYIHRIGRGGRFGRKGVAINFVTNEDVGA 372

Query: 531 LLDLEIFLGKKI 542
           + ++E F   +I
Sbjct: 373 MREIEKFYSTQI 384

>Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 52  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 111

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 112 KTAVFVLSTLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 169

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  E  +DL  ++  V DE D++  E+  +  
Sbjct: 170 PISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRD 229

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 230 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 289

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 290 EREKNRKLAQLLDDL------------EFN------------------------------ 307

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 308 ------------QVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 355

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 356 EKRICVSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKE 414

>KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 and highly similar to
           uniprot|P10081 Saccharomyces cerevisiae YJL138C
           TIF2translation initiation factor eIF4A
          Length = 396

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/429 (25%), Positives = 199/429 (46%), Gaps = 60/429 (13%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  I   GF  P+ IQ++ I  I +  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDLNLKEELLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
           KT  F +  ++K+     KI A +A++L+P+RELA+Q   V    +    ++     GG 
Sbjct: 72  KTGTFSIAALQKI---DPKIKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGT 128

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
           S  +    + +   +++ TPGR   +          I+  + DEAD +   GF+EQ+ ++
Sbjct: 129 SFVEDAEALRDGAQIVVGTPGRVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKI 188

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P  +++     + NP+ + +  +    E ++  F++ + ++ +
Sbjct: 189 FTLLPPTTQVVLLSATMPQDVLEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYK 248

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 249 YDCLSDLYDSISVTQA-------------------------------------------- 264

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L    + +S IY  L Q  R   +  FRTG + IL
Sbjct: 265 ---------VIFCNTRRKVEELTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRIL 315

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 316 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGIAINFVTNKDVGAMRE 375

Query: 534 LEIFLGKKI 542
           LE F   +I
Sbjct: 376 LERFYSTQI 384

>Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059W
           (REAL)
          Length = 429

 Score =  150 bits (379), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/429 (25%), Positives = 204/429 (47%), Gaps = 61/429 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 49  TNYDKVVYK---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTG 105

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 106 KTGTFSIAALQRIDTSVK--APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTS 163

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 164 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQI 221

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + ++ +
Sbjct: 222 FTVLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDFK 281

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 282 YECLTDLYDSISVTQA-------------------------------------------- 297

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR+  + +S IY  L Q  R   +  FR+G + IL
Sbjct: 298 ---------VIFCNTRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRIL 348

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LPA+ + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 349 ISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 408

Query: 534 LEIFLGKKI 542
           LE F   +I
Sbjct: 409 LEKFYSTQI 417

>Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {ON}
           complement(82855..84180) [1326 nt, 442 aa]
          Length = 441

 Score =  150 bits (380), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 113/432 (26%), Positives = 192/432 (44%), Gaps = 73/432 (16%)

Query: 113 STTNLDKSK---HKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQ 161
           +TT  D S     KKGS+    S G   F++       I   GF  P+ +Q+ TIP  + 
Sbjct: 34  ATTAEDASNGDAEKKGSYVGIHSTGFKDFLLKPELARAIIDCGFEHPSEVQQHTIPQSIH 93

Query: 162 NRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKG 221
             D++  A++G GKTA F+L  +++L    G++    V++  +RELA Q  N +  FSK 
Sbjct: 94  GTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKY 151

Query: 222 T-QLRSVLLTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDE 277
              +++ +  GG  +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE
Sbjct: 152 MPDVKTAVFYGGTPINKDAELLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDE 211

Query: 278 ADRLF-EMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKI 336
            D++  E+  +  + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K+
Sbjct: 212 CDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSEEIRPICRRFLQNPLEIFVDDEAKL 271

Query: 337 S-ENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXX 395
           +   L+  +   + +E+   L  LL ++            +FN                 
Sbjct: 272 TLHGLQQYYTKLQENEKNRKLAQLLDDL------------EFN----------------- 302

Query: 396 XXXXXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQ 455
                                      I+FV +      ++ LL ES +    ++G + Q
Sbjct: 303 -------------------------QVIIFVKSTKRANELTKLLNESNFPAITVHGHMKQ 337

Query: 456 HARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGN 515
             R  +   F+     I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G 
Sbjct: 338 AERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGT 397

Query: 516 RGWAYSIVSESE 527
           +G A S VS  E
Sbjct: 398 KGLAISFVSSPE 409

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  152 bits (383), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 84  SFNELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 144 RL-WHDQE-PYYACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNES 321

