Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C032508.325ON42942918480.0
Smik_12.1938.325ON42243413810.0
Skud_12.1998.325ON42243413550.0
YLR130C (ZRT2)8.325ON42243513480.0
KNAG0G024608.325ON40342813160.0
TPHA0A015508.325ON41143311741e-159
KLLA0D16434g8.325ON41441510931e-147
NDAI0G025708.325ON4292018801e-114
Suva_10.2238.325ON4201968711e-113
NCAS0B035808.325ON3471987861e-101
Kpol_543.648.325ON4241977921e-101
KAFR0H022508.325ON3791977791e-100
SAKL0H15510g8.325ON3991957652e-97
SAKL0H14388gna 1ON3801977528e-96
KNAG0A051808.325ON3952007372e-93
KAFR0B057308.325ON3721967213e-91
NDAI0J010108.325ON3841927075e-89
CAGL0E01353g8.325ON4331976984e-87
TBLA0H012708.325ON4011686616e-82
TPHA0D00970na 2ON3831926458e-80
Kpol_1006.10na 2ON3911926441e-79
AGL143Cna 1ON3741926291e-77
CAGL0M04301g8.325ON3891866302e-77
KLTH0F09064gna 1ON3611956272e-77
TBLA0F02390singletonON4271716141e-74
Ecym_4202na 1ON3751946091e-74
SAKL0F16346gsingletonON3791945822e-70
Suva_7.6na 3ON3721724016e-44
Smik_7.6na 3ON3721663981e-43
Skud_7.12na 3ON3721693894e-42
YGL255W (ZRT1)na 3ON3761663894e-42
ZYRO0F02200gsingletonON3811843885e-42
KLTH0C00374gsingletonON3761943641e-38
TDEL0D06550singletonON3811983623e-38
KLTH0A07722gna 4ON3921973529e-37
Kwal_23.6522na 4ON3892033492e-36
ZYRO0D17732gsingletonON3991713327e-34
Kwal_14.824singletonON3741593168e-32
NDAI0G039803.50ON57080810.23
CAGL0E01969g3.50ON54689800.30
Kwal_55.219553.50ON52190790.36
KLTH0F18744g3.50ON51690790.38
KAFR0C016703.50ON539122751.2
KLLA0A03740g3.50ON57990686.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C03250
         (429 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325    716   0.0  
Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {...   536   0.0  
Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {...   526   0.0  
YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON} ...   523   0.0  
KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {O...   511   0.0  
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...   456   e-159
KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]...   425   e-147
NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325    343   e-114
Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {...   340   e-113
NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {O...   307   e-101
Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {O...   309   e-101
KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.3...   304   e-100
SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} simi...   299   2e-97
SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} simi...   294   8e-96
KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.3...   288   2e-93
KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa] ...   282   3e-91
NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8....   276   5e-89
CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} simila...   273   4e-87
TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.3...   259   6e-82
TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {O...   253   8e-80
Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {O...   252   1e-79
AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON} N...   246   1e-77
CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa] ...   247   2e-77
KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} simila...   246   2e-77
TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON}              241   1e-74
Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar t...   239   1e-74
SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]...   228   2e-70
Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)    159   6e-44
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)    157   1e-43
Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)   154   4e-42
YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}  ZRT1High-aff...   154   4e-42
ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} simila...   154   5e-42
KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON...   144   1e-38
TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON}            144   3e-38
KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} simila...   140   9e-37
Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL25...   139   2e-36
ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]...   132   7e-34
Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON} ...   126   8e-32
NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {O...    36   0.23 
CAGL0E01969g Chr5 complement(195338..196978) [1641 bp, 546 aa] {...    35   0.30 
Kwal_55.21955 s55 (1054213..1055778) [1566 bp, 521 aa] {ON} YOL1...    35   0.36 
KLTH0F18744g Chr6 (1519346..1520896) [1551 bp, 516 aa] {ON} simi...    35   0.38 
KAFR0C01670 Chr3 (340899..342518) [1620 bp, 539 aa] {ON} Anc_3.5...    33   1.2  
KLLA0A03740g Chr1 complement(335548..337287) [1740 bp, 579 aa] {...    31   6.8  

>NCAS0C03250 Chr3 (638559..639848) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/429 (84%), Positives = 362/429 (84%)

Query: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60
           MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF
Sbjct: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60

Query: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120
           FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT
Sbjct: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120

Query: 121 HYYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVLPM 180
           HYYVAKSF                ITSFEADGFTDLERQNGIVRSTDH        VLPM
Sbjct: 121 HYYVAKSFGDHDHDGGHSNHHEDDITSFEADGFTDLERQNGIVRSTDHNNNSNNNNVLPM 180

