Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C032708.322ON1841849691e-135
NDAI0G025908.322ON2862155754e-74
TDEL0F044808.322ON2601855334e-68
Suva_10.2218.322ON1781814917e-63
YLR128W (DCN1)8.322ON2691814997e-63
Skud_12.1978.322ON1791814673e-59
KNAG0G024408.322ON2651824632e-57
KAFR0H022708.322ON2681854535e-56
CAGL0M04257g8.322ON2731834511e-55
ZYRO0F10362g8.322ON2511844361e-53
Kpol_1036.688.322ON2561844222e-51
TPHA0C008208.322ON2661844083e-49
SAKL0H15576g8.322ON2821833869e-46
Kwal_56.239148.322ON2651793711e-43
Ecym_42538.322ON2581813641e-42
AGL194C8.322ON2561843622e-42
KLLA0D16346g8.322ON3011873462e-39
KLTH0G12320g8.322ON2541723325e-38
TBLA0A039308.322ON2661843311e-37
Smik_12.1918.322ON1251263086e-36
Skud_8.1315.351ON73147682.2
KLTH0G14608g8.223ON82561682.3
YHR072W (ERG7)5.351ON73150672.5
Kwal_27.114442.307ON75721655.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03270
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   377   e-135
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   226   4e-74
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   209   4e-68
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   193   7e-63
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   196   7e-63
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   184   3e-59
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   182   2e-57
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   179   5e-56
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   178   1e-55
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   172   1e-53
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   167   2e-51
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   161   3e-49
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   153   9e-46
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   147   1e-43
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   144   1e-42
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   144   2e-42
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   137   2e-39
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   132   5e-38
TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   132   1e-37
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...   123   6e-36
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...    31   2.2  
KLTH0G14608g Chr7 complement(1285757..1288234) [2478 bp, 825 aa]...    31   2.3  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...    30   2.5  
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    30   5.7  

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  377 bits (969), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL
Sbjct: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
           VDLNDKLHSDKQYFIDIYNYTFGLITDPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL
Sbjct: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
           LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD
Sbjct: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180

Query: 181 TNHI 184
           TNHI
Sbjct: 181 TNHI 184

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  226 bits (575), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 145/215 (67%), Gaps = 32/215 (14%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           +DGL+NY++DL  +LEDLVTICL  LLHC+N+KD I + QFL NW+LQGCS + QM+ VL
Sbjct: 73  VDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNWYLQGCSTLEQMQHVL 132

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITD-------------------------------PD 89
            DL+ KLH D  YF  IYNYTF LI D                                D
Sbjct: 133 NDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTTNSNDTSIVIVPRMKD 192

Query: 90  KDLEVETAVAYWKLFLQPKEGEFPVRVDPTLLNLWFQFLDEENKKFITQDYWHMLVVFFQ 149
            +L+VETA+AYWK+F    E ++PV+V+  LL+LWFQFL+EE KK IT+D W ML+ FF+
Sbjct: 193 NNLDVETAIAYWKVFFNVNE-QYPVKVNKELLSLWFQFLNEERKKEITKDQWQMLLEFFK 251

Query: 150 KFPNLNVIKEGYDETAAWPYIIDEYYEYLQDTNHI 184
           KF NL ++K+ YDETAAWPY+IDE+YEYLQDT  I
Sbjct: 252 KFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  209 bits (533), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 4/185 (2%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           +DG++  + DL   LEDLVTICL  LLHC  + D I++DQFL NW++QGCS + QM+ VL
Sbjct: 79  IDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGISKDQFLHNWYMQGCSTLPQMRHVL 138

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPDK-DLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
            DL+ KLH+D +Y  DIYNYTF L  D +K DL+ +TA  YW+LF QP      V V+P 
Sbjct: 139 DDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTDTAAEYWRLFFQPGTA---VHVNPA 195

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           LLN W  FLD E K  +T+D W ML+ FF++FP+L+ +K  Y+E  AWPYIIDEYYEYL+
Sbjct: 196 LLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAVKTSYNEADAWPYIIDEYYEYLE 255

Query: 180 DTNHI 184
           D+  I
Sbjct: 256 DSRLI 260

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  193 bits (491), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 90/181 (49%), Positives = 129/181 (71%), Gaps = 4/181 (2%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           MD L+ ++ DLG +LEDL T+CL HLL  K +++ + R+ FL  WF+QGCS +  MK+ +
Sbjct: 1   MDSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCV 60

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
             L+ KLH D QYF +IY+YTF LI D + KD++ E A+ YW L  QP   E+P+ ++P 
Sbjct: 61  KGLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQP---EYPIHMEPG 117

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           LL  WF+FL +E K+ IT+D WHML+ FF+++P +  I + YDE AAWP+IIDE+YE+L+
Sbjct: 118 LLEAWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLR 177

Query: 180 D 180
           D
Sbjct: 178 D 178

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  196 bits (499), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 129/181 (71%), Gaps = 4/181 (2%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           +D L+ ++ +LG +LEDL T+CL HLL  K +++ + R+ FL  WF+QGCS I+ M++ +
Sbjct: 90  IDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECI 149

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
             L+ KLH D QYF  IYNY F LI DP+ KD++ +  + YWKLF QP   E+PVR++P 
Sbjct: 150 KTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQP---EYPVRMEPD 206

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           LL  WF+FL +E K  I++D W ML++FF+++P +  I   YDETAAWP+IIDE+YE LQ
Sbjct: 207 LLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQ 266

Query: 180 D 180
           D
Sbjct: 267 D 267

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  184 bits (467), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 125/181 (69%), Gaps = 4/181 (2%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           MD L+ ++ DLG  LEDL T+CL  LL  KN+++ + R+ FL  WF+QGCS +  M+  +
Sbjct: 1   MDSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCI 60

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
             L+ KLH D QY+  +Y+Y F LI D + K+++++ A+ YW LF QP    +PV ++  
Sbjct: 61  KRLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQPV---YPVHIESN 117

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           LL  WF FL +E K  I++D WHML++FFQ++  +  I +GYDETAAWP+IIDE+YEYLQ
Sbjct: 118 LLESWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQ 177

Query: 180 D 180
           D
Sbjct: 178 D 178

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  182 bits (463), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 128/182 (70%), Gaps = 3/182 (1%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           +G++ Y+ DL L ++DLVTICL  LL  +N+   ITR+QFL  WFLQGCS I +MK VL 
Sbjct: 81  EGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITREQFLAQWFLQGCSTINEMKTVLA 140

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPDKD-LEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
           DLN KL  D+ YF +IY YTF L+ +PD++ L+  + + YWKLF   +E ++P+ +D  L
Sbjct: 141 DLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAASTIEYWKLFFD-QEKKYPMIIDQEL 199

Query: 121 LNLWFQFLDEENKKF-ITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           L+ WF +L E+++   +T+D W M+  FF +F +L  +K+GYDE AAWP +IDE+ EYLQ
Sbjct: 200 LDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDVKQGYDEMAAWPILIDEFIEYLQ 259

Query: 180 DT 181
           DT
Sbjct: 260 DT 261

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  179 bits (453), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 125/185 (67%), Gaps = 4/185 (2%)

Query: 3   GLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLVD 62
           G++  + D GL +EDL TICL H+LH +N++D I RD FL   F QGC  +  +K VL D
Sbjct: 85  GMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDFLQYLFEQGCCTVNDIKVVLKD 144

Query: 63  LNDKLHSDKQYFIDIYNYTFGLITDPD---KDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
           LN+KL++D  YF  IYN++FGLI D D   + ++++ A+ YWKLF    E    V +   
Sbjct: 145 LNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAIEYWKLFF-LNESIQSVEISNE 203

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           LL+LWFQFL +E KK +++D W M++ FF+KF +L  +KE YDE   WP++IDE+YEYLQ
Sbjct: 204 LLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKESYDENDPWPFVIDEFYEYLQ 263

Query: 180 DTNHI 184
           DT  +
Sbjct: 264 DTGKL 268

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  178 bits (451), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 87/183 (47%), Positives = 122/183 (66%), Gaps = 2/183 (1%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           DGL++Y+ DLG +LEDLVTI L H L CKN+++ IT  QFL  W+ +GC  + QM+  L 
Sbjct: 89  DGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLE 148

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPDKDLEVETAVAYWKLFLQPKEGEFP--VRVDPT 119
           D   KL +D +YF  IYNY+F L       +E + A+ YWKLF +    +    ++VD  
Sbjct: 149 DCERKLCNDWKYFTTIYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQA 208

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
            L+LW +FL +E+KK I +D W ML++FF+KFP+L+ IK  Y+E  AWPY IDE+YEYL+
Sbjct: 209 HLDLWCKFLQDEHKKLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLE 268

Query: 180 DTN 182
           + N
Sbjct: 269 ERN 271

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  172 bits (436), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 114/184 (61%), Gaps = 5/184 (2%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           DGL+ Y+ DLG ++++L TICL  LLHC+ + D IT  QF  NW   GC+ + QM +++ 
Sbjct: 72  DGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQFSYNWQQNGCTSLHQMGKLVQ 131

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
            L+ KL +D+ Y   IYNYTF L  DP  K LE  TAV YW LF     G++PV V+   
Sbjct: 132 RLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQYWTLFF--ATGQYPVIVEQQF 189

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
             LW  F+ +E    I++D W ML  FF +F NL  +++ Y+E  AWPYIIDE+YEYL D
Sbjct: 190 FQLWISFVQQEQS--ISRDTWRMLFPFFNRFSNLQSVRDNYNEADAWPYIIDEFYEYLAD 247

Query: 181 TNHI 184
              I
Sbjct: 248 KGEI 251

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  167 bits (422), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 120/184 (65%), Gaps = 4/184 (2%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           DG +  ++DL   LED+VTICL  L+HCK++   IT+DQFL  W+ QGCS +  MK +L 
Sbjct: 76  DGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLSTWYEQGCSQLKHMKILLD 135

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
           DL+ KL +D +Y+  IY Y+F LI D  +K +E + A+ YWKLF   K    P+ ++   
Sbjct: 136 DLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKLFFSSK---CPITINELQ 192

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
           LN W +F++    + IT+D W  L+ +F+K+P L ++ + Y+E   WPYI+DEYYE+L+D
Sbjct: 193 LNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELDPWPYIMDEYYEFLED 252

Query: 181 TNHI 184
           T  I
Sbjct: 253 TKRI 256

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  161 bits (408), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 119/184 (64%), Gaps = 4/184 (2%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           DGL+ ++ DLG +LEDL T+CL +++ C N+ D ITR+QFL  W+ + CS+I  +K  L 
Sbjct: 85  DGLIQFIEDLGYELEDLTTLCLANVMGCNNLTDCITRNQFLEAWYNKKCSNIKDIKDELE 144

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPD-KDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
            + + L SD  YF  IYNY+FGLIT+ + K ++++TA  YWKLF        P+ ++   
Sbjct: 145 TVGENLRSDINYFTYIYNYSFGLITEENMKSIQIDTAKEYWKLFFGDGT---PLHIEKEQ 201

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
           L+ W +FL    KK IT+D W M++ FF+KFP +   K+ YD    WPYI+DEY+EYL++
Sbjct: 202 LDNWNKFLTISGKKTITKDEWKMILEFFKKFPTVTEFKDEYDPMDPWPYIMDEYHEYLEE 261

Query: 181 TNHI 184
              +
Sbjct: 262 NGKL 265

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  153 bits (386), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 76/183 (41%), Positives = 109/183 (59%), Gaps = 4/183 (2%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           ++ LM Y+ DLG  LEDL TICL  LL C+ I  DIT  QFL +W   GC ++  MK  L
Sbjct: 98  VENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDITEQQFLSSWTEHGCKNMIHMKHEL 157

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLIT-DPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
            DL ++LH D+ YF  IYNYT+ LI  + ++ L ++TA  YW+LF       + V +  +
Sbjct: 158 QDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDTAAEYWELFFH--NSHYAVTISDS 215

Query: 120 LLNLWFQFLDEEN-KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYL 178
            L  W +F  +++ +  +T+D W M + F  KFP+   +  GYDE  AWP + DEYYEY+
Sbjct: 216 RLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESLIRGYDEMDAWPLVFDEYYEYM 275

Query: 179 QDT 181
            + 
Sbjct: 276 DEA 278

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  147 bits (371), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/179 (41%), Positives = 109/179 (60%), Gaps = 3/179 (1%)

Query: 1   MDGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVL 60
           M GL  ++ DLGL+LED VT+CL  L+ C ++++DI+ D F+ +W  + C +   MK  +
Sbjct: 83  MIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDISMDTFIQSWHDRLCENFNDMKLHV 142

Query: 61  VDLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPT 119
            +L  KL +D  YF  IYNYTF L  +P  K L +ET++AYW+L   P +  + ++V   
Sbjct: 143 KELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLETSIAYWELLFSPAKP-YAIKVPQE 201

Query: 120 LLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYL 178
            L  W Q+L  E  K + +D W M + F   FP+   +K+GY E  AWP +IDEYYEYL
Sbjct: 202 RLQSWIQYLSGEVAK-VHRDVWKMFLKFAVAFPDNEALKKGYSEDDAWPLVIDEYYEYL 259

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  144 bits (364), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 4/181 (2%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           D L+ Y++DLG  LED VTICL  LL  +N+  DI  +QFL  W   GCS++  M + + 
Sbjct: 78  DTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFLSTWADLGCSNLNDMSEYMN 137

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITD-PDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
            L+ KLH D  YF  IY+YTF +  D   + L ++TA++YW L     +  F  ++  T 
Sbjct: 138 TLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYWTLLFL--DHSFATKIPRTR 195

Query: 121 LNLWFQFLDEEN-KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQ 179
           L  WF+FL E+N   F+T+D W ML  F  KFP+   +   Y E  AWP I+DEYY +++
Sbjct: 196 LESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYSEMGAWPLIMDEYYGWIK 255

Query: 180 D 180
           +
Sbjct: 256 E 256

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  144 bits (362), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 4/184 (2%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           + L+ Y+ DLG  LED+ T+CL  LL  + +  DI+R QFL  W   GCS +  M+  + 
Sbjct: 76  EALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFLSTWHGLGCSSLPDMRAAVD 135

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
            L  +L +D  YF  +Y YTFGL  D   + L VETA+AYW LF    +  + V V    
Sbjct: 136 ALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYWSLFFL--DHTYAVTVPAPR 193

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
           L  WF+FL   +   +++D W M   F Q+FP+   + E Y+E A+WP +IDEYYE+++ 
Sbjct: 194 LRSWFEFLRAGDHS-VSRDTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWVKG 252

Query: 181 TNHI 184
            N +
Sbjct: 253 RNQL 256

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  137 bits (346), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/187 (35%), Positives = 115/187 (61%), Gaps = 7/187 (3%)

Query: 3   GLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLVD 62
           GL+ ++ DLG+ +ED +T+CL+ +L   ++   ++R+QFL  W    C  + +MK  L  
Sbjct: 117 GLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSREQFLNAWSDLCCDTLRKMKAYLHT 176

Query: 63  LNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTLL 121
           L ++L +DK YF  IY+YTF L TD   + L  + A+ YW +F   K+ ++ +++    L
Sbjct: 177 LEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAIEYWNIFF--KDNKYALKISKERL 234

Query: 122 NLWFQFLDEEN----KKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEY 177
           N W +F++ ++    K+ I+ D W M   F +++PN   +K+ YDE AAWP +IDEYYE+
Sbjct: 235 NSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDESLKQNYDEMAAWPLLIDEYYEF 294

Query: 178 LQDTNHI 184
           L++ + +
Sbjct: 295 LEENDKL 301

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  132 bits (332), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 104/172 (60%), Gaps = 3/172 (1%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           DGL+ ++ DLGLDLED  T+C+   +HC ++   ++++ F+  W    C ++ Q+K+ + 
Sbjct: 73  DGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEMFVQGWHDNLCENLQQIKEKVK 132

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
           +L++KL  D  YF  IY++T+ L  +P +K L++ETA+AYW L   P +G + +++    
Sbjct: 133 ELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIAYWHLLF-PTDGAYAIQIPQKR 191

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIID 172
           L  W  FL   N   I  D W M + F + FP+   +K+GY+E  AWP +ID
Sbjct: 192 LCSWTAFL-TRNVSRIHHDIWKMFLKFARMFPDNKTLKQGYNEDDAWPVLID 242

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 108/184 (58%), Gaps = 3/184 (1%)

Query: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61
           +GL+  + DLG  ++ LVT+CL  L+ C +    I    F+ +     C  +  +K +L 
Sbjct: 85  EGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSLKANKCRSLEDIKNLLN 144

Query: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPDKD-LEVETAVAYWKLFLQPKEGEFPVRVDPTL 120
           + ++KL ++ +Y+  IY+  F L+ +  K  ++ ETA  YW LF   +   +P++V    
Sbjct: 145 EFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQN--YPIKVQSDQ 202

Query: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180
              WF++L   N K IT+D W ML+ FF+KFP+L+ ++  Y E +AWPYI DEYYEYL+D
Sbjct: 203 YQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLED 262

Query: 181 TNHI 184
            N I
Sbjct: 263 NNKI 266

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score =  123 bits (308), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 56  MKQVLVDLNDKLHSDKQYFIDIYNYTFGLITDP-DKDLEVETAVAYWKLFLQPKEGEFPV 114
           M++ +  L+ KL  + QYF  IYNYTF L+ D   KD+++   + YWKLF +P   E+PV
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRP---EYPV 57

Query: 115 RVDPTLLNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEY 174
            ++  LL  WF+FL +E K  I +D W ML+VFF+K+  +  I + YDE+AAWP+IIDE+
Sbjct: 58  SIEQNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEF 117

Query: 175 YEYLQD 180
           YEYLQD
Sbjct: 118 YEYLQD 123

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 30.8 bits (68), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 130 EENKKFITQDYWHMLVVFFQKFPNLNVIKEGY-------DETAAWPY 169
           +  K  + Q  W ++ +FF ++PN  VI  G        +E+  W +
Sbjct: 646 DSGKSLVVQSAWALIALFFAEYPNKEVIDRGIELLKNRQEESGEWKF 692

>KLTH0G14608g Chr7 complement(1285757..1288234) [2478 bp, 825 aa]
           {ON} similar to uniprot|P38966 Saccharomyces cerevisiae
           YDR089W Hypothetical ORF
          Length = 825

 Score = 30.8 bits (68), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 26/61 (42%)

Query: 65  DKLHSDKQYFIDIYNYTFGLITDPDKDLEVETAVAYWKLFLQPKEGEFPVRVDPTLLNLW 124
           D+ H     F++I     G  T   KD + E      +  L+ K   FP+R D TL  L 
Sbjct: 468 DRKHKVPYAFVEIRRLPSGPDTSQGKDQDEEVVTGLIEKLLETKSSTFPLRKDQTLWKLL 527

Query: 125 F 125
           +
Sbjct: 528 Y 528

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 30.4 bits (67), Expect = 2.5,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 127 FLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYD-------ETAAWPY 169
           ++D E K  + Q  W ++ + F ++PN  VI  G D       E+  W +
Sbjct: 644 YVDSE-KSLVVQTAWALIALLFAEYPNKEVIDRGIDLLKNRQEESGEWKF 692

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score = 29.6 bits (65), Expect = 5.7,   Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%)

Query: 54  AQMKQVLVDLNDKLHSDKQYF 74
           A +K++L  LNDK H DK YF
Sbjct: 197 AALKELLEKLNDKYHRDKPYF 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.143    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,855,102
Number of extensions: 1062434
Number of successful extensions: 2706
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2704
Number of HSP's successfully gapped: 31
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)