Query: 364 I 364
           I
Sbjct: 322 I 322

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 443

Query: 540 KKI 542
           +K+
Sbjct: 444 RKL 446

>CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa]
           {ON} highly similar to uniprot|Q07478 Saccharomyces
           cerevisiae YDL084w SUB2
          Length = 439

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 45  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 104

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +R+ +  GG 
Sbjct: 105 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVRTAVFYGGT 162

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 163 PIAKDAELLKNKDTAPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRD 222

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 223 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 282

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 283 EREKNRKLAQLLDDL------------EFN------------------------------ 300

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 301 ------------QVIIFVKSTSRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 348

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 349 EKRICVSTDVFGRGIDIERINLAINYDLLNEADQYLHRVGRAGRFGTKGLAISFVSNKE 407

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  151 bits (382), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/249 (35%), Positives = 132/249 (53%), Gaps = 4/249 (1%)

Query: 118 DKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 177
           D ++    SF    +   ++       F +PTPIQ K IP  L+ +DI+G+A+TGSGKTA
Sbjct: 74  DSTEKTLESFSGLNIVPELLQACKNLNFTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTA 133

Query: 178 AFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLED 237
           AF LP++ +L          A ILSP+RELA Q    F         R+  + GG ++ D
Sbjct: 134 AFALPILNRLWHDQSPY--YACILSPTRELAQQIKETFDSLGTIMGARTTCIVGGMNMMD 191

Query: 238 QFGMMMNNPDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLAS 296
           Q   +M  P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  
Sbjct: 192 QARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKI 251

Query: 297 LPS-SRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREAN 355
           +P+  R T LFSAT+ S +    +A LT+PV   +  + +  + L    +      +   
Sbjct: 252 IPTQGRTTYLFSATMTSKIDKLQRASLTDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTF 311

Query: 356 LLYLLQEVI 364
           L+YLL E I
Sbjct: 312 LIYLLNEFI 320

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 81/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 540 KKI 542
           KK+
Sbjct: 442 KKL 444

>TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON}
           Anc_1.211 YJL138C
          Length = 401

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 108/433 (24%), Positives = 206/433 (47%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +   +F    L K ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 16  TNYDKVVY---TFDDMKLKKELLRGVFAYGFEEPSAIQQRAILPIVEGNDVLAQAQSGTG 72

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++         +A+IL+P+RELA+Q   V    +    ++     GG S
Sbjct: 73  KTGTFSIAALQRINPEIK--APQALILAPTRELALQIQKVVISLALYLDIKVHACIGGTS 130

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR         L    I+  + DEAD +   GF+EQ+ ++
Sbjct: 131 FVEDTEGL--RDAQIVVGTPGRVFDNIQRHRLRTDKIKMFISDEADEMLSSGFKEQIYQI 188

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              +P + Q +L SAT+P  +++     + +PV + +  +    E ++  +++ + ++ +
Sbjct: 189 FTMMPPTTQVVLLSATMPRDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYINVEEEDYK 248

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            ++L  L + I +  A                                            
Sbjct: 249 YDVLTDLYDSISVTQA-------------------------------------------- 264

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L E+ + +S IY  L Q  R+  +  FR+G + IL
Sbjct: 265 ---------VIFCNTRRKVEELTKKLTEADFTVSAIYSDLPQQERETIMKEFRSGSSRIL 315

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 316 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNVDVGAMRE 375

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 376 LETFYSTQIEEMP 388

>YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}
           ROK1RNA-dependent ATPase; involved in pre-rRNA
           processing at sites A0, A1, and A2, and in control of
           cell cycle progression; contains two upstream open
           reading frames (uORFs) in 5' untranslated region which
           regulate translation
          Length = 564

 Score =  152 bits (384), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 109/395 (27%), Positives = 193/395 (48%), Gaps = 68/395 (17%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+   GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 118 GSFEDLISRFSFDKRLLNNLIENGFTEPTPIQCECIPVALNNRDVLACGPTGSGKTLAFL 177

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTGG 232
           +P+++++       G + +I+SP++ELA Q        ++ +F +  +  Q+  +  + G
Sbjct: 178 IPLVQQIIDDKQTAGLKGLIISPTKELANQIFIECFKLSYKIFLEKKRPLQVALLSKSLG 237

Query: 233 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
             L+++  +     D+II+TP R + +     LDL  +++ +FDEAD+LF+  F EQ ++
Sbjct: 238 AKLKNKV-VSDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDD 296

Query: 293 LLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           +L++   PS R+  +FSAT+PS++ + A++ + +PV V +  +   + N+E   +   N+
Sbjct: 297 ILSACREPSLRKA-MFSATIPSNVEEIAQSIMMDPVRVIIGHKEAANTNIEQKLIFCGNE 355

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
             E  L+ + Q V         Q  +F                                 
Sbjct: 356 --EGKLIAIRQLV---------QEGEFK-------------------------------- 372

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PP          I+F+ +    + + + L      +  I+       R R +  F+TG  
Sbjct: 373 PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKTGEL 423

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVH 505
             L+ TDV ARG+D   +  VIN+ +P SS+ +VH
Sbjct: 424 WCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 458

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  151 bits (381), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   ++       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSELKLVPELVEACKNLNYEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 146

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           KL     +    A I++P+RELA Q    F        +RSV + GG ++ DQ   +M  
Sbjct: 147 KL--WEDQQPYYACIMAPTRELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDLMRK 204

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL ++ F   L+ +L  LP+  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQGRTT 264

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YL+ E 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLINEF 324

Query: 364 I 364
           +
Sbjct: 325 V 325

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 85/137 (62%), Gaps = 3/137 (2%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           KS I+F  T+ + E +S L     +    ++G L+Q+ R   L  F+ G  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 540 KKILMTPMYDSMSDIML 556
           KK+   P  +   DI+L
Sbjct: 447 KKL---PKENVDRDIIL 460

>CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171w ATP-dependent RNA helicase
          Length = 565

 Score =  152 bits (384), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 112/394 (28%), Positives = 186/394 (47%), Gaps = 66/394 (16%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F L K +++N+    F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 120 GSFEDLISRFSLDKRLLNNLIENHFTEPTPIQCEAIPLCLNGRDLLACAPTGSGKTLAFL 179

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFG 240
           +P+++++       G + +I+SP++ELA Q  N     SK   L          L    G
Sbjct: 180 IPLLQQIIEEKNFSGVKGLIISPTKELATQIFNECVKLSKRIYLDKKRPLQVAILSKSLG 239

Query: 241 MMMNNP-------DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
             + N        D+II+TP R + +     LDL ++++ +FDEAD+LF+  F EQ +++
Sbjct: 240 AKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSNVKHLIFDEADKLFDKTFIEQTDDI 299

Query: 294 LASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDE 351
           L S   PS R++ +FSAT+PSS+ + A + + +PV V +  +   + N+E   +   N+ 
Sbjct: 300 LNSCTDPSMRKS-MFSATIPSSVEETANSIMNDPVRVIIGHKEAANTNIEQKLIFCGNE- 357

Query: 352 REANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLP 411
            E  L+ + Q V         Q  +F                                 P
Sbjct: 358 -EGKLIAIRQLV---------QQGEFK--------------------------------P 375

Query: 412 PANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTS 471
           P          I+F+ +    + + + L      +  I+       R++ +  F+TG   
Sbjct: 376 P---------IIIFLESIARAKALYHELMYDRINVDVIHAERTAIQREKIIERFKTGELW 426

Query: 472 ILVVTDVAARGVDIPMLANVINFSLPASSKIFVH 505
            L+ TDV ARG+D   +  VIN+ +P +++ +VH
Sbjct: 427 CLICTDVLARGIDFKGVNLVINYDVPTTAQAYVH 460

>Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {ON}
           YKR059W (TIF1) - translation initiation factor eIF4A
           [contig 106] FULL
          Length = 396

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 108/429 (25%), Positives = 200/429 (46%), Gaps = 60/429 (13%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  I   GF  P+ IQ++ I  I +  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDLNLKEELLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGA-RAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGD 233
           KT  F +  ++++     KI A +A++L+P+RELA+Q   V    +    ++     GG 
Sbjct: 72  KTGTFSIAALQQI---DPKIKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGT 128

Query: 234 SLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
           S  +    + +   +++ TPGR   +          I+  + DEAD +   GF+EQ+ ++
Sbjct: 129 SFVEDAEALRDGAQIVVGTPGRVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKI 188

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P  +++     + NP+ + +  +    E ++  F++ + ++ +
Sbjct: 189 FTLLPPTTQVVLLSATMPQDVLEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYK 248

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 249 YDCLSDLYDSISVTQA-------------------------------------------- 264

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE +++ L    + +S IY  L Q  R   +  FRTG + IL
Sbjct: 265 ---------VIFCNTRRKVEELTSRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRIL 315

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 316 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGIAINFVTNKDVGAMRE 375

Query: 534 LEIFLGKKI 542
           LE F   +I
Sbjct: 376 LERFYSTQI 384

>TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  148 bits (373), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 110/433 (25%), Positives = 200/433 (46%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L   ++  +   GF  P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMNLKNELLRGVFGYGFEDPSAIQQRAILPIIEGHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++   S     +A+IL+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRI--DSALKSPQALILAPTRELALQIQKVVIALAFHMDIKVHACIGGTS 129

Query: 235 L-EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
             ED  G+   +  +++ TPGR             SI+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FQEDAEGL--RDAQIVVGTPGRVFDNIQRRKFKTDSIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P  +++     + NPV + +  +    E ++  +++ + +  +
Sbjct: 188 FTLLPPTTQVVLLSATMPKDVLEVTTKFMRNPVRILVKKDELTLEGIQQFYINVEQELYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 248 YDCLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L+   + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTQKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRE 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LETFYSTQIEELP 387

>ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 translation initiation factor
           eIF4A
          Length = 395

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 109/433 (25%), Positives = 201/433 (46%), Gaps = 61/433 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L   ++  +   GF +P+ IQ++ I  I++  D++  A++G+G
Sbjct: 15  TNYDKVVYK---FDDMNLKPELLRGVFGYGFEEPSAIQQRAILPIIEAHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++  +      +A++L+P+RELA+Q   V    +    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDVNVK--APQALMLAPTRELALQIQKVVIALAFHMDIKVHACIGGTS 129

Query: 235 L-EDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
             ED  G+   +  +++ TPGR              I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FQEDAEGL--RDAQIVVGTPGRVFDNIQRRKFKTDHIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+P+ +++     + NPV + +  +    E ++  +++ + +  +
Sbjct: 188 FTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIQQFYINVEEELYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
            + L  L + I +  A                                            
Sbjct: 248 YDCLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  LR   + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTQKLRADSFTVSSIYSDLPQQERDVIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + D
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRD 374

Query: 534 LEIFLGKKILMTP 546
           LE F   +I   P
Sbjct: 375 LEKFYSTQIEELP 387

>Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W
           (REAL)
          Length = 558

 Score =  151 bits (382), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 193/396 (48%), Gaps = 70/396 (17%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+   GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 119 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQSECIPIALNNRDVLACGPTGSGKTLAFL 178

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTGG 232
           +P+++++       G + +I+SP++ELA Q        +H +F    K   L+  LL+  
Sbjct: 179 IPLVQQIIDDKHTPGLKGLIISPTKELANQIFIECFKLSHKIF--LEKKRPLQIALLSKS 236

Query: 233 DSLEDQFGMMMNNP-DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLN 291
            S + +  ++ +   D+II+TP R + +     LDL  +++ +FDEAD+LF+  F EQ +
Sbjct: 237 LSAKLKNKVISDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSD 296

Query: 292 ELLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKN 349
           ++L++   P+ R+  +FSAT+PSS+ + A++ + +PV V +  +   + ++E   +   N
Sbjct: 297 DILSACKEPALRKA-MFSATIPSSVEEIAQSIMMDPVRVIIGHKEAANTDIEQKLVFCGN 355

Query: 350 DEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXER 409
           +  E  L+ + Q V         Q  +F                                
Sbjct: 356 E--EGKLIAIRQLV---------QEGEFK------------------------------- 373

Query: 410 LPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGL 469
            PP          I+F+ +    + + + L      +  I+       R R +  F++G 
Sbjct: 374 -PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKSGE 423

Query: 470 TSILVVTDVAARGVDIPMLANVINFSLPASSKIFVH 505
              L+ TDV ARG+D   +  VIN+ +P SS+ +VH
Sbjct: 424 LWCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 459

>TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.384
           YDL084W
          Length = 444

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 50  KKGSYVGIHSTGFKDFLLEPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 109

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 110 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 167

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 168 PIAKDAELLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRD 227

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 228 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLE 287

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 288 EREKNRKLAKLLDDL------------EFN------------------------------ 305

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 306 ------------QVIIFVRSTSRANELTKLLNASNFPALTVHGHMKQEERIARYKAFKDF 353

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G A S VS  E
Sbjct: 354 EKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVSTKE 412

>YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essential
           nucleolar protein, putative DEAD-box RNA helicase
           required for maintenance of M1 dsRNA virus; involved in
           biogenesis of large (60S) ribosomal subunits
          Length = 773

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 125/438 (28%), Positives = 208/438 (47%), Gaps = 70/438 (15%)

Query: 132 LSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHS 191
           LS  I+ ++    F +PT IQ+K+IP+I+Q  D++G A TGSGKT A+ +P++EKL ++ 
Sbjct: 178 LSMTILQSLQNLNFLRPTEIQKKSIPVIMQGVDVMGKASTGSGKTLAYGIPIVEKLISNF 237

Query: 192 GKIGAR--AVILSPSRELAMQTHNVFKDFSK----GTQLRSVLLTGGDSLEDQFGMMM-- 243
            +   +  ++I +P+RELA Q  +  K   +     +Q   + LTGG S++ Q  ++   
Sbjct: 238 SQKNKKPISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYD 297

Query: 244 NNPDVIIATPGRFLHLKVEMNLDLK---SIEYAVFDEADRLFEMGFQEQLNELLASLPSS 300
           N+  ++IATPGRFL L  + N  +K    +   + DEADRL + G  ++  +++  L   
Sbjct: 298 NSGQIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVE 357

Query: 301 R--------------QTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLS 346
           R              QTL+FSAT    L D                  K+S + ++    
Sbjct: 358 RRKNRENSEGSSKIWQTLIFSATFSIDLFD------------------KLSSSRQVKDRR 399

Query: 347 TKNDEREANLLYLLQEVI-KIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXX 405
            KN+E E N   ++Q ++ KI   S+  +   N ++                        
Sbjct: 400 FKNNEDELN--AVIQHLMSKIHFNSKPVIIDTNPESKVSSQIKESLIECPPLERDLYCYY 457

Query: 406 XXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNF 465
                P         +T++F      V+ ++  L   G     I+ ++ Q  R + L  F
Sbjct: 458 FLTMFP--------GTTLIFCNAIDSVKKLTVYLNNLGIPAFQIHSSMTQKNRLKSLERF 509

Query: 466 R----------------TGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGR 509
           +                  L+++L+ +DVAARG+DIP + +VI++ LP S+ I++HR GR
Sbjct: 510 KQQSAKQKTINHSNPDSVQLSTVLIASDVAARGLDIPGVQHVIHYHLPRSTDIYIHRSGR 569

Query: 510 TARAGNRGWAYSIVSESE 527
           TARAG+ G +  I S  E
Sbjct: 570 TARAGSEGVSAMICSPQE 587

>SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 translation initiation factor
           eIF4A and highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YJL138C TIF2
          Length = 397

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 105/428 (24%), Positives = 195/428 (45%), Gaps = 58/428 (13%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +K   F    L + ++  +   GF  P+ IQ++ I  I +  D++  A++G+G
Sbjct: 16  TNYDKVVYK---FDDLNLKEELLRGVYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTG 72

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++         +A+IL+P+RELA+Q   V    +    +      GG S
Sbjct: 73  KTGTFTIAALQRIDETIK--APQALILAPTRELALQIRKVVMALAFHMDINVHACIGGTS 130

Query: 235 LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELL 294
             +    + N   +++ TPGR   +          I+  + DEAD +   GF+EQ+ ++ 
Sbjct: 131 FVEDAEALRNGAQIVVGTPGRVFDMIERRKFRTDHIKMFILDEADEMLSSGFKEQIYKIF 190

Query: 295 ASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREA 354
             LP + Q +L SAT+P  +++     + NP+ + +  +    E ++  +++ + ++ + 
Sbjct: 191 TLLPPTTQVVLLSATMPGDVLEVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEDYKY 250

Query: 355 NLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPAN 414
           + L  L + I +  A                                             
Sbjct: 251 DCLSDLYDSISVTQA--------------------------------------------- 265

Query: 415 QLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILV 474
                   ++F  TR  VE ++  L    + +S IY  L Q  R   +  FRTG + IL+
Sbjct: 266 --------VIFCNTRRKVEELTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILI 317

Query: 475 VTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDL 534
            TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V+  ++  + +L
Sbjct: 318 STDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGIAINFVTNKDVGAMREL 377

Query: 535 EIFLGKKI 542
           E F   +I
Sbjct: 378 ERFYSTQI 385

>Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W
           (REAL)
          Length = 557

 Score =  150 bits (380), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 105/395 (26%), Positives = 193/395 (48%), Gaps = 68/395 (17%)

Query: 125 GSFPS----FGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFI 180
           GSF      F   K +++N+   GF +PTPIQ + IP+ L NRD++    TGSGKT AF+
Sbjct: 118 GSFEDLISRFSFDKRLLNNLVENGFTEPTPIQSECIPVALNNRDVLACGPTGSGKTLAFL 177

Query: 181 LPMIEKLKTHSGKIGARAVILSPSRELAMQ--------THNVFKDFSKGTQLRSVLLTGG 232
           +P+++++       G + +I+SP++ELA Q        +H +F +  +  Q+  +  + G
Sbjct: 178 IPLVQQIINDKQTTGLKGLIISPTKELANQIFIECFKLSHKIFLEKKRPLQVALLSKSLG 237

Query: 233 DSLEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNE 292
             L+++  +     D+II+TP R + +     LDL  +++ +FDEAD+LF+  F EQ ++
Sbjct: 238 AKLKNKV-VGDKKYDIIISTPLRLIDVVKNEALDLSKVKHLIFDEADKLFDKTFVEQSDD 296

Query: 293 LLASL--PSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKND 350
           +L++   P+ R+  +FSAT+PS++ + A++ + +P+ + +  +   + N++   +   N+
Sbjct: 297 ILSACKEPALRKA-MFSATIPSNVEEIAQSIMMDPIRIIIGHKEAANTNIDQKLIFCGNE 355

Query: 351 EREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERL 410
             E  L+ + Q V         Q  +F                                 
Sbjct: 356 --EGKLIAIRQLV---------QEGEFK-------------------------------- 372

Query: 411 PPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLT 470
           PP          I+F+ +    + + + L      +  I+       R R +  F++G  
Sbjct: 373 PP---------IIIFLESITRAKALYHELMYDRINVDVIHAERTALQRDRIIERFKSGEL 423

Query: 471 SILVVTDVAARGVDIPMLANVINFSLPASSKIFVH 505
             L+ TDV ARG+D   +  VIN+ +P SS+ +VH
Sbjct: 424 WCLICTDVLARGIDFKGVNLVINYDVPGSSQAYVH 458

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  147 bits (371), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/429 (24%), Positives = 201/429 (46%), Gaps = 61/429 (14%)

Query: 115 TNLDKSKHKKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           TN DK  +   +F    L + ++  +   GF  P+ IQ++ I  I+++ D++  A++G+G
Sbjct: 15  TNYDKVVY---TFDDMNLDEKLLRGVYGYGFENPSAIQQRAIMPIIESHDVLAQAQSGTG 71

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDS 234
           KT  F +  ++++ T       +A++L+P+RELA+Q   V    S    ++     GG S
Sbjct: 72  KTGTFSIAALQRIDTSIK--APQALMLAPTRELALQIQKVVMALSFHMDVKVHACIGGTS 129

Query: 235 -LEDQFGMMMNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNEL 293
            +ED  G+   +  +++ TPGR             +I+  + DEAD +   GF+EQ+ ++
Sbjct: 130 FVEDAEGL--RDAQIVVGTPGRVFDNIQRRKFKTDNIKMFILDEADEMLSSGFKEQIYQI 187

Query: 294 LASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDERE 353
              LP + Q +L SAT+PS +++     + NPV + +  +    E ++  +++ + ++ +
Sbjct: 188 FTMLPPTTQVVLLSATMPSDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQYK 247

Query: 354 ANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXERLPPA 413
              L  L + I +  A                                            
Sbjct: 248 YECLTDLYDSISVTQA-------------------------------------------- 263

Query: 414 NQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSIL 473
                    ++F  TR  VE ++  L    + +S IY  L Q  R   +  FR+G + IL
Sbjct: 264 ---------VIFCNTRRKVEELTQKLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRIL 314

Query: 474 VVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLD 533
           + TD+ ARG+D+  ++ VIN+ LP + + ++HR+GR  R G +G A + V   ++  + +
Sbjct: 315 ISTDLLARGIDVQQVSLVINYDLPTNKENYIHRIGRGGRFGRKGVAINFVVNEDVGAMRE 374

Query: 534 LEIFLGKKI 542
           +E F   +I
Sbjct: 375 IEKFYSTQI 383

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           +F    L   ++       + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ 
Sbjct: 84  TFNELNLVPELLQACKNLNYSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 144 RL-WHDQE-PYYACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSS-RQT 303
           P +IIATPGR + HL+      L+ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 321

Query: 364 I 364
           I
Sbjct: 322 I 322

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+ G  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  V+N+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 540 KKI 542
           KK+
Sbjct: 444 KKL 446

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  149 bits (377), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 121/208 (58%), Gaps = 2/208 (0%)

Query: 123 KKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 182
           K  +F  F L + ++  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 41  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 100

Query: 183 MIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +EK+K    KI  +A+I+ P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 101 TLEKIKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 158

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
             +  V++ TPGR L L      DL   +  + DEAD++    F+  + ++L  LP   Q
Sbjct: 159 NESVHVLVGTPGRVLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 218

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRL 330
           +LLFSAT P ++ +F    LTNP  + L
Sbjct: 219 SLLFSATFPLTVKEFMVKHLTNPYEINL 246

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 69/124 (55%)

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+F  + + VE ++  + + GY   Y +  + Q  R R  + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKI 542
           +DI  +  VINF  P +S+ ++HR+GR+ R G+ G A ++++ ++   L  +E  LG +I
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 403

Query: 543 LMTP 546
              P
Sbjct: 404 AAIP 407

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 118/208 (56%), Gaps = 2/208 (0%)

Query: 123 KKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 182
           K  +F  F L + ++  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIP 86

Query: 183 MIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +EK+K    KI  +A+IL P+RELA+QT  V +   K   +  ++ TGG +L D    +
Sbjct: 87  TLEKIKPKVNKI--QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 243 MNNPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQ 302
                V++ TPGR L L      DL      V DEAD++    F+  + ++L+  P SRQ
Sbjct: 145 HEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQ 204

Query: 303 TLLFSATLPSSLVDFAKAGLTNPVLVRL 330
           +LLFSAT P ++ +F    L  P  + L
Sbjct: 205 SLLFSATFPLTVKEFMVNHLNKPYEINL 232

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 69/124 (55%)

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+F  + + VE ++  + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKI 542
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++ ++   L  +E  LG +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 543 LMTP 546
              P
Sbjct: 390 AAIP 393

>ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 443

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/419 (25%), Positives = 186/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 49  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 108

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 109 KTAVFVLSTLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 166

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLF-EMGFQEQ 289
            +     ++ N    P +++ATPGR   L  +  +DL  ++  V DE D++  E+  +  
Sbjct: 167 PISKDADLLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRD 226

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++   
Sbjct: 227 VQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLD 286

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 287 EKEKNRKLAQLLDDL------------EFN------------------------------ 304

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 305 ------------QVIIFVRSTARANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDF 352

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   +N+ L   +  ++HRVGR  R G +G A S +S +E
Sbjct: 353 EKRICVSTDVFGRGIDIERINLALNYDLTTEADQYLHRVGRAGRFGTKGLAISFISSNE 411

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 121/209 (57%), Gaps = 4/209 (1%)

Query: 123 KKGSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILP 182
           K  +F  F L + ++  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALTRRDILARAKNGTGKTAAFVIP 87

Query: 183 MIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMM 242
            +E +K    KI  +A+I+ P+RELA+QT  V +   K   L  ++ TGG +L D   M 
Sbjct: 88  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGLSCMVTTGGTNLRDDI-MR 144

Query: 243 MNNP-DVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSR 301
           +N P  V++ TPGR L L      DL      + DEAD++    F+  + ++L+ LPSS 
Sbjct: 145 LNEPVHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKSLIEQILSFLPSSH 204

Query: 302 QTLLFSATLPSSLVDFAKAGLTNPVLVRL 330
           Q+LLFSAT P ++ +F    L  P  + L
Sbjct: 205 QSLLFSATFPLTVKEFMVKHLNKPYEINL 233

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 69/124 (55%)

Query: 423 ILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARG 482
           I+F  + + VE ++  + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 483 VDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKI 542
           +DI  +  VINF  P +++ ++HR+GR+ R G+ G A ++++ ++   L  +E  LG +I
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 390

Query: 543 LMTP 546
              P
Sbjct: 391 ASIP 394

>SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [1407
           bp, 468 aa] {ON} highly similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 468

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 188/419 (44%), Gaps = 70/419 (16%)

Query: 123 KKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSG 174
           KKGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D++  A++G G
Sbjct: 74  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 133

Query: 175 KTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-QLRSVLLTGGD 233
           KTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    +++ +  GG 
Sbjct: 134 KTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGT 191

Query: 234 SLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFE-MGFQEQ 289
            ++    ++ N    P +++ATPGR   L  +  ++L  ++  V DE D++ E +  +  
Sbjct: 192 PIQKDAELLKNKETAPHIVVATPGRLKALVRDKLINLGHVKNFVIDECDKVLEALDMRRD 251

Query: 290 LNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-ENLEMLFLSTK 348
           + ++  + P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +
Sbjct: 252 VQDIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYVKLE 311

Query: 349 NDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXXXXXXXXXXXE 408
             E+   L  LL ++            +FN                              
Sbjct: 312 EREKNRKLAQLLDDL------------EFN------------------------------ 329

Query: 409 RLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTG 468
                         I+FV +      ++ LL  S +    ++G + Q  R  +   F+  
Sbjct: 330 ------------QVIIFVKSTLRANELTKLLNASNFPAITVHGGMKQEERIARYKAFKEF 377

Query: 469 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESE 527
              I V TDV  RG+DI  +   IN+ LP  +  ++HRVGR  R G +G A S VS  E
Sbjct: 378 EKRICVSTDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAISFVSTKE 436

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  149 bits (377), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 132/241 (54%), Gaps = 4/241 (1%)

Query: 126 SFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIE 185
           SF    L   +I       + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 106 SFSELNLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 165

Query: 186 KLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNN 245
           +L  H  +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 166 QL-WHDQQ-PYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 223

Query: 246 PDVIIATPGRFL-HLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPS-SRQT 303
           P +IIATPGR + HL+      ++ +++ V DEADRL +M F   L+ +L  +P+  R T
Sbjct: 224 PHIIIATPGRLMDHLENTKGFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 283

Query: 304 LLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEV 363
            LFSAT+ S +    +A LTNPV   +  + +  + L    +      +   L+YLL E 
Sbjct: 284 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 343

Query: 364 I 364
           +
Sbjct: 344 L 344

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 420 KSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVA 479
           K+ I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+ G  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 480 ARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLG 539
           ARG+DIP +  VIN+ +P  SK ++HRVGRTARAG  G + S+VS+ +L  +L +E  LG
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 465

Query: 540 KKI 542
           +K+
Sbjct: 466 RKL 468

>KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.384
           YDL084W
          Length = 443

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/429 (26%), Positives = 190/429 (44%), Gaps = 74/429 (17%)

Query: 113 STTNLDKSKHKKGSF---PSFGLSKFIIS-----NITRKGFRQPTPIQRKTIPLILQNRD 164
           STT+ DK    KGS+    S G   F++       I   GF  P+ +Q+ TIP  +   D
Sbjct: 43  STTDGDK----KGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTD 98

Query: 165 IVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGT-Q 223
           ++  A++G GKTA F+L  +++L    G++    V++  +RELA Q  N +  FSK    
Sbjct: 99  VLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPD 156

Query: 224 LRSVLLTGGDSLEDQFGMMMNN---PDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADR 280
           +++ +  GG        ++ N    P +++ATPGR   L  +  +DL  ++  V DE D+
Sbjct: 157 VKTAVFYGGTPTSKDAEILKNKETAPHIVVATPGRLKALVRDKYIDLSHVKNFVIDECDK 216

Query: 281 LF-EMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKIS-E 338
           +  E+  +  + E+  + P  +Q ++FSATL   +    +  L NP+ + +D E K++  
Sbjct: 217 VLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLH 276

Query: 339 NLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFNAQNIXXXXXXXXXXXXXXXX 398
            L+  ++  +  E+   L  LL ++            +FN                    
Sbjct: 277 GLQQYYIKLEEREKNRKLAQLLDDL------------EFN-------------------- 304

Query: 399 XXXXXXXXXERLPPANQLPSEKSTILFVPTRHHVEYISNLLRESGYLISYIYGTLDQHAR 458
                                   I+FV +      ++ LL  S +    ++G + Q  R
Sbjct: 305 ----------------------QVIIFVKSTARANELTKLLNASNFPAITVHGHMKQAER 342

Query: 459 KRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASSKIFVHRVGRTARAGNRGW 518
             +   F+     I V TDV  RG+DI  +   IN+ L   +  ++HRVGR  R G +G 
Sbjct: 343 IARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLSNEADQYLHRVGRAGRFGTKGL 402

Query: 519 AYSIVSESE 527
           A S VS  E
Sbjct: 403 AISFVSSKE 411

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,243,634
Number of extensions: 3833597
Number of successful extensions: 15202
Number of sequences better than 10.0: 631
Number of HSP's gapped: 14324
Number of HSP's successfully gapped: 1128
Length of query: 977
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 858
Effective length of database: 39,836,145
Effective search space: 34179412410
Effective search space used: 34179412410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)