Query: 181 KKNQVXXXXXXXXXXXXXXXXXXXPASNDLASSSRIXXXXXXXXXXXXISRFVSSVPGKD 240
           KKNQV                   PASNDLASSSRI            ISRFVSSVPGKD
Sbjct: 181 KKNQVDEKSIDEDDDGDDEDKEQDPASNDLASSSRINNNDNLVNTNTNISRFVSSVPGKD 240

Query: 241 HFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFET 300
           HFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFH            EEFET
Sbjct: 241 HFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHSVFVGLSLSVSGEEFET 300

Query: 301 LFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIP 360
           LFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIP
Sbjct: 301 LFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIP 360

Query: 361 GSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAG 420
           GSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAG
Sbjct: 361 GSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAG 420

Query: 421 LMALLGKWA 429
           LMALLGKWA
Sbjct: 421 LMALLGKWA 429

>Smik_12.193 Chr12 complement(384118..385386) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/434 (63%), Positives = 311/434 (71%), Gaps = 17/434 (3%)

Query: 1   MIDIILARD-VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWC 59
           MID+I+  D  D+C+ SN YNGHAGLRILA+FIILISSGLGV+FPI++SRYSFI LP WC
Sbjct: 1   MIDLIVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 60  FFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIV 119
           FF+AKFFGSGVIVATAF+HLL PAAEALG+ CLGGTF EYPWAFGICLMSLF+LF  EI+
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 120 THYYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVLP 179
           THYYVAK+                  TS +     D+   +  V + D          + 
Sbjct: 121 THYYVAKTLGHDHGDHGEN-------TSID----VDVPSSDLAVSNIDSQPASFNNEAVY 169

Query: 180 MKKNQVXXXXXXXXXXXXXXXXXXXPASN----DLASSSRIXXXXXXXXXXXXISRFVSS 235
              N                     P+SN    DL + +               +  + S
Sbjct: 170 FIHNNKTPYTTRNEEIGATPIKEKEPSSNITNYDLEAGNTESIANELFPMSSHATN-IPS 228

Query: 236 VPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXX 295
           VPGKDHF H++ HQD+SQ+GT +EEE+KEQYLNQM+AVFILEFGIIFH            
Sbjct: 229 VPGKDHFSHENDHQDASQLGTRIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG 288

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           EEFETLFIVL FHQMFEGLGLGTRVAETNWP+SKRYTPWLMGLAFT+TSPIAVA+GIGVR
Sbjct: 289 EEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAVGIGVR 348

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIM 415
            SWIPGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKML+AYFIM
Sbjct: 349 HSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLSAYFIM 408

Query: 416 CMGAGLMALLGKWA 429
           C GA LMALLGKWA
Sbjct: 409 CCGAALMALLGKWA 422

>Skud_12.199 Chr12 complement(385437..386705) [1269 bp, 422 aa] {ON}
           YLR130C (REAL)
          Length = 422

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/434 (62%), Positives = 306/434 (70%), Gaps = 17/434 (3%)

Query: 1   MIDIILARD-VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWC 59
           MID+++  D  D+C+ SN YNGHAGLRILA+FIILISSGLGV+FPI++SRYSFI LP WC
Sbjct: 1   MIDLVVRDDSTDSCQASNDYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNWC 60

Query: 60  FFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIV 119
           FF+AKFFGSGVIVATAF+HLL PAAEALG+ CLGGTF EYPWAFGICLMSLF+LF  EI+
Sbjct: 61  FFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEII 120

Query: 120 THYYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVLP 179
           THY+VAK+                 I S E+            VR+            + 
Sbjct: 121 THYFVAKTLGHDHGDNEGVGTVDADIASSES-----------AVRNGGPNPASLNNEAVY 169

Query: 180 MKKNQVXXXXXXXXXXXXXXXXXXXPASN----DLASSSRIXXXXXXXXXXXXISRFVSS 235
              N                     P SN    DL + +               +   +S
Sbjct: 170 SIHNNKIPYTTRNEEIVGTPVKEKDPNSNVINYDLETGNTESIANGLIPMNSHATNL-TS 228

Query: 236 VPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXX 295
           VPGKDH+ H++ HQD+S++G  +EEE+KEQYLNQM+AVFILEFGIIFH            
Sbjct: 229 VPGKDHYSHENYHQDASELGKGIEEEDKEQYLNQMLAVFILEFGIIFHSVFVGLSLSVAG 288

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           EEFETLFIVL FHQMFEGLGLGTRVAETNWP+SKRYTPWLMGLAFT+TSPIAVAIGIGVR
Sbjct: 289 EEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKRYTPWLMGLAFTLTSPIAVAIGIGVR 348

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIM 415
            SW+PGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP GLKKML+AYFIM
Sbjct: 349 HSWVPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYFIM 408

Query: 416 CMGAGLMALLGKWA 429
           C GA LMALLGKWA
Sbjct: 409 CCGAALMALLGKWA 422

>YLR130C Chr12 complement(402794..404062) [1269 bp, 422 aa] {ON}
           ZRT2Low-affinity zinc transporter of the plasma
           membrane; transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 422

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/435 (62%), Positives = 307/435 (70%), Gaps = 19/435 (4%)

Query: 1   MIDIILARD--VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEW 58
           M+D+I ARD  VDTC+ SN YNGHAGLRILA+FIILISSGLGV+FPI++SRYSFI LP W
Sbjct: 1   MVDLI-ARDDSVDTCQASNGYNGHAGLRILAVFIILISSGLGVYFPILSSRYSFIRLPNW 59

Query: 59  CFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEI 118
           CFF+AKFFGSGVIVATAF+HLL PAAEALG+ CLGGTF EYPWAFGICLMSLF+LF  EI
Sbjct: 60  CFFIAKFFGSGVIVATAFVHLLQPAAEALGDECLGGTFAEYPWAFGICLMSLFLLFFTEI 119

Query: 119 VTHYYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVL 178
           +THY+VAK+                 +TS + D          ++R+ D           
Sbjct: 120 ITHYFVAKTLGHDHGDHGE-------VTSIDVDA----PSSGFVIRNMDSDPVSFNNEAA 168

Query: 179 PMKKNQVXXXXXXXXXXXXXXXXXXXPASN----DLASSSRIXXXXXXXXXXXXISRFVS 234
               N                     P SN    DL    +              +  ++
Sbjct: 169 YSIHNDKTPYTTRNEEIVATPIKEKEPGSNVTNYDL-EPGKTESLANELVPTSSHATNLA 227

Query: 235 SVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXX 294
           SVPGKDH+ H++ HQD SQ+ T +EEE+KEQYLNQ++AVFILEFGIIFH           
Sbjct: 228 SVPGKDHYSHENDHQDVSQLATRIEEEDKEQYLNQILAVFILEFGIIFHSVFVGLSLSVA 287

Query: 295 XEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGV 354
            EEFETLFIVL FHQMFEGLGLGTRVAETNWP+SK+Y PWLMGLAFT+TSPIAVA+GIGV
Sbjct: 288 GEEFETLFIVLTFHQMFEGLGLGTRVAETNWPESKKYMPWLMGLAFTLTSPIAVAVGIGV 347

Query: 355 RKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFI 414
           R SWIPGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP GLKKML+AY I
Sbjct: 348 RHSWIPGSRRALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLKKMLSAYLI 407

Query: 415 MCMGAGLMALLGKWA 429
           MC GA LMALLGKWA
Sbjct: 408 MCCGAALMALLGKWA 422

>KNAG0G02460 Chr7 complement(560626..561837) [1212 bp, 403 aa] {ON}
           Anc_8.325 YLR130C
          Length = 403

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/428 (60%), Positives = 304/428 (71%), Gaps = 36/428 (8%)

Query: 5   ILARDVD---TCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFF 61
           +L RD D    C VSN+YNGH GLRILA+FIILISSG+GVFFPIMASRYSFI LP+WCFF
Sbjct: 9   LLPRDDDDVVACAVSNSYNGHNGLRILAVFIILISSGVGVFFPIMASRYSFIRLPDWCFF 68

Query: 62  LAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTH 121
           +AKFFGSGVIVATAFIHLL PA+EALG+ CLGGTF EYPWAFGICLMSLFMLF  EIV+H
Sbjct: 69  IAKFFGSGVIVATAFIHLLQPASEALGDPCLGGTFAEYPWAFGICLMSLFMLFFTEIVSH 128

Query: 122 YYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVLPMK 181
           ++++KS                 +   + D    + +Q  IV S               +
Sbjct: 129 HFISKSLGDSHESHGGADS----VYGDDDDSEFSVSKQREIVDS---------------Q 169

Query: 182 KNQVXXXXXXXXXXXXXXXXXXXPASNDLASSSRIXXXXXXXXXXXXISRFVSSVPGKDH 241
           K ++                   P++ D A+ +               +    ++PGKDH
Sbjct: 170 KGELFIKDKFEQEVDLSQGITTVPSTRDYANLTS--------------TELEPTIPGKDH 215

Query: 242 FGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETL 301
           F HD  HQD SQ+GTPV+E++KEQYLNQ++AV ILE GIIFH            EEFETL
Sbjct: 216 FAHDTEHQDPSQLGTPVQEQDKEQYLNQIVAVTILEAGIIFHSVFVGLSLSVSGEEFETL 275

Query: 302 FIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPG 361
           FIVL FHQMFEGLGLGTRVAETNWP++++ TPWLMGLAF +TSPIAVAIGIGVR SW+PG
Sbjct: 276 FIVLTFHQMFEGLGLGTRVAETNWPENRKNTPWLMGLAFMLTSPIAVAIGIGVRHSWVPG 335

Query: 362 SRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGL 421
           SR +LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGPGGLKKML AYFIMC+GAGL
Sbjct: 336 SRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGLKKMLYAYFIMCLGAGL 395

Query: 422 MALLGKWA 429
           MALLGKWA
Sbjct: 396 MALLGKWA 403

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
           YLR130C
          Length = 411

 Score =  456 bits (1174), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 238/433 (54%), Positives = 287/433 (66%), Gaps = 32/433 (7%)

Query: 2   IDIILARD---VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEW 58
           I+++L RD    DTC+  ++YNG   +R+LA+FIILISSGLG FFPI+AS YSFI LP+ 
Sbjct: 6   IELVL-RDGDSTDTCDTQSSYNGSTNMRVLALFIILISSGLGSFFPILASTYSFIRLPDC 64

Query: 59  CFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEI 118
           CFF+AKFFGSGVIVATAFIHLLDPA EAL N+CLGGTFTEYPWAFGICLMSLF+LFL+EI
Sbjct: 65  CFFVAKFFGSGVIVATAFIHLLDPAVEALSNTCLGGTFTEYPWAFGICLMSLFLLFLIEI 124

Query: 119 VTHYYVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQ--NGIVRSTDHXXXXXXXX 176
           +TH+ +                     TS+ A    D E    +  VR   +        
Sbjct: 125 MTHHMLTHD------EHGDGGHSHGDDTSYTASSIDDKEADSIDADVRKDANDDSYDINS 178

Query: 177 VLPMKKNQVXXXXXXXXXXXXXXXXXXXPASNDLASSSRIXXXXXXXXXXXXISRFVSSV 236
           +L   KN+                      +N    + +I                  S 
Sbjct: 179 ILNFDKNK------DYDIEANHYEVSMEDRNNTKMDNYKISQ--------------TKST 218

Query: 237 PGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXE 296
           PG+DHF HD  HQD  Q+GTPVE+ +KE+Y+ Q+++V ILEFG+IFH            +
Sbjct: 219 PGQDHFSHDSEHQDLVQLGTPVEQLDKEKYMGQIVSVIILEFGVIFHSIFTGLSLAVSGD 278

Query: 297 EFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRK 356
           EFETLFIVL+FHQMFEGLGLGTR+AETNWPKSK+ TPWL+ L FTI++PIA+ IGIGVR 
Sbjct: 279 EFETLFIVLVFHQMFEGLGLGTRIAETNWPKSKKNTPWLLALGFTISTPIAIGIGIGVRY 338

Query: 357 SWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMC 416
           ++IPGSR ALI NG+FDSISSGILIYTGLVELMAHEFL+S QF G  G KKM+ AY IMC
Sbjct: 339 TFIPGSRTALITNGIFDSISSGILIYTGLVELMAHEFLFSKQFSGRDGFKKMIFAYVIMC 398

Query: 417 MGAGLMALLGKWA 429
            GA LMALLGKWA
Sbjct: 399 CGAALMALLGKWA 411

>KLLA0D16434g Chr4 complement(1384826..1386070) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 414

 Score =  425 bits (1093), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 220/415 (53%), Positives = 260/415 (62%), Gaps = 47/415 (11%)

Query: 16  SNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATA 75
            N Y+G   +R+ A+FIILIS GLG +FPI++SRYSFI LP+WCFF+AKFFGSGVIVAT 
Sbjct: 46  DNDYDGKDNMRVCALFIILISGGLGSYFPILSSRYSFIRLPDWCFFIAKFFGSGVIVATG 105

Query: 76  FIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSFXXXXXXX 135
           FIHLL+PAA+ALG  CLGGTF +YPWAFGICLMSLF LFL E V  YY  KS+       
Sbjct: 106 FIHLLEPAADALGEECLGGTFADYPWAFGICLMSLFALFLSECVARYYTNKSY------- 158

Query: 136 XXXXXXXXXITSFEADGFTDLERQNGIVRSTDHXXXXXXXXVLPMKKNQVXXXXXXXXXX 195
                           GF +    +    S D             K NQV          
Sbjct: 159 ----------------GFQNDHVHSHFPSSKDQKSLEDEDDEDSDKYNQVVDEENVSLTV 202

Query: 196 XXXXXXXXXPASNDLASSSRIXXXXXXXXXXXXISRFVSSVPGKDHFGHDDVHQDSSQIG 255
                     A+N                          S+PG +HF HD  HQD + IG
Sbjct: 203 ANNNNGAEITATNPH-----------------------PSMPGSNHFSHDKSHQDLATIG 239

Query: 256 TPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXX-XEEFETLFIVLIFHQMFEGL 314
           TP +  +KE+Y NQ+++VFILEFGIIFH             +EF TLFIVL+FHQMFEG+
Sbjct: 240 TPAQMTSKEKYQNQLLSVFILEFGIIFHSVFIGLALAVTGNDEFNTLFIVLVFHQMFEGM 299

Query: 315 GLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDS 374
           GLG R+AE +W K  R+TPWL+   FT+T+PIA+AIGIGVR S+ PGSR ALIANG FD+
Sbjct: 300 GLGARIAEVSWAKKHRFTPWLLAAGFTLTTPIAIAIGIGVRHSYAPGSRTALIANGCFDA 359

Query: 375 ISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           IS+GILIYTGLVELMAHEFLYS+ FKG  GLKKML A+F MC GAGLMALLGKWA
Sbjct: 360 ISAGILIYTGLVELMAHEFLYSDNFKGENGLKKMLWAFFTMCWGAGLMALLGKWA 414

>NDAI0G02570 Chr7 (588135..589424) [1290 bp, 429 aa] {ON} Anc_8.325
          Length = 429

 Score =  343 bits (880), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 165/201 (82%), Positives = 176/201 (87%), Gaps = 1/201 (0%)

Query: 229 ISRFVSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXX 288
           ++RF +S+PGKDHF HD  HQD +Q+GTP+EEE+KEQYLNQM AVFILEFGIIFH     
Sbjct: 230 MTRF-NSIPGKDHFSHDTDHQDQTQLGTPIEEEDKEQYLNQMFAVFILEFGIIFHSVFVG 288

Query: 289 XXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAV 348
                  EEFETLFIVL FHQMFEGLGLGTRVAETNWP ++RYTPWLMGLAFTITSPIAV
Sbjct: 289 LSLSVSGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPSNRRYTPWLMGLAFTITSPIAV 348

Query: 349 AIGIGVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKM 408
           AIGIGVR SWIPGSR ALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGP G KKM
Sbjct: 349 AIGIGVRHSWIPGSRKALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGFKKM 408

Query: 409 LTAYFIMCMGAGLMALLGKWA 429
           L AYFIMC+GAGLMALLGKWA
Sbjct: 409 LAAYFIMCLGAGLMALLGKWA 429

 Score =  223 bits (567), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 102/128 (79%), Positives = 116/128 (90%)

Query: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60
           M++++   D   CE+SN YNGH+GLRILA+FIILISSGLGV+FPI++SRYSFI LP WCF
Sbjct: 1   MLELLARDDAVVCEISNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPSWCF 60

Query: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120
           FLAKFFGSGVIV+TAFIHLLDPAAEALGN CLGGTF EYPWAFGICLMSLF+LF +EIVT
Sbjct: 61  FLAKFFGSGVIVSTAFIHLLDPAAEALGNECLGGTFVEYPWAFGICLMSLFLLFFVEIVT 120

Query: 121 HYYVAKSF 128
           HY+VAKSF
Sbjct: 121 HYFVAKSF 128

>Suva_10.223 Chr10 complement(411354..412616) [1263 bp, 420 aa] {ON}
           YLR130C (REAL)
          Length = 420

 Score =  340 bits (871), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 174/196 (88%)

Query: 234 SSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXX 293
           +SVPGKDH+ H++ HQD+SQ+GT +EEE+KEQY+NQM+AVFILEFGIIFH          
Sbjct: 225 ASVPGKDHYSHENDHQDASQLGTQIEEEDKEQYINQMLAVFILEFGIIFHSVFVGLSLSV 284

Query: 294 XXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIG 353
             EEFETLFIVL FHQMFEGLGLGTRVAETNWP SKRYTPWLMGLAFT+TSPIAVA+GIG
Sbjct: 285 AGEEFETLFIVLTFHQMFEGLGLGTRVAETNWPDSKRYTPWLMGLