Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C032808.321ON81181142030.0
NDAI0G026008.321ON91190911871e-149
TDEL0F044708.321ON80984811091e-138
ZYRO0F10340g8.321ON81885111071e-138
Suva_10.2208.321ON85488710271e-126
SAKL0H15598g8.321ON78782610221e-126
Skud_12.1968.321ON85488610141e-124
YLR127C (APC2)8.321ON85388110051e-123
Smik_12.1908.321ON8508769951e-121
KLTH0G12342g8.321ON7748219171e-111
CAGL0M04235g8.321ON7838048771e-105
Kwal_56.239098.321ON7767938691e-104
TBLA0A039208.321ON7327348381e-100
TPHA0C008308.321ON8428468125e-95
KAFR0H022808.321ON8178698053e-94
Ecym_42528.321ON6897036905e-79
AGL193W8.321ON7097196872e-78
Kpol_YGOB_Anc_8.3218.321ON5115176532e-75
KNAG0G024308.321ON7978466581e-73
KLLA0D16324g8.321ON6977125625e-61
CAGL0M01782g3.304ON758163743.3
KLLA0A10329gna 1ON63952743.6
NCAS0I014003.304ON758163734.2
CAGL0G09999g7.542ON66074735.0
Smik_2.2133.304ON758163726.8
Suva_5.2257.401ON1386101726.9
YBR080C (SEC18)3.304ON758163717.1
Kpol_534.336.146ON111168727.1
Skud_14.2282.176ON147151717.4
NCAS0D046006.341ON168375718.7
Smik_16.3713.455ON120842709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03280
         (811 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...  1623   0.0  
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   461   e-149
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   431   e-138
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   431   e-138
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   400   e-126
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   398   e-126
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   395   e-124
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   391   e-123
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   387   e-121
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   357   e-111
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   342   e-105
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   339   e-104
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   327   e-100
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   317   5e-95
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   314   3e-94
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   270   5e-79
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   269   2e-78
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   256   2e-75
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   258   1e-73
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   221   5e-61
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...    33   3.3  
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    33   3.6  
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304     33   4.2  
CAGL0G09999g Chr7 (956817..958799) [1983 bp, 660 aa] {ON} simila...    33   5.0  
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...    32   6.8  
Suva_5.225 Chr5 complement(342111..346271) [4161 bp, 1386 aa] {O...    32   6.9  
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...    32   7.1  
Kpol_534.33 s534 complement(77829..81164) [3336 bp, 1111 aa] {ON...    32   7.1  
Skud_14.228 Chr14 (420251..424666) [4416 bp, 1471 aa] {ON} YNL10...    32   7.4  
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    32   8.7  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...    32   9.8  

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score = 1623 bits (4203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/811 (98%), Positives = 797/811 (98%)

Query: 1   MSLDADLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRA 60
           MSLDADLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRA
Sbjct: 1   MSLDADLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRA 60

Query: 61  GYSQDEKFKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDIS 120
           GYSQDEKFKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDIS
Sbjct: 61  GYSQDEKFKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDIS 120

Query: 121 NLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSA 180
           NLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSA
Sbjct: 121 NLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSA 180

Query: 181 TDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTN 240
           TDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTN
Sbjct: 181 TDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTN 240

Query: 241 LIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEW 300
           LIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEW
Sbjct: 241 LIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEW 300

Query: 301 SKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRS 360
           SKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRS
Sbjct: 301 SKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRS 360

Query: 361 NEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYKKFS 420
           NEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYKKFS
Sbjct: 361 NEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYKKFS 420

Query: 421 PEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESK 480
           PEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESK
Sbjct: 421 PEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESK 480

Query: 481 DKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIM 540
           DKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIM
Sbjct: 481 DKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIM 540

Query: 541 LHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKFKRQSEYQFPLDSKLRKKLSKYM 600
           LHD              FQNSSEMQLFPKFISKLYWKFKRQSEYQFPLDSKLRKKLSKYM
Sbjct: 541 LHDISISKESSNEKISEFQNSSEMQLFPKFISKLYWKFKRQSEYQFPLDSKLRKKLSKYM 600

Query: 601 KSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLS 660
           KSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLS
Sbjct: 601 KSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLS 660

Query: 661 INQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPL 720
           INQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPL
Sbjct: 661 INQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPL 720

Query: 721 SQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYS 780
           SQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYS
Sbjct: 721 SQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYS 780

Query: 781 KVTVTQLEAYLDQLVEEEQLIVLPDGSFKKL 811
           KVTVTQLEAYLDQLVEEEQLIVLPDGSFKKL
Sbjct: 781 KVTVTQLEAYLDQLVEEEQLIVLPDGSFKKL 811

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  461 bits (1187), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 318/909 (34%), Positives = 496/909 (54%), Gaps = 103/909 (11%)

Query: 1   MSLDADLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRA 60
           +  D DL  I  S+   ++ Q+HPQL+++LLWL+PN +         T++LK+CIN++ +
Sbjct: 5   LDTDVDLSRITESIFVSIDPQYHPQLQTMLLWLNPNETTTQSATTM-TIDLKNCINIIVS 63

Query: 61  GYSQDEKFKMWLREYYLYVVKFHFMKN--VDEISVLKDFKLLEMIYIYPLQFM-DLVDST 117
            Y +D++ ++  ++YY +V+K HFMK+     ++ +++F  LE +Y+ PL+F  DL+D+ 
Sbjct: 64  TYGKDDQIRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFTYDLIDTN 123

Query: 118 DISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGV 177
           ++ +L+  FK YLI+ N TFRKN++   +  FL  +QFEF+Y   ++ EI+ W+ D+ G 
Sbjct: 124 EMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANGN 183

Query: 178 LSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLI-------G 230
           +S  DL+LD  L KIE F + +M G  N +FI+ME FN FI+ YWK +++L        G
Sbjct: 184 VSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDYG 243

Query: 231 NIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSIL-----SKQNS 285
           ++E+DH LTNLIY FF +QFIKIRI E L IMV ++P + PTI+ELK++L      ++N 
Sbjct: 244 DVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPRENV 303

Query: 286 STAGAR--KRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPS 343
           ST      +     +E+ K  +K+FL  F+R+FLNPCIPTI ++ A VK T SFL+LDP 
Sbjct: 304 STTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDPR 363

Query: 344 GSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKEL 403
           G LL +I++ +KP ++    ++V+ILLYA+LNL   +L +L C    +D+ S  +L  EL
Sbjct: 364 GQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGC-NIDFDIESFNILVSEL 422

Query: 404 -------SNDHSKHAGDVDYKKFSPEGTNEFE---NSTLPYEQV---------------- 437
                   N +  +   V Y       T   E   N  +PY+ V                
Sbjct: 423 YPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYLARRK 482

Query: 438 ---------YTDFLNWKPSITPISESSN-----DDEFASLGKNITPIDYVFNALESKDKL 483
                    +  +L W P +  I +S++     DDE  S  ++   IDY+F   +S D L
Sbjct: 483 PETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDSIDLL 542

Query: 484 ISEFLKLLTIKLLHMKG-YEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLH 542
           +SE+LKLLT K +H K  Y +++ W  CL +L++K  S    V DE++ S INTI IML+
Sbjct: 543 LSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEKSNSSN--VPDENVKSTINTIDIMLN 600

Query: 543 DXXXXXXXXXXXXXXFQNS---SEMQLFPKFISKLYWKFKRQSEYQFPLDSKLR-KKLSK 598
           D               +N+    ++  +PK +SKLYWK    +  ++ ++ K     L K
Sbjct: 601 DMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWKINSTNIAKWRMNMKGDFFHLLK 660

Query: 599 YMKSYHHSHP---------------GMKLKLVNGTGICSLNLTFKDGRKLSVD-ATFEQY 642
           Y K+   +H                G K++L     +  + ++F DGR+L  D  T EQY
Sbjct: 661 YSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQY 720

Query: 643 TVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQND--YYTIQEY 700
            VLS F  +K  +  +       + LK   +++   +QFW++KKVL   +D   Y + E 
Sbjct: 721 DVLSLFTVEKGAAFTLEKAYDFFSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLER 780

Query: 701 LNNQELSSGPTVITSSILPLSQERMPF-------------------KRSVPTNVLNDPKE 741
           L   +       +    +  S  RM                      + V +   ++ K 
Sbjct: 781 LTFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKN 840

Query: 742 ILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLI 801
           IL R++P+IN M  NLGS+K++KIHSFL M+VPR   Y+++ + QLE YL+ LVE+E+L 
Sbjct: 841 ILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLE 900

Query: 802 VLPDGSFKK 810
              DG+FKK
Sbjct: 901 TTTDGAFKK 909

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  431 bits (1109), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 277/848 (32%), Positives = 445/848 (52%), Gaps = 92/848 (10%)

Query: 5   ADLPTIITSLREQVERQFHP----QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLL-- 58
           ++LP II S++E V  + HP     LE+LL WL+PN S+     +PP L LKD I L   
Sbjct: 7   SELPVIIDSIKE-VALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVN 65

Query: 59  ---RAGY--------SQDEKFKMW--LREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYI 105
               +GY        ++  +F++   LR++Y+Y V+ HF  + + I   KD + LE  Y+
Sbjct: 66  QYYNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYV 125

Query: 106 YPLQFMDLVDSTDISNLVK--SFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFAN 163
            PL ++ L +S+    +++    +HYL+++N+ F  N+  + +  F+   Q +FEY    
Sbjct: 126 SPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFM---QDDFEY---- 178

Query: 164 IVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWK 223
           + E++ W++ +   LS+ D++LD  + K++ F  + M+G   + ++VM+TFNKFI  YW 
Sbjct: 179 VAEMLDWVEKAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWS 238

Query: 224 NLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQ 283
           N  QL+G  +DDH LTN++Y  FE+QFI+IR +E+  I V ++P +KPTI+E++ +++  
Sbjct: 239 NFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHS 298

Query: 284 NSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPS 343
                             K ++  FL TF+++ LNP + T D L AYVK+ K+FL LDPS
Sbjct: 299 TD---------------FKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPS 343

Query: 344 GSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSI--ELLSK 401
           G  L S++ FVK   +    ++V ILLYA+L+L+   L+  + +     ++++  EL   
Sbjct: 344 GRYLQSVISFVKQTFQERS-DLVVILLYAILDLQLDGLVGSHIQVDPVCLKALASELRDP 402

Query: 402 ELSNDHSKHAGD------VDYKKFSPEGTNEFENSTLPYEQVYTDFLNWKP---SITPIS 452
           EL  ++  +  D          K + EG        LPYE+V   FL+W P    + P +
Sbjct: 403 ELGIENDIYPDDNLANVATGMAKLNYEG-------CLPYEEVMQRFLSWNPDPRDMAPRA 455

Query: 453 ESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQ---- 508
            S       SL      +D +    ESKD  +SEFLKLLT +LL +K Y ++  W     
Sbjct: 456 ISKQSPSHMSL------LDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQ 509

Query: 509 -------KCLKILQDKVTSDKNIVNDESITSDINTILIMLHDXXXXXXXXXXXXXXFQNS 561
                  +    +    T  +N        S+IN+  +ML D                + 
Sbjct: 510 LLKKKLARGAPNISLAPTGQQNNSERGDDYSNINSNDVMLWDVKLSYELCKQMHQV--SG 567

Query: 562 SEMQLFPKFISKLYWKFKRQSEYQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGTGIC 621
            + +++PKFIS LYW  + +S+  F +   L  +  KY + Y     G  LKL+   G+ 
Sbjct: 568 LDQRIYPKFISYLYWNCQLESKNDFEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVI 627

Query: 622 SLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQF 681
            L+L FKDGR L  D T EQY V+  F  D+D  +  L    +S  L M+  RV++ LQF
Sbjct: 628 ELDLEFKDGRVLQCDVTLEQYAVIQQF--DEDSYANRLMAETISLYLNMEISRVKSALQF 685

Query: 682 WINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVLNDPKE 741
           W+ K VL   + +Y  QE   +  + +  +    S    ++  +  + ++         +
Sbjct: 686 WVEKGVLYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNETIIEEETTL--------SK 737

Query: 742 ILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLI 801
            L+ ++P++  M TNLGSLK  KIHSFL ++VP+ + Y  VT +QLE+YL+ LVEEE+L 
Sbjct: 738 TLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLA 797

Query: 802 VLPDGSFK 809
               GS+K
Sbjct: 798 CTTSGSYK 805

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  431 bits (1107), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 287/851 (33%), Positives = 449/851 (52%), Gaps = 82/851 (9%)

Query: 1   MSLDADLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCIN 56
           M    DL  ++  ++E V  + HP     LESLL W++PN  +   Q KPPTL LK+ I 
Sbjct: 5   MRAGEDLKRLLVQIQE-VALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIK 63

Query: 57  LLRAGY-----SQDEK-----FKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIY 106
           +L   Y      +DE+     F   +R++Y+Y V+ HF  ++  +   KD + L   Y +
Sbjct: 64  MLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEF 123

Query: 107 PLQFMDLVDSTDISNLVK--SFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANI 164
           PL+++ + ++     + +     HYL++++   R N++++ KD  +       E +F   
Sbjct: 124 PLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVM-------EDDFDLA 176

Query: 165 VEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKN 224
           ++++ W+ +S   +S+ DL+LD  + KI  F ++QM G  N +F++METFN+FI  YW  
Sbjct: 177 MDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQ 236

Query: 225 LTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQN 284
              L+   ED+H+LT ++Y  FERQF+K+R +EI  I+V  YP +KPT+LEL+ +L K  
Sbjct: 237 FCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSK 296

Query: 285 SSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSG 344
             T               +++ +FL  F+R+ LNP I T++ L AYVK  K+FL LDP+G
Sbjct: 297 DFT---------------QIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTG 341

Query: 345 SLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKEL- 403
             LNS+  FVKPY +    ++V +LLYA+L L+S++       +   D  S+  LS+EL 
Sbjct: 342 RCLNSVSAFVKPYFQERN-DLVTVLLYAILELQSEEF--EGPARAYLDTNSLNQLSQELK 398

Query: 404 -------SNDHSKHAGDVDYKKFSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISE-SS 455
                  S+  +    D+  +  S   T    +  LPY+ V  +FL W P   P+   S 
Sbjct: 399 DPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPE--PMDTISK 456

Query: 456 NDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQ 515
           N  +  S  +N+  +D + +  ESKD  +SEFL LLT KLL +K Y ++ +W  CL++L+
Sbjct: 457 NYSKSLSASRNL--LDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLK 514

Query: 516 DKVTSDKNIVNDESIT----------------SDINTILIMLHDXXXXXXXXXXXXXXFQ 559
            K           +                  S+IN I +ML D                
Sbjct: 515 TKFGPAGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRMHQV-- 572

Query: 560 NSSEMQLFPKFISKLYWKFKRQSE-YQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGT 618
              + +++PKFIS LYW     S  + F LD ++  +L KY + Y    PG  L L    
Sbjct: 573 AGLDQRIYPKFISPLYWNRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQ 632

Query: 619 GICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAH 678
           GI  L L+F+DGRK   +AT EQ +V+  F +    ++  L+   +   L+MDP R RA 
Sbjct: 633 GIVVLTLSFQDGRKKRCEATLEQCSVIQQF-DASTATTTGLTEQMIGARLQMDPARARAA 691

Query: 679 LQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVLND 738
           LQ W+ + VL +  + Y  +EYL++Q   + P    SS    ++   P + S  T+    
Sbjct: 692 LQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRDSRLTS---- 747

Query: 739 PKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEE 798
              IL + +P+I  M TNLG+LKV KIHSFL ++ P+ L +S VT +QLE+YL  LVEEE
Sbjct: 748 ---ILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEE 804

Query: 799 QLIVLPDGSFK 809
           +LI   + ++K
Sbjct: 805 RLICTTNDTYK 815

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  400 bits (1027), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 278/887 (31%), Positives = 439/887 (49%), Gaps = 134/887 (15%)

Query: 6   DLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCI------ 55
           DL  I   L+      FH      L SLL+W+ P+  K   Q +PP+L +K+ I      
Sbjct: 10  DLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPN 69

Query: 56  -----------------NLLRAGYSQDE---KFKMWLREYYLYVVKFHFMKNVDEISVLK 95
                            +++  G +  E   +F    +EYY++ V++HF  +   I+ LK
Sbjct: 70  NACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLK 129

Query: 96  DFKLLEMIYIYPLQFMDLVD--STDISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGN 153
           D +  E  Y +PL+++ + D      +  + S +HYL+++N  F+ NL T+        N
Sbjct: 130 DIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRL-------N 182

Query: 154 QFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMET 213
           +   + +F     +I W+  + G LS+ DLI++A   KI +F    M G  N++F++MET
Sbjct: 183 KLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMET 242

Query: 214 FNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTI 273
           FNKFI+ YW   ++LIG  EDDH+LT  ++  FE  F++IR +EI  I V  YP +K T+
Sbjct: 243 FNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITL 302

Query: 274 LELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKA 333
           LELK I+      T                ++  FL  FK+  LNP I T+D L +YVK 
Sbjct: 303 LELKKIMKDFKDYT---------------NIVTTFLSDFKKHILNPSITTVDALLSYVKT 347

Query: 334 TKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDM 393
            K+FL+LDP+G  L+SI  FVKPY +  +  +V++LLYA+L+L  ++L E    K   DM
Sbjct: 348 IKAFLVLDPTGRCLHSITTFVKPYFQERK-HLVNVLLYAILDLPEEELKEKISFKV--DM 404

Query: 394 RSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEFENSTLP-------------------- 433
           +++ LL + L      H  D+D    +P+  ++ +  + P                    
Sbjct: 405 KALLLLVETL------HDSDIDQITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQS 458

Query: 434 --YEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLL 491
             YE +   +L W P   P      + + +S+  N+   + + +  ES++  ISEF  LL
Sbjct: 459 MLYEHILNYYLTWVPE--PNDMIPGNIKSSSIKTNL--FEVLLDLFESREFFISEFRNLL 514

Query: 492 TIKLLHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVNDESIT-------------SD 533
           T +L  +K Y+++++W +CLK++++K+     T+  N + +  I              S+
Sbjct: 515 TDRLFTLKFYKLDNKWSRCLKLIREKIVKSTETNQTNYIANGIIGLPQTTAPAADADLSN 574

Query: 534 INTILIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKF----KRQSEYQFPLD 589
           IN+I +ML D                   +  ++PKFIS LYWK        +E  F L 
Sbjct: 575 INSIDVMLWDIKCSEELCLKMHEV--AGLDPAIYPKFISLLYWKHNGDTNNANELTFHLP 632

Query: 590 SKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFH 649
             L  +L KY   Y    PG KL+L    G   + L F DGRKL +D + EQ +V++ F 
Sbjct: 633 GNLENELQKYSDIYSQLKPGRKLQLCKDQGKIEMELDFNDGRKLVLDVSLEQCSVINQF- 691

Query: 650 NDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSG 709
           N  D     LS+ QLS  L + P R+   L FWI + VL  +N  Y++ EY         
Sbjct: 692 NSTDGEPIYLSLEQLSEPLNIAPARLLDLLNFWIQRGVLSEENGVYSVIEY--------- 742

Query: 710 PTVITSSILPLSQERMPFKRSVPTNVLNDPKE-------ILHRVYPYINDMFTNLGSLKV 762
               + +    +Q   P K     N L D  E       IL R  P+I  M  NLG++K+
Sbjct: 743 ----SRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILERSLPFIEGMLANLGAMKL 798

Query: 763 DKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           +KIHSFL ++VP+   Y+++T+ QLE YL+ L +E +L  + +GS++
Sbjct: 799 NKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITNGSYE 845

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  398 bits (1022), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 266/826 (32%), Positives = 427/826 (51%), Gaps = 59/826 (7%)

Query: 1   MSLDADLPTIITSLREQVERQFHPQLE----SLLLWLDPNSSKGTRQNKPPTLELKDCIN 56
           M  +A++  +   LRE V   ++P LE     +L WL+PN      Q +PP+L LK+ I 
Sbjct: 1   MGSNAEIQELNAQLREFV-TTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIK 59

Query: 57  LLRAGYSQDEKFKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDS 116
           L+         F   LR++ L   + HF  N + I+  KD + LE  Y +PL+++++   
Sbjct: 60  LVVNNEDVPPGFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYINIFTP 119

Query: 117 TDISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEG 176
            +    +  F+HYL+ KN  F  N+  + +       Q   E +F    +I  W+ ++ G
Sbjct: 120 DEWFIEMNGFRHYLMSKNRIFGDNIKHRVR-------QLIMEDDFDMAWKIYTWLTETMG 172

Query: 177 VLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDH 236
                 L+L+  + KI  F+++ M+GK  Q+F+VMETFN FI  YW    Q +   EDDH
Sbjct: 173 -HQLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDDH 231

Query: 237 DLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRR 296
           ++T  I+  FE++F+KIR  EI  I V +YP +KP +LEL++++      +         
Sbjct: 232 EITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYS--------- 282

Query: 297 KDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKP 356
                 KL+ +FL  F+ + +NP + T ++L +Y++  KSFL +DP+G  L S+  ++KP
Sbjct: 283 ------KLMIEFLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKP 336

Query: 357 YLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKELSN-DHSKHAGDVD 415
           YLR     +V  LLYA+L L   ++ + N    + +M  +  LSKEL + D      D  
Sbjct: 337 YLRERRDTVVH-LLYAMLELDESEIDDANV---SLNMPILTELSKELKDPDFGIEDADSK 392

Query: 416 YKK---FSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDY 472
            +K      + +  F+      EQV   FL W P  + ++    ++ F     N + +D 
Sbjct: 393 SRKNKLMVTDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTFV----NKSLLDI 448

Query: 473 VFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITS 532
           + +  +SKD  ISEFL L T KLL +K Y++E +W K L++L+ K        +    TS
Sbjct: 449 LLDIFDSKDVFISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKFGHTSFPQHQFQDTS 508

Query: 533 DINTILIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKFKRQSEYQ-FPLDSK 591
           +IN I IML D                   + ++FPKFIS L+W    ++E   F L   
Sbjct: 509 NINNIDIMLRDVKTSYELISKMHEV--AGLDDRVFPKFISYLFWNSALEAETSDFQLPGW 566

Query: 592 LRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHND 651
           L  ++ KY + Y    PG +L L    G   L+L FKDGRK+S +    +  V+S F  D
Sbjct: 567 LETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVISCF--D 624

Query: 652 KDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDY--YTIQEYLNNQELSSG 709
           +D + + L++ Q+   +KM+   V + LQFW  K  + + + Y  Y + EY       S 
Sbjct: 625 QDTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYYEPNSALSA 684

Query: 710 PTVITS------SILPLSQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVD 763
            TVI+S       I P+  +     +     +     + + +++P+I  M TNLGS+K +
Sbjct: 685 STVISSKGNTNGGINPMDDQDNAGDKQQQEFI-----QSMSKIWPFIQGMLTNLGSMKPE 739

Query: 764 KIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           KIHSFL M+VP+ + Y+  TV QLE+YL+ LV+E++L  +P+GS+K
Sbjct: 740 KIHSFLKMAVPKDIGYT-ATVNQLESYLNVLVDEDKLAAVPNGSYK 784

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  395 bits (1014), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 281/886 (31%), Positives = 441/886 (49%), Gaps = 132/886 (14%)

Query: 6   DLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCINLL--- 58
           DL  I   L+      FH      L SLL+W+ PN  K   Q +PP+L +K+ I +L   
Sbjct: 10  DLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69

Query: 59  ------------------RAGYSQDEK-----FKMWLREYYLYVVKFHFMKNVDEISVLK 95
                              AG     K         L+EYY++ V++HF    ++I  LK
Sbjct: 70  NVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLK 129

Query: 96  DFKLLEMIYIYPLQFMDLVDST--DISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGN 153
           D +  E  Y +PL+++ + D +  D S  + S +HY++++N+ F+ NL  +        N
Sbjct: 130 DIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRL-------N 182

Query: 154 QFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMET 213
           +   + +F     +I W+  + G LS+ +LI++A   KIE F    M G  N++F++MET
Sbjct: 183 KLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMET 242

Query: 214 FNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTI 273
           FNKFI+ YW    +LI   EDDH+LT  ++  FE  F++IR  EI  I V  YP +K  +
Sbjct: 243 FNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVAL 302

Query: 274 LELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKA 333
           LELK I+      T                ++ +FL  FK+  LNP I T+D L  YVK 
Sbjct: 303 LELKKIMKDFKDYT---------------NIVTKFLSDFKKYILNPSITTVDALLRYVKT 347

Query: 334 TKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDM 393
            K+FL+LDP+G  L+SI+ FVKPY +  +  +V++LLYA+L+L  ++L     EK T+ +
Sbjct: 348 IKAFLVLDPTGRCLHSIITFVKPYFQERK-HLVNVLLYAMLDLPEEELK----EKITFKV 402

Query: 394 RSIELLS-------KELSNDHSKHAGDVDYKKFSP----------EGTNE--FENSTLPY 434
               LLS        ++  +   H    D  K SP          + TNE      T+ Y
Sbjct: 403 DMKALLSLVDILHDYDIGQNTDAHKSK-DKNKRSPFLWNLKVKGKKETNEDPLARQTMLY 461

Query: 435 EQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIK 494
           E V   +L W P    I   S    +  +  N+  I  + +  ES++  ISEF  LLT +
Sbjct: 462 EHVLNHYLTWVPEPNDIIPGSVKSSY--IKTNLFEI--LLDLFESREFFISEFRNLLTDR 517

Query: 495 LLHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVND-------------ESITSDINT 536
           L  +K Y+++D+W +CLK++++++     T+  N + +             ++  S++N+
Sbjct: 518 LSSLKFYKLDDKWSQCLKLIRERIVKFTETNHANYITNGILGLPETTAPAADADQSNLNS 577

Query: 537 ILIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKFKRQSEYQFPLDSKLR--- 593
           I +ML D                   +  +FPKFIS LYW  K   + Q P DSK R   
Sbjct: 578 IDVMLWDIKCSEELCRKMHEV--AGLDPTVFPKFISLLYW--KHNGDTQNPKDSKFRIPA 633

Query: 594 ---KKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHN 650
              ++L KY   Y    PG +L+L    G   + L+F+DGRKL +D + EQY+V++ F N
Sbjct: 634 DLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMELSFRDGRKLVLDVSLEQYSVMNQF-N 692

Query: 651 DKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGP 710
             +D    LS+ QLS  L +   ++   L FWI K VL  + + Y++ EY          
Sbjct: 693 STNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKGVLSEEGEVYSVIEY---------- 742

Query: 711 TVITSSILPLSQERMPFKRSVPTNVLNDPKEI-------LHRVYPYINDMFTNLGSLKVD 763
              + +    +Q+ +  K     N L D  E+       L R  P+I  M  NLG++K++
Sbjct: 743 ---SDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQRSLPFIEGMLANLGAMKLN 799

Query: 764 KIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           KIHSFL ++VP+   Y+++T+ QLE YL+ L +E +L  + +GS++
Sbjct: 800 KIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYE 845

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  391 bits (1005), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 274/881 (31%), Positives = 448/881 (50%), Gaps = 123/881 (13%)

Query: 6   DLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAG 61
           DL  I   L+      FH      L SLL W+ PN +K   Q +PP+L +K+ I +L   
Sbjct: 10  DLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPN 69

Query: 62  YSQDEKFKM--------------------------WLREYYLYVVKFHFMKNVDEISVLK 95
            +    + M                           L+E+Y++ V++HF  + + I+ LK
Sbjct: 70  NATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLK 129

Query: 96  DFKLLEMIYIYPLQFMDL--VDSTDISNLVKSFKHYLIDKNVTFRKNLITKFKDCFLVGN 153
           D +  E  Y +PL+++ +  V+  D +  + S +HYL+++N+ F+ NL T+  D  ++ +
Sbjct: 130 DIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRL-DKLIMDD 188

Query: 154 QFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMET 213
            F+          +I W++ + G LS+T+LI++A  +KI  F  + M    N++F++MET
Sbjct: 189 DFDLA------DNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMET 242

Query: 214 FNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTI 273
           FNKFI+ YW   ++L+G  EDDH+LT  ++  FE  F++IR  EI  I V  YP +K T+
Sbjct: 243 FNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTL 302

Query: 274 LELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKA 333
           LEL+ I+      T                ++  FL  FK+  LNP + T+D L  YVK 
Sbjct: 303 LELRKIMKDFKDYT---------------NIVTTFLSDFKKYILNPSVTTVDALLRYVKT 347

Query: 334 TKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTY-- 391
            K+FL+LDP+G  L+SI  FVKPY +  +  +V++LLYA+L+L  ++L     EK  +  
Sbjct: 348 IKAFLVLDPTGRCLHSITTFVKPYFQERK-HLVNVLLYAMLDLPEEELK----EKINFNV 402

Query: 392 DMRSIELLSKELSNDHSKHAGDV---DYKKFSP-------EGTNEFENSTLP------YE 435
           DM+++  L   L +       ++   D  K SP       +G  E  N  LP      YE
Sbjct: 403 DMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKREL-NKDLPIRHAMLYE 461

Query: 436 QVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKL 495
            +   ++ W P   P      + + + +  N+   + + +  ES++  ISEF  LLT +L
Sbjct: 462 HILNYYIAWVPE--PNDMIPGNIKSSYIKTNL--FEVLLDLFESREFFISEFRNLLTDRL 517

Query: 496 LHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVND-------------ESITSDINTI 537
             +K Y ++++W +CLK++++K+     TS  N + +             ++  S++N+I
Sbjct: 518 FTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSI 577

Query: 538 LIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKFKRQSE------YQFPLDSK 591
            +ML D                   +  +FPKFIS LYWK+   ++      +  P+D  
Sbjct: 578 DVMLWDIKCSEELCRKMHEV--AGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPID-- 633

Query: 592 LRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHND 651
           L ++L KY   Y    PG KL+L    G   + L FKDGRKL +D + EQ +V++ F + 
Sbjct: 634 LERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQF-DS 692

Query: 652 KDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLN---NQELSS 708
            +D    LS+ QLS  L + P R+   L FWI K VL  +N  Y++ E+     +Q   +
Sbjct: 693 PNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKT 752

Query: 709 GPTVITSSILPLSQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSF 768
            P  I +S   L  +    ++   T         L R  P+I  M TNLG++K+ KIHSF
Sbjct: 753 APMEIENSNYELHNDSEIERKYELT---------LQRSLPFIEGMLTNLGAMKLHKIHSF 803

Query: 769 LNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           L ++VP+   Y+++T+ QLE YL+ L +E +L  + +GS++
Sbjct: 804 LKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYE 844

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  387 bits (995), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 279/876 (31%), Positives = 445/876 (50%), Gaps = 116/876 (13%)

Query: 6   DLPTIITSLREQVERQFHP----QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAG 61
           DL  I   L+      FH      L SLL+W  PN  K   Q +PP+L +K+ I +L   
Sbjct: 10  DLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69

Query: 62  YSQDEKFKM--------------------------WLREYYLYVVKFHFMKNVDEISVLK 95
            +    + +                           L+EYY++ V++HF  + + I+ LK
Sbjct: 70  SASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLK 129

Query: 96  DFKLLEMIYIYPLQFMDLVDSTDISNL---VKSFKHYLIDKNVTFRKNLITKFKDCFLVG 152
           D +  E  Y +PL+++ + D  DI+     + S +HYL+++N+ F+ NL T+  D  ++ 
Sbjct: 130 DIQRWENYYEFPLRYVPIFD-LDINGWSLELNSLRHYLLNRNMKFKNNLRTRL-DKLIMD 187

Query: 153 NQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVME 212
           + F+          +I W+  ++G LS+ +LI++A   KI  F  + M G  N++F++ME
Sbjct: 188 DDFDLA------DNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIME 241

Query: 213 TFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPT 272
           TFNKFI+ YW   ++LIG  EDDH+LT  ++  FE  F++IR +EI  I V  YP +K T
Sbjct: 242 TFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVT 301

Query: 273 ILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVK 332
           +LELK I+                KD     ++  FL  FK+  LNP I T+D L  YVK
Sbjct: 302 LLELKKIMKD-------------FKD--YANIVTTFLSDFKKYILNPSITTVDALLRYVK 346

Query: 333 ATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTY- 391
             K+FL+LDP+G  L+SI  FVKPY +  +  +VD+LLYA+L+L  ++L E    K T+ 
Sbjct: 347 TIKAFLVLDPTGRCLHSITTFVKPYFQERK-HLVDLLLYAMLDLPEEELKE----KITFK 401

Query: 392 -DMRSIELLSKELSNDHSKHAGDV---DYKKFSP-------EGTN--EFENSTLPYEQVY 438
            D++++  L   L +       +V   +  K  P       +G N     + T+ Y+ + 
Sbjct: 402 VDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHIL 461

Query: 439 TDFLNWKPS---ITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKL 495
             +L W P    + P S  S     + +  N+   + + +  ES++  ISEF  LLT +L
Sbjct: 462 NYYLTWVPEPNDMIPGSVKS-----SCIKTNL--FEVLLDLFESREFFISEFRNLLTDRL 514

Query: 496 LHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVND-------------ESITSDINTI 537
             +K Y+++D+W +CLK++++KV     TS  N + +             ++  S++N+I
Sbjct: 515 FTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSI 574

Query: 538 LIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKF----KRQSEYQFPLDSKLR 593
            +ML D                   +  +FPKFIS LYWK+    +  +E  F L   L+
Sbjct: 575 DVMLWDIKCSEELCRKMHEV--AGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLK 632

Query: 594 KKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKD 653
           K+L KY   Y    PG KL+L    G   + L FKDGRKL +D + EQ +V++ F +  D
Sbjct: 633 KELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQF-DSTD 691

Query: 654 DSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVI 713
           + S  L++ QLS  L + P R+   L FWI K V+  +N  Y++ E   N E        
Sbjct: 692 NKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIE---NCETDFDKV-- 746

Query: 714 TSSILPLSQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSV 773
               +P+  E         +      +  L R  P+I  M  NLG++K++KIHSFL ++V
Sbjct: 747 -HKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITV 805

Query: 774 PRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           P+   Y++V++ QLE YL  L +E +L  + +GS++
Sbjct: 806 PKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYE 841

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  357 bits (917), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 246/821 (29%), Positives = 404/821 (49%), Gaps = 75/821 (9%)

Query: 6   DLPTIITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQD 65
           +L   + SL   V+      LE +L W++PN      Q +PP+L +K  I  L  G    
Sbjct: 9   ELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKSLLNGVVTS 68

Query: 66  EKFKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKS 125
           E F   L +Y ++  + HF  N   +   KD + LE  Y +P +++++  S +  + +  
Sbjct: 69  ESFIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNIFSSEEWCDEMSG 128

Query: 126 FKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLIL 185
            ++YLI +N   + N+  + +       Q   E +F    +I  W+  +EG L   ++++
Sbjct: 129 LRNYLIRQNSGLKNNIQLRLE-------QLVHEDDFDMACKIYEWLCQAEGRL-LPEILV 180

Query: 186 DASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQF 245
           D  L+K+++FA + M     Q+F +ME +N F+  YW    +++  +EDDH++TN IY+ 
Sbjct: 181 DVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEITNEIYRC 240

Query: 246 FERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLL 305
           FE +FI+IR  ++  I V  +P TKPT+LEL+S+L      T               +L+
Sbjct: 241 FEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYT---------------ELI 285

Query: 306 KQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEM 365
            +FL  F+ + LNP I T ++L +YV+A KS L++D S      +  FV+PYL     + 
Sbjct: 286 TEFLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERH-DT 344

Query: 366 VDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYKKFSPEGTN 425
           V   LYA+L L + DL   N   T+  M     LS EL   H   +     +   P G +
Sbjct: 345 VATFLYAMLGLDASDLSSKNS--TSTHMSIASQLSAELRGSHQPISSSTAERGNLPHGKH 402

Query: 426 EFENSTLPYEQVYTD----FLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKD 481
               S  PYE  Y      +L+W P      +++ND   A + K +   D +    +SKD
Sbjct: 403 AL--SMNPYEPAYQQIIDYYLHWNPEPADSIQANNDQ--ALISKEL--FDIIVELFDSKD 456

Query: 482 KLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIML 541
            ++ EFL L T KLL ++GY++E  W + LK+++ K+  D    +     S+IN I +ML
Sbjct: 457 VIVREFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKL--DFKTYSSAQEFSNINNIDVML 514

Query: 542 HDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKFKRQSEYQ-----FPLDSKLRKKL 596
            D                 S   ++ PKF+S L+W     S++       PL  +L   +
Sbjct: 515 RDVKHSEELCSLMHEKLGLSD--RIIPKFVSYLFW--NAHSDFSALPKDHPLPKELEADI 570

Query: 597 SKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSS 656
           + Y K+Y +   G KL+L     I  L L   DGR L+ + T ++  VLS   ++ D   
Sbjct: 571 NNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYLSSNGDG-- 628

Query: 657 QVLSINQLSTMLKMDPERVRAHLQFWINKKVLCH--QNDYYTIQEYLN------NQELSS 708
              ++ ++     +D  +V   L+FW+   +L +  +   Y+++E  N       +  SS
Sbjct: 629 ---TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKHAVERQSS 685

Query: 709 GPTVITSSILPLSQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSF 768
              V  +  + L Q++                + + +V P+I  M TNLGSLK DKIHSF
Sbjct: 686 SEIVNATDSVDLQQQQFI--------------DSMQKVLPFIKGMLTNLGSLKADKIHSF 731

Query: 769 LNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           L M+VP+ + YS  T +QL+ YL+ LVEE +L+  P+G+F+
Sbjct: 732 LKMAVPKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFR 771

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  342 bits (877), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 245/804 (30%), Positives = 402/804 (50%), Gaps = 81/804 (10%)

Query: 29  LLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHFMKNV 88
           LL WLDP + K   Q KPP L +K  I  L  G S D +    +++YY +  + +F    
Sbjct: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLG-SNDYQLLSNIQDYYCWQCRVYFYNEY 90

Query: 89  DEISVLKDFKLLEMIYIYPLQFMDLVDSTD-ISNLVKSFKHYLIDKNVTFRKNLITKFKD 147
             I  L + K +E   ++PL+++ + +  + + N V+ F +YL+  N       + + ++
Sbjct: 91  KRIETLNELKRIERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRN 150

Query: 148 CFLVGNQFEFEYEFAN-IVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQ 206
             L     E ++E A  IV+   + Q       +T ++LD  L KIE F +     K N+
Sbjct: 151 RML-----EDDFELATEIVDYFDYCQ-----TDSTSIVLDIILDKIEQFCQLHYTRKWNK 200

Query: 207 KFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDY 266
           ++++METFN+FI  YW  L+ L+   ED+H +TN +Y++FE+QFI IR  EI  I + + 
Sbjct: 201 RYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNP 260

Query: 267 PQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDV 326
              +PT+LEL+  +S  N                   ++ + L  F  + +NP I T D 
Sbjct: 261 ASVQPTLLELRKEISTVNDFNC---------------VVVELLSKFNLKVINPSIVTADA 305

Query: 327 LNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNC 386
           L  Y++  K+F +LDPSG  L +I  +VKP+ R  + ++V +LL+++L L   D  +LN 
Sbjct: 306 LFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRK-DLVHLLLFSMLGLDETD--QLNT 362

Query: 387 EKTTYDMRSIELLSKELSN----DHSKHAGDVDYKKFSPE-GTNEFENSTLPYEQVYTDF 441
             +      +  L+ EL +     +++ + DV      P  G+   E  ++  EQV   +
Sbjct: 363 MPSQVSEEKLTALTNELKDTEICSYTEESDDV----VDPMIGSFSKEEDSMVLEQVIKRY 418

Query: 442 LNWKPSITPISESSNDDEFASLGKNITP------IDYVFNALESKDKLISEFLKLLTIKL 495
           + W P +             S GK I         D +   LESK+ L+ EF  LLT KL
Sbjct: 419 MEWIPEVP-----------TSFGKGILSDHKLDLFDILLELLESKETLVIEFKNLLTKKL 467

Query: 496 LHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHDXXXXXXXXXXXX 555
           L ++GY ++ +W K L +L+ +  +      DE   ++INTI IML D            
Sbjct: 468 LDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIYKSRQIATDMQ 527

Query: 556 XXFQNSSEMQLFPKFISKLYWKFKRQSEYQ---FPLDSKLRKKLSKYMKSYHHSHPGMKL 612
               N++ ++++PK +S LYW     ++ +   F +D +L   L  Y + Y     G KL
Sbjct: 528 LDLHNTN-VKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKL 586

Query: 613 KLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDS---SQVLSINQLSTMLK 669
           +L    G  SLNL+F DGR +   A+  QY+VL+ F + K DS   ++ L+I++L     
Sbjct: 587 ELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSG 646

Query: 670 MDPERVRAHLQFWINKKVLCHQNDYYTIQEYL---NNQELSSGPTVITSSILPLSQERMP 726
           M  +++   L++W++K VL   +  Y   E+L    +   ++ P V+  S++  S +   
Sbjct: 647 MQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQH-- 704

Query: 727 FKRSVPTNVLNDPKE-ILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVT 785
                      D +E  + R  PYI D+  NLG+LK+DK+H+ L  ++P+  HYS V   
Sbjct: 705 ----------EDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQK 754

Query: 786 QLEAYLDQLVEEEQLIVLPDGSFK 809
           QL+ YLD LVEE  L    + S+K
Sbjct: 755 QLQDYLDTLVEEGVLSSASNDSYK 778

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  339 bits (869), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 248/793 (31%), Positives = 390/793 (49%), Gaps = 60/793 (7%)

Query: 26  LESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHFM 85
           LES+L W++PN      Q +PP+L LK  I +L             LR+Y ++  + HF 
Sbjct: 29  LESVLTWINPNEPTSNHQLRPPSLRLKSAIKILINENGNGPALTDILRQYLIFQTRKHFF 88

Query: 86  KNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKNLITKF 145
            +   +   KD + LE  Y +PL+F+ L +  + +  +   ++YLI KN+ F +N   + 
Sbjct: 89  AHYYSLCHFKDVQKLERYYEFPLRFVRLFNREEWAEEINGLRNYLISKNLVFNRNARLRL 148

Query: 146 KDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLN 205
           +       Q   E +F    ++  W+  +EG L  T L++DA L+K++ FA + M    +
Sbjct: 149 R-------QLVLEDDFEMACKLYEWLCRAEGRL-LTHLLVDAVLSKVKAFALKHMEEAWS 200

Query: 206 QKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQD 265
           ++F+ +E +N FI  YW  L+Q++   EDDHD+TN IY+ FE +FI+IR ++   I V  
Sbjct: 201 KRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIYRCFEEEFIRIRTQQAFKIFVTG 260

Query: 266 YPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTID 325
           YP+++PT+LEL+S+L      T               +L+ + L  F+   LNP I T +
Sbjct: 261 YPESEPTLLELRSVLKTPAKYT---------------QLVTELLSQFEARMLNPSITTAE 305

Query: 326 VLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELN 385
           +L +YVKA KS L +D S      +  FV+P+L     + V   LYA+L L   D  E  
Sbjct: 306 ILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERR-DTVVTFLYAMLGL---DASETR 361

Query: 386 CEKTTYDMRSI-ELLSKELSNDHSK-HAGDVDYKKFSPEGTNEFENSTLP-YEQVYTDFL 442
             K T    SI   LS EL + H       +D    SP       N   P Y+QV   +L
Sbjct: 362 GPKPTGAHASIASQLSAELKDSHQPIFRSALDKSAQSPVDDMASVNPKEPVYQQVINFYL 421

Query: 443 NWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYE 502
           +W P  +   +++N D   + G      D +    +SKD +I EFL L T KLL +KGY 
Sbjct: 422 HWTPEPSDSIQANNSDTLMNKGL----FDIIVELFDSKDIIIGEFLTLFTDKLLDLKGYR 477

Query: 503 VEDRWQKCLKILQDKVTSDKNIVNDESITSDINTILIMLHDXXXXXXXXXXXXXXFQNSS 562
           +E  W K LKIL+++    KN  N + + S+IN I +ML D               + S 
Sbjct: 478 LEQNWVKSLKILKNRFDF-KNYSNAQGV-SNINNIDVMLRDVKHSEELCAQMHSVPEISR 535

Query: 563 EMQLFPKFISKLYWKFKRQSEYQFPLD----SKLRKKLSKYMKSYHHSHPGMKLKLVNGT 618
           E  + P FIS L+W    +     P D    S+L  ++ KY   Y    PG KL+L    
Sbjct: 536 E--VIPMFISYLFWNAGSKFS-TLPKDCRLPSQLESEIRKYKDMYAQIKPGRKLRLHQEQ 592

Query: 619 GICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAH 678
               L L F D R +  + + ++ +VL+         +  +S +++     ++  +V  +
Sbjct: 593 STVVLQLHFADKRVMDFEVSMDKSSVLACVAE-----TTGISRDKIVEATGLEKAQVDQN 647

Query: 679 LQFWINKKVLC--HQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVL 736
           L+FW++  VL    +   Y+  E  +    S     + +      Q R  F       V 
Sbjct: 648 LRFWLDASVLRFDSKTSLYSSLERQDTDNASEREAQMRAE----DQARSAFDSQQQQFV- 702

Query: 737 NDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVE 796
               E + +V+P+I  M TNLG+LKV+KIHSFL ++VP+ + ++  T  QLEAYL  LV+
Sbjct: 703 ----ESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFN-ATTAQLEAYLRLLVD 757

Query: 797 EEQLIVLPDGSFK 809
           E +L+   + +FK
Sbjct: 758 ENKLVCSANNAFK 770

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  327 bits (838), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 233/734 (31%), Positives = 365/734 (49%), Gaps = 92/734 (12%)

Query: 25  QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGY--------SQDEKFKMWLREYY 76
           +LE+LL+WLDPN         PPTL+LK  I  +            S     + WL+ +Y
Sbjct: 32  ELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYKDPSNSIKNNIQNWLKLFY 91

Query: 77  LYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVT 136
           +Y V+ +F K +D I   KD   LE  Y +PLQF+ L    +    + S +HY++ +N  
Sbjct: 92  VYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFTFQEWCFELLSLRHYILHQNKE 151

Query: 137 FRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFA 196
           F + +I + +       Q   E +F   ++I+ WI++ +  L + + ILD  L KI ++ 
Sbjct: 152 FTQKIILELR-------QLIKEEDFETSLDIVTWIREVDSNLLSENFILDILLEKITLYC 204

Query: 197 REQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIE 256
            + M G   ++++VMET+N F+  YW N TQL+   ED+H +TN+++++FE+QFIKIRI+
Sbjct: 205 EQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQFIKIRIQ 264

Query: 257 EILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREF 316
           EI  I +  YP TKPT+LEL+++L   N               + +KL+  FL  F+R  
Sbjct: 265 EIFKICILSYPDTKPTLLELRNLLVTYN---------------FFQKLVVNFLSAFERIV 309

Query: 317 LNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNL 376
           L P I TID L AY++  KSF +LDPSG  L SI  ++ P+ R  ++ +  ILL+A+L L
Sbjct: 310 LTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERKM-LAPILLHAILAL 368

Query: 377 KSKDL-----------------------IELNCEKTTYDMRSI----ELLSKELSNDHSK 409
              DL                        EL  E T+    SI    E+LS +  N+H+ 
Sbjct: 369 PKIDLENAIYPIKVSSISLKLIINELEDPELGIENTSTKKNSIKKFNEILSPKRFNNHNS 428

Query: 410 HAGDVDYKKFSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITP 469
                D  +     ++E  NSTL  ++V   FL W P   P   ++ND +      N+  
Sbjct: 429 SEYLPDLLQ---NTSSEDSNSTLLVQKVVKQFLTWVP--IPNDIATNDTKKLYSSTNL-- 481

Query: 470 IDYVFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDK------- 522
           +D + N  ESK+ L++EF KLL+ +LL  K Y++E +W  CL++L+ + +S         
Sbjct: 482 LDILLNIFESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTN 541

Query: 523 -----NIVNDESITSDINTILIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYW- 576
                N+VN E++   I  + +ML D                N    +++PKFIS  YW 
Sbjct: 542 LADTDNLVNGENL--KITNMNVMLSDLNYSSELCKIFHH--ANGVNTRVYPKFISSHYWV 597

Query: 577 --------KFKRQSEYQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFK 628
                       +    F +   L     +Y K Y   + G K+ +    G+  + L+F+
Sbjct: 598 DLDDENVSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFE 657

Query: 629 DGRKLSVDATFEQYTVLSAFH--NDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKK 686
           DGR L +DAT  QY +L      N    ++Q  ++N+LS  L +  + V   + FW+ K 
Sbjct: 658 DGRVLEIDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFWLKKN 717

Query: 687 VLCHQNDYYTIQEY 700
           VL   +D Y+I EY
Sbjct: 718 VLKKVDDKYSILEY 731

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  317 bits (812), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 247/846 (29%), Positives = 411/846 (48%), Gaps = 96/846 (11%)

Query: 26  LESLLLWLDPNSSKGTRQNKPPTLELKDCINLLR------AGYSQDEKFKMWLREYYLYV 79
           ++SLL WL+PN  K   Q KPPT+ LK  I  +         Y   E     LR YY++ 
Sbjct: 28  IDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIETLNSLLRYYYIFQ 87

Query: 80  VKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDI--SNLVKSFKHYLIDKNVTF 137
           V+ +F  N+  I+  KD   LE  Y +P+  + +  + +      +   +HYL+  N+TF
Sbjct: 88  VRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLLRTNLTF 147

Query: 138 RKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSE-GVLSATDLILDASLTKIEIFA 196
           R NLI + K   LV    E +++ A   EII W  ++   +LS+  +IL+A L KI ++A
Sbjct: 148 RSNLINRLKK--LVK---EDDFDLAQ--EIIKWSNEANFSLLSSKQIILNALLDKITMYA 200

Query: 197 REQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIE 256
            +Q     +Q+FI+MET+NKFI+ YW N   L+   EDDH++T ++Y++FE+QF++IR E
Sbjct: 201 DKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSE 260

Query: 257 EILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREF 316
           EI  I V  YP +KPTI+EL+ +L++   ST                +L + L  F+ + 
Sbjct: 261 EIFDICVISYPDSKPTIMELRGLLTQSKIST---------------NILIRLLSEFQLKV 305

Query: 317 LNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNL 376
           LN  IPT  +L AY+K  KS L+LDP+   L S   F  PYL+  + +++ ILL+A+L+L
Sbjct: 306 LNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQ-KSDIIYILLFAILDL 364

Query: 377 KSKDLIELNCEKTTYDMRSIELLSKELSNDH---SKHAGDVDYK----------KFSPEG 423
           ++ D+      K   D   ++LLS+EL   H   + +  DVD              S   
Sbjct: 365 RTDDIKTNPIVKV--DQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLD 422

Query: 424 TNEFENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKL 483
               E+S L Y Q+    L W P    +S + +      + +    +D +F   +  +  
Sbjct: 423 YAGQESSQLLYSQILNRALTWLPESKLVSPNKS----IKMMRKKNLLDILFAIFDDHELF 478

Query: 484 ISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDK-----NIVNDESITSD----- 533
           +  F++LL  KL  +KGY +E+ W +CL++ + K + +         N E++T +     
Sbjct: 479 LKRFVELLKQKLFVIKGYNLEESWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMY 538

Query: 534 INTILIMLHDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYWKF-----KRQSEYQF-- 586
           +  I +ML D               +  + + L  K IS LYW++     KR++ Y    
Sbjct: 539 MTNIDVMLWDMRGSKKLTEQMHLIDELDNRINL--KIISSLYWQYDMKNEKRKTYYGLLN 596

Query: 587 PLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLS 646
            +D  L  +L KY K Y    PG  L L+       ++  F+D R ++ + TFE Y  + 
Sbjct: 597 KMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSIC 656

Query: 647 AFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQEL 706
            F  ++  SS  L   +LS +     E ++  L+FW+++K+L      Y   EYL+  E+
Sbjct: 657 PFLENEGTSSYTLE--ELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEI 714

Query: 707 -------SSGPTVITSSILPL----------------SQERMPFKRSVPTNVLNDPKEIL 743
                  ++  +V++ +  PL                SQE +           N   + +
Sbjct: 715 IIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEV 774

Query: 744 HRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVL 803
            ++  Y+  + TNLG   ++K+++ L  +        KV+   LE  + +LVE  Q++ L
Sbjct: 775 SKIKEYVLSILTNLGEQNIEKLYNVL-QTTSHDTAIKKVSSVTLENIVTELVENGQILCL 833

Query: 804 PDGSFK 809
           P+G ++
Sbjct: 834 PNGLYQ 839

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  314 bits (805), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 260/869 (29%), Positives = 399/869 (45%), Gaps = 151/869 (17%)

Query: 21  QFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVV 80
           +F   L+ LLLWL P       Q KPP+L +K  I  +R  +     F   L + Y+ ++
Sbjct: 15  KFAEDLDRLLLWLSP----AEHQCKPPSLRIKKSIQRIRECFQLSSDFTNCLVKLYIDLI 70

Query: 81  KFHFMKNVDE-ISVLK--DFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTF 137
           +F F+  + E  + LK  D   LE    +P  F+  ++     NL    +HYL+D + +F
Sbjct: 71  RFEFISYMKENANCLKFNDVLKLENRIEHPRLFIPELEFEYFKNL-HMLRHYLLDSDKSF 129

Query: 138 RKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGV-LSATDLILDASLTKIEIFA 196
           +  L T  ++  +       E +F +   I+ WI  +  + LS  DL+LD  + KI    
Sbjct: 130 KTALCTSIENLIM-------EDDFYSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGIC 182

Query: 197 REQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIE 256
              + G   ++FIV+ETFN FI++YW +  QL+   E+DH+LT  +++ FER+FI IRI 
Sbjct: 183 SGSIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKCFEREFINIRIN 242

Query: 257 EILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREF 316
           EI  I    YP++KPTILEL+ ++         A K  +R       L   FL TFK E 
Sbjct: 243 EIFEIFTSAYPESKPTILELRKVMK--------APKDLQR-------LTYTFLDTFKDEM 287

Query: 317 LNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNL 376
           LNPC+ TID L +Y+KA K FLLLDP+G  LN +  FVKPY + ++ ++++ILLYA+L+L
Sbjct: 288 LNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYFQ-DKSDLINILLYAILDL 346

Query: 377 KSKDLIELNCE------KTTYDMRSIELLSKELSNDHSKHAGDVDYKKFSPE----GTNE 426
           K KD  +LN        K + DMR     S E     +    D +YK+  P     G N 
Sbjct: 347 KPKDFEDLNISYIPGLNKLSLDMREDPEFSIE-----NVEPNDNNYKRTVPNLESIGANS 401

Query: 427 FEN-STLPYEQVYTDFLNW--KPSITPIS---------ESSNDDEFA--SLGKNITPIDY 472
             +  TL  + +   F+ W  +P++  +          E  N+D  A  S+  N+  +D 
Sbjct: 402 LHDKGTLIQDHIMKQFMMWVPEPNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDI 461

Query: 473 VFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITS 532
           + +  ESK+  I +F+ LLTIK   ++ Y V+  WQKCL+++  K  S  NI  DE +  
Sbjct: 462 LLDLFESKEIFIGKFVNLLTIKFFKLQNYRVDPNWQKCLELINSKFNS-SNISMDEKMEE 520

Query: 533 DI--------------------------------NTILIMLHDXXXXXXXXXXXXXXFQN 560
           D+                                N I +ML+D              FQ 
Sbjct: 521 DVAIGTVNPTNENYVDEKRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFS------FQI 574

Query: 561 SSEMQLF----------PKFISKLYWKFKRQS--------EYQFPLDSKLRKKLSKYMKS 602
           SSE+  +          PKFIS LYW ++           E  F  D +  K + +Y   
Sbjct: 575 SSELNRYGLRSNNVGIKPKFISPLYWDYEDNELGVNNFLKENVF--DEECTKAILQYASE 632

Query: 603 YHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSIN 662
           Y   + G  L    G  +  + ++F DG          QY VL+ F    D  ++ L+I 
Sbjct: 633 YCSINKGFALHYCKGKEMIEVEISFNDGAIKGFLVNASQYYVLTLF----DTGNEKLTIE 688

Query: 663 QLSTM--LKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPL 720
            + T    K     +   L+FW+ K VL ++  YY  ++ L++ E S G T   +  L  
Sbjct: 689 SILTAGEAKRSKNEIIDALKFWVEKNVLVYEGGYYYSRD-LHSIENSKGNTTTRTDDL-- 745

Query: 721 SQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYS 780
                                ++    PYI  M  + G+L   +I +FL  ++P     S
Sbjct: 746 ---------------------LVKEALPYIKTMLESFGNLSASRIQNFLKATLPAA-QDS 783

Query: 781 KVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
              +T + + LD LV +  L     GS+K
Sbjct: 784 DHIITDIHSVLDTLVSDGILFKNSSGSYK 812

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  270 bits (690), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 204/703 (29%), Positives = 346/703 (49%), Gaps = 59/703 (8%)

Query: 10  IITSLREQVERQFHPQLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFK 69
           +I++L E  E      LE+LL W++PN      Q + P+L +K+ I LL+   ++     
Sbjct: 14  LISALPENDE-ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAEQVFLL 72

Query: 70  MWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHY 129
             LR++ L  +++HF  N + +   KD   LE  Y +PL+++ L  + ++SN +   + Y
Sbjct: 73  QLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLFTAEELSNELIGLRKY 132

Query: 130 LIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASL 189
           L+++N TFR N+ ++ +   L  + FE         ++  W+    G       ++D   
Sbjct: 133 LLNRNSTFRNNMESRIRVLILEEDDFEMS------SKLYKWMVQGLG-HPMVKFVIDLLT 185

Query: 190 TKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKNLTQLIG-NIEDDHDLTNLIYQFFER 248
            KIE+F + +M G ++QK ++ E FN FID  W    QL+    EDD +L NLIY+ FE 
Sbjct: 186 NKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQELNNLIYRCFEN 245

Query: 249 QFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQF 308
           +FI+++ +E+   ++  +P +KP++LE+KS++        GA +   R       L+ Q 
Sbjct: 246 KFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIK-------GATEELDR-------LVAQI 291

Query: 309 LVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDI 368
              F  E L P + TI++L  YVKA K  +++DP+G  +N     +KP ++    +++  
Sbjct: 292 CNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERS-DLITT 350

Query: 369 LLYALLNLKSKDLIELNCEKT-TYDMRSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEF 427
           +L A+L L   ++ E+  + T T + + ++ LSKEL N  + +   V   K      +  
Sbjct: 351 VLCAILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIKSKAAIYSVA 410

Query: 428 ENSTLPYEQVYTDFLNWKPSITP----ISESSNDD-----EFASLGKNITPIDYVFNALE 478
           +    P   +   FL W P   P    IS+  N+D     E   L K++  ++ VF   +
Sbjct: 411 QERQNP---LVKQFLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDV--LEVVFQVFD 465

Query: 479 SKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDK-VTSDKNIVNDESITSDINTI 537
           S + LI+EF+KL+T  +L M+GY +  +W + LK L  K   ++K ++      S++  +
Sbjct: 466 SPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSICEESNLVNV 525

Query: 538 LIMLHDXXXXXXXXXXXXXXFQN-SSEMQL-----FPKFISKLYWKFKRQSEY-QFPLDS 590
            +M  D              FQN S+++QL     +PK IS LYWK  R+S Y  + + S
Sbjct: 526 FVMWSD--------LEKSASFQNWSTKLQLIPSNVYPKIISYLYWKISRKSLYGDYRISS 577

Query: 591 KLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHN 650
            L     +  K++    PG KL+  N  G   + LTF DGR  S   +  +YTV+  F  
Sbjct: 578 ALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWSNKVSLPKYTVIELFQK 637

Query: 651 DKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQND 693
                 + L    +     M    V A +Q+W  + VL    D
Sbjct: 638 ----VPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGD 676

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  269 bits (687), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 194/719 (26%), Positives = 340/719 (47%), Gaps = 64/719 (8%)

Query: 25  QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHF 84
           ++E++L W+DPN      Q +PP+L +K+ I LLR G          LR+  +  ++ HF
Sbjct: 28  EIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLLRLGEQAPGTTVGLLRQCAVSQMRQHF 87

Query: 85  MKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKNLITK 144
            ++ + +    D   LE  Y +PL+++ +    +++  +   + YL++ N  FR N+  +
Sbjct: 88  FRHWERLEQYTDMVKLERYYEFPLRYVAVFTEDEVAAELVGLRKYLLNGNPGFRANMEAR 147

Query: 145 FKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKL 204
            +   L  + FE          +  WI    G       +++    KI +F R +M G +
Sbjct: 148 IRALILQDDDFE------TAARLYKWIVQGLG-HPMVKFVIEVLTQKIALFCRNRMDGNV 200

Query: 205 NQKFIVMETFNKFIDIYWKNLTQLIG-NIEDDHDLTNLIYQFFERQFIKIRIEEILTIMV 263
           +Q++++ME FN FI   W    QL+     DD +L NLIY+ FE++FI+++ +E+   ++
Sbjct: 201 DQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPELNNLIYRCFEKKFIELKTQELFHQII 260

Query: 264 QDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPT 323
             +P +KP +LE+KS++    +                 +L+ Q    F +E L P + T
Sbjct: 261 PKFPMSKPALLEMKSVIKGDTAEL--------------DRLVAQIYNDFHKELLVPSVTT 306

Query: 324 IDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIE 383
           +++L  YVK  K  +++DP+G  +N     +KP ++    +++  +L A+L L S ++ E
Sbjct: 307 VEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERS-DLIISVLCAILELDSDEIHE 365

Query: 384 LNCEKT-TYDMRSIELLSKELSND-----HSKHAGDVDYKKFSPEGTNEFENSTLPYEQV 437
           +  + T T + + +  LSKEL N      HS          +S      FE      +Q+
Sbjct: 366 VISKNTLTENPQLLSQLSKELKNSTALTFHSMSTSKGKAAIYSV----AFERQ----DQL 417

Query: 438 YTDFLNWKPSITPISE------SSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLL 491
              FL W P   P +       +S+DD   +L      ++ VF   +S + LI+EF++L+
Sbjct: 418 VKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEVVFQVFDSPEVLINEFIQLV 477

Query: 492 TIKLLHMKGYEVEDRWQKCLKILQDK-VTSDKNIVNDESITSDINTILIMLHDXXXXXXX 550
           T  +L M GY +  +W + LK +  K   ++K ++      S++  + +M  D       
Sbjct: 478 TNHMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSMCEESNLVNVFVMWSD------- 530

Query: 551 XXXXXXXFQN-SSEMQL-----FPKFISKLYWKFKRQSEY-QFPLDSKLRKKLSKYMKSY 603
                  FQ  S+++QL     +PK IS LYWK  R+S Y  + +   L     +  K++
Sbjct: 531 -LEKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGRRSPYGDYAVAPGLAAIFDQMEKAF 589

Query: 604 HHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQ 663
               PG KL+     G   L L F+DGR  S   +  +YTV+  F       +  LS+  
Sbjct: 590 ETRSPGRKLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVIDLFQR----QACPLSVTD 645

Query: 664 LSTMLKMDPERVRAHLQFWINKKVL-CHQNDYYTIQEYLNNQELSSGPTVITSSILPLS 721
           ++    M P  V   +QFW ++ VL  ++ND Y I E  N+   S        +  P+S
Sbjct: 646 IAAHTNMSPRLVEDIIQFWCHEHVLHLNKNDLYEILENHNSAIASRQSQASVPAFHPVS 704

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  256 bits (653), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 189/517 (36%), Positives = 278/517 (53%), Gaps = 37/517 (7%)

Query: 317 LNPCIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNL 376
           +NP I T+D L AYVK  KSFL LDPSG  L+SI  FV PYL+    ++V +LLYA+L+L
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERN-DLVSVLLYAILDL 59

Query: 377 KSKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAG----DVDYKKFSPEGTNEFENSTL 432
           +S++  E    +   D  S+ +LS EL +      G    D+D  + + + +N+  +S+L
Sbjct: 60  QSENFQE--EAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSNKSGDSSL 117

Query: 433 PYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLT 492
            Y QV T  LNW P  + I   S   +   L KN+  +D +    E+ +  I+EFLKLLT
Sbjct: 118 LYRQVITQMLNWVPESSKID--SKRQKMIGLRKNL--LDILLEIFENNEVFIAEFLKLLT 173

Query: 493 IKLLHMKGYEVEDRWQKCLKILQDKVTSDKNIVNDESITSDI-----------NTILIML 541
            KLL +K Y+++ RW KCLK+L++K     N     SI+++I           N I +ML
Sbjct: 174 KKLLKLKYYKLDSRWSKCLKLLKEKFKG--NSAGTTSISTNIGNVTGSDLVYINNIDVML 231

Query: 542 HDXXXXXXXXXXXXXXFQNSSEMQLFPKFISKLYW------KFKRQSEYQFPLDSKLRKK 595
            D                    +Q  PKFIS LYW      K K  +  Q  +D  L  +
Sbjct: 232 WDLKTSGDLTSRMHQIEGLDRRIQ--PKFISSLYWDQAKESKSKGNNAKQTQIDPLLSTQ 289

Query: 596 LSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDS 655
           L KY++ Y    PG  L L+   G   L  TF+DGR +S DAT EQ  +++ F     ++
Sbjct: 290 LEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYFSEAVSEN 349

Query: 656 SQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITS 715
              LS+ QL  +  ++   ++  LQFW+++KVL      Y I EYL+  E+       T 
Sbjct: 350 G--LSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEIIVQSLTHTG 407

Query: 716 SILPLSQERMPFKRSVPTNV---LNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMS 772
            +L   Q+  P   S  T+    +N   E L+ V+PYI  M TNLGSLK++KIHSFL  +
Sbjct: 408 EVLKEEQKLNPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRAT 467

Query: 773 VPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809
           VP+ ++Y+ +TV+ LE YL+ LVE++ L +L  GS++
Sbjct: 468 VPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYR 504

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  258 bits (658), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 233/846 (27%), Positives = 388/846 (45%), Gaps = 137/846 (16%)

Query: 26  LESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQ-DEKFKMWLREYYLYVVKFHF 84
           LE ++ W+ P +        PP+L +K  I  +    S+ D +FK+    YY+ V+K  +
Sbjct: 25  LERVMGWIHPQA----HACHPPSLRMKKAIRSVLGKASELDRQFKI----YYIDVIKQEY 76

Query: 85  MKNVDEISV-LKDFKLLEMIYIYP---LQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKN 140
           +   D++    K  ++LE   +YP   L F+ + D   I   + S +HYL+D +   R +
Sbjct: 77  L--CDQVKREFKHIQVLESKLVYPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRNS 134

Query: 141 LITKFKDCFLVGNQFEFEYEFANIVEIIHWIQDSEG-VLSATDLILDASLTKIEIFAREQ 199
           L+ +F +  +  + FE  Y+      II W+  +   +L   +L LD  ++KI      +
Sbjct: 135 LVAEF-ETLMQDDDFESGYQ------IIEWLYTANAKLLRPWNLALDTIVSKISTLCDNE 187

Query: 200 MIGKLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEIL 259
           M      KF+VM TFNKFI++YW +L + +   ED+HD T ++Y+ FE++F++IR EEI 
Sbjct: 188 MRRNWEAKFLVMNTFNKFINLYWSHLAKFLHLSEDNHDFTKVLYKCFEKEFVRIRTEEIF 247

Query: 260 TIMVQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNP 319
            I+V+ Y   K TILEL++ +S                 E   KL+ QFL  FK + LNP
Sbjct: 248 EIVVESYQAAKTTILELRTFMSGY---------------ERLSKLVNQFLKQFKIKVLNP 292

Query: 320 CIPTIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSK 379
            + T++ L A++++ K F++LDP    +++I  FVKP+      + V I+LYA+L+L+  
Sbjct: 293 SVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRG-DAVQIILYAILDLRDV 351

Query: 380 DLIELNCEKTTYDMRSIELLSKELSND----------------------HSKHAGDVDYK 417
           D  ++        ++ +  LS EL  D                      H   +  +D  
Sbjct: 352 DFEKMGVSP----VKGLSELSHELREDPYVNINAKCQTPTPSPSKISSPHLNDSSSMDVD 407

Query: 418 KFSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISESSND-----DEFASLGKNITPIDY 472
               +GT +     L Y+QV   F       T  ++ + D      +F+        +D 
Sbjct: 408 DKLDDGTTD-----LVYKQVLNQFXXRGHHET--NQGTRDYVGVNVKFSQRSNRTNLLDP 460

Query: 473 VFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQDKV-------------- 518
           +F   + KD+L+S FLKLLT+KL  + GY +E  W +C ++++ KV              
Sbjct: 461 LFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKGDVGDGGPLSRD 520

Query: 519 TSDKNI-VNDESITSDINTILIMLHDXXXXXXXXXXXXXXFQNSSEM--QLFPKFISKLY 575
           T+D  +  N+E +   +N I +MLHD                 +S +   +FPKFIS  Y
Sbjct: 521 TADAPVSSNNEQVLLSLNKIDVMLHD----LRENAKITRRLHRTSMLNGNVFPKFISSQY 576

Query: 576 WKF------KRQSEYQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKD 629
           W +      K  +  Q  +D  L   + +Y   +     G  ++L     I  + LT  D
Sbjct: 577 WSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELTVND 636

Query: 630 G---RKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKK 686
           G   +   VDA   +Y+V+  +      +    +  +L  +  MD   V+  L +W+N  
Sbjct: 637 GEVPQVFKVDAM--KYSVIEKYATGGPRAG--YTPTELCELCGMDIADVQTSLTYWVNAG 692

Query: 687 VLCHQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVLNDPKEILHR- 745
           +L               +  SSG    TS   P      P + S         +E L   
Sbjct: 693 LL---------------RLSSSGYYESTSETGPPPNRGTPLEAST--------REFLDGV 729

Query: 746 VYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSK-VTVTQLEAYLDQLVEEEQLI-VL 803
           V+ +I  M  +LG+L   +IH +L  +VP  + Y + VT+ QL+ YLD  V+   L+   
Sbjct: 730 VWTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTHLLQQT 789

Query: 804 PDGSFK 809
           P+G +K
Sbjct: 790 PEGEYK 795

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  221 bits (562), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 188/712 (26%), Positives = 337/712 (47%), Gaps = 79/712 (11%)

Query: 25  QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAGYSQDEKFKMWLREYYLYVVKFHF 84
           +++ +L WL+P     T Q + PTL +K C+ ++      DE+ +  + +YYL +++ HF
Sbjct: 26  EVDMVLAWLNP-----TFQPQIPTLRIKQCLKVVLE--QSDERTRFLIEQYYLTLIRTHF 78

Query: 85  MKNVDEISVLKDFKLLEMIYIYPLQFMDLVDSTDISNLVKSFKHYLIDKNVTFRKNLITK 144
               D+I   KD   LE +YI  ++FM       I   + SFK  L+ KN  FRK L  K
Sbjct: 79  FLQFDDIVNWKDMIKLEKLYISKVEFMFGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAK 138

Query: 145 FKDCFLVGNQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLT--KIEIFAREQMIG 202
            +   L  +   F+       ++  W+  +       ++  +  +   K++  +++ M  
Sbjct: 139 LESHILDNDLVRFD-------QMYQWLAPA---FDGQEIEFNVRIINLKVDQMSQKLMKN 188

Query: 203 KLNQKFIVMETFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIM 262
           K++ +++VM T+N FI  +W   ++L+  IEDDH+LT +IYQ FE+ +IK + +E  T +
Sbjct: 189 KIDDRYLVMNTYNHFIKDFWSKFSKLLI-IEDDHELTAIIYQSFEKNYIKYKCDEFYTDI 247

Query: 263 VQDYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIP 322
           V  +P ++  +LEL+SIL+K +  T G             K+L+     F   FL   + 
Sbjct: 248 VPKFPASRKCLLELRSILNK-DIKTVGT------------KVLETLYHGFVSRFLTSSLL 294

Query: 323 TIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLI 382
           T ++L  Y+K  K   ++DP G  L S+   V+ YL     +++  LL  +   ++ +  
Sbjct: 295 TCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRP-DIIKTLLLGIFPFQNNERF 353

Query: 383 ELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYKKFSPEGTNEFENSTLPY------EQ 436
           ++    ++ D  S+ L   E     S+  GD       P     F    LP       +Q
Sbjct: 354 KI---ASSTDGSSVHL---EKLEQFSREVGDFSMGPELPTALPWFNQPHLPRCTYDGDDQ 407

Query: 437 VYTDFLNWKPSITPISESSNDDEFA-SLGKNITPIDYV---FNALESKDKLISEFLKLLT 492
           +   +LNW P   P     + ++FA + GK + P+D +    + LESK  L+ + L +++
Sbjct: 408 LLKQYLNWVPE--PPRIKLDVEDFADNDGKYVPPVDLIHVLLDVLESKRTLVDDLLGVVS 465

Query: 493 IKLLHMKGYEVEDRWQKCLKILQDKV--TSDKNIVNDESITSDINTILIMLHDXXXXXXX 550
            K +  + Y ++  WQ+ + I+ + +  T    + ++E+  + +N + IML D       
Sbjct: 466 GKFIESEEYSLDPEWQRIMDIILNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQF 525

Query: 551 XXXXXXXFQNSSEMQLFP--KFISKLYWKF-----KRQSEYQFPLDSKLRKKLSKYMKSY 603
                   +N+S  + FP  K +SKLYW+       R    ++  DS++   + K  K Y
Sbjct: 526 RNQVAH--KNNSHFENFPHIKILSKLYWRHYQNLNGRLVTTKYKWDSEMEPLIQKLTKVY 583

Query: 604 HHSHPGMKLKLVNGTGI-CSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKD--------- 653
              + G  LK   G+    S+N+  K G +     T EQY V+S F N+ +         
Sbjct: 584 ERLNTGRTLKFDTGSSSRVSINIVTKSGERRFFKVTMEQYLVISHFQNETNGRNAPGMMA 643

Query: 654 DSSQVL-----SINQLSTMLKMDPERVRAHLQFWINKKVLC-HQNDYYTIQE 699
           D + V+     ++  L  M  M  +++   L FW  K+++  H +D Y++QE
Sbjct: 644 DCNYVIPERRYTLKDLHKMTSMPRQKILDILSFWQQKEIVTKHSDDSYSVQE 695

>CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highly
           similar to uniprot|P18759 Saccharomyces cerevisiae
           YBR080c SEC18
          Length = 758

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 13/163 (7%)

Query: 207 KFIVMETFNKFIDIYWKNLTQL-IGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQ- 264
           ++++ME    + D+  +NL  + +G+I+    +++            I ++ ILT   Q 
Sbjct: 156 QYMIMEFKGHYFDLKIRNLQAIDLGDIDSSAPVSS-----------GIEVKGILTKQTQI 204

Query: 265 DYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTI 324
           ++ + +  ++ LKS  S +  S A  R   + +D     L K+F   F+R F +   P  
Sbjct: 205 NFFKGRDGLVNLKSPNSLRPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPA 264

Query: 325 DVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVD 367
            +    +   K  LL  P G+    I   +   L + E ++V+
Sbjct: 265 VIEKLGISHVKGLLLYGPPGTGKTLIARKIGMMLNAKEPKIVN 307

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 610 MKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSI 661
           + + LV+ T +  L+L+  DG K  +D +      +  FHND DD  Q L +
Sbjct: 150 VNMALVSSTPLSPLSLSLFDGSKDELDDSIAGSQRIGGFHNDDDDLVQSLDL 201

>NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304
          Length = 758

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 13/163 (7%)

Query: 207 KFIVMETFNKFIDIYWKNLTQL-IGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQ- 264
           ++++M+    F D+  +N+  + +G++E  + ++             I ++ ILT   Q 
Sbjct: 156 QYLIMDFKGFFFDLKVRNVQAIDLGDVEPSNSVST-----------GIEVKGILTNKTQI 204

Query: 265 DYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTI 324
           ++ + +  ++ LKS  S +  S A  R   + +D     L K+F   F+R F +   P  
Sbjct: 205 NFFKGRDGLVNLKSSNSLRPRSDAVIRSDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPA 264

Query: 325 DVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVD 367
            +    +   K  LL  P G+    I   +   L + E ++V+
Sbjct: 265 VIEKLGISHVKGLLLFGPPGTGKTLIARKIGTMLNAREPKIVN 307

>CAGL0G09999g Chr7 (956817..958799) [1983 bp, 660 aa] {ON} similar
           to uniprot|Q06628 Saccharomyces cerevisiae YPR185w APG13
           protein required for the autophagic process
          Length = 660

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 4/74 (5%)

Query: 701 LNNQELSSGPTVITSSILPLSQERMPFKR----SVPTNVLNDPKEILHRVYPYINDMFTN 756
           +N  ++S+ P  I S    L++ R PF++    S PT +       +HR     +D  + 
Sbjct: 568 INKHKMSTSPRSIDSISNSLTRNRTPFRQPYQYSQPTTIATQAYAKMHRPTVRSSDAISE 627

Query: 757 LGSLKVDKIHSFLN 770
           + S K D  H  +N
Sbjct: 628 INSRKGDNFHQLIN 641

>Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON}
           YBR080C (REAL)
          Length = 758

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 13/163 (7%)

Query: 207 KFIVMETFNKFIDIYWKNLTQL-IGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQ- 264
           ++++ME    F D+  +N+  + +G+IE    +              I  + ILT   Q 
Sbjct: 156 QYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVAT-----------GIETKGILTKQTQI 204

Query: 265 DYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTI 324
           ++ + +  ++ LKS  S +  S A  R   + +D     L K+F   F+R F +   P  
Sbjct: 205 NFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPS 264

Query: 325 DVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVD 367
            +    +   K  LL  P G+    I   +   L + E ++V+
Sbjct: 265 VIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNAKEPKIVN 307

>Suva_5.225 Chr5 complement(342111..346271) [4161 bp, 1386 aa] {ON}
            YER105C (REAL)
          Length = 1386

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 3/101 (2%)

Query: 440  DFLNWKPSITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMK 499
            D L    + T I+E    +  + L   + P+ Y+FN  +  D L    + L   K   ++
Sbjct: 1164 DILTLVENETRINEDHKKELISKLNGKVLPLSYLFN--DCADPLGYHEINLRIFKASGLR 1221

Query: 500  GYEVEDR-WQKCLKILQDKVTSDKNIVNDESITSDINTILI 539
               V  R W +   +++ KV  D+   + ESI S I++ LI
Sbjct: 1222 DESVIRREWDRLFDVIKMKVLPDRKCGDPESIISTISSALI 1262

>YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}
           SEC18ATPase required for vesicular transport between ER
           and Golgi, the 'priming' step in homotypic vacuole
           fusion, autophagy, and protein secretion; releases
           Sec17p from SNAP complexes; has similarity to mammalian
           NSF
          Length = 758

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 13/163 (7%)

Query: 207 KFIVMETFNKFIDIYWKNLTQL-IGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQ- 264
           ++++ME    F D+  +N+  + +G+IE    +              I  + ILT   Q 
Sbjct: 156 QYLIMEFQGHFFDLKIRNVQAIDLGDIEPTSAVAT-----------GIETKGILTKQTQI 204

Query: 265 DYPQTKPTILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTI 324
           ++ + +  ++ LKS  S +  S A  R   + +D     L K+F   F+R F +   P  
Sbjct: 205 NFFKGRDGLVNLKSSNSLRPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPS 264

Query: 325 DVLNAYVKATKSFLLLDPSGSLLNSIVIFVKPYLRSNEVEMVD 367
            +    +   K  LL  P G+    I   +   L + E ++V+
Sbjct: 265 VIEKLGISHVKGLLLYGPPGTGKTLIARKIGTMLNAKEPKIVN 307

>Kpol_534.33 s534 complement(77829..81164) [3336 bp, 1111 aa] {ON}
            complement(77829..81164) [3336 nt, 1112 aa]
          Length = 1111

 Score = 32.3 bits (72), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 427  FENSTLPYEQVYTDFLNWKPSITPISESSNDDEFASLGKNITP--IDYV-FNALESKDKL 483
            F ++TLP  +V  D    +P+I PI E  + D   SL ++I+P   D   F+   S D L
Sbjct: 968  FSSNTLPKTKVIEDGTGEQPTIVPIDEQEHIDNQLSLTRSISPKQTDGTDFSPSLSHDSL 1027

Query: 484  ISEFLKLL 491
            I +  KL+
Sbjct: 1028 IQDMNKLV 1035

>Skud_14.228 Chr14 (420251..424666) [4416 bp, 1471 aa] {ON} YNL102W
            (REAL)
          Length = 1471

 Score = 32.0 bits (71), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 8/51 (15%)

Query: 722  QERMPFKRSVPTNVLN------DPKEILHRVYPYINDMFTNL--GSLKVDK 764
            +E  P  R V  +VLN      DP+E L  VY Y+ D+ T +   S+++DK
Sbjct: 1079 REFCPLSRDVSVHVLNTILSDKDPEEALQEVYDYLEDIRTKVEANSIRIDK 1129

>NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6.341
          Length = 1683

 Score = 32.0 bits (71), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 8/75 (10%)

Query: 323  TIDVLNAYVKATKSFLLLDPSGSLLNSIVIFVKP----YLRSN----EVEMVDILLYALL 374
            T  VLN Y K   +F  + P+  LLNSI +F +     +LR+N    E + V ILL   L
Sbjct: 1151 TYSVLNNYSKVVTTFKRVCPANELLNSIFLFARDFGRNFLRTNVANFEKKSVIILLMIRL 1210

Query: 375  NLKSKDLIELNCEKT 389
            ++     +  +C  T
Sbjct: 1211 SVGWLSFLVEDCNPT 1225

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
           (REAL)
          Length = 1208

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 23/42 (54%)

Query: 211 METFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIK 252
           ME+F +F  ++WKN  QL+  ++   D  + I  +  R F +
Sbjct: 791 MESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNFTQ 832

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,776,193
Number of extensions: 4227987
Number of successful extensions: 15530
Number of sequences better than 10.0: 81
Number of HSP's gapped: 15933
Number of HSP's successfully gapped: 84
Length of query: 811
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 693
Effective length of database: 39,950,811
Effective search space: 27685912023
Effective search space used: 27685912023
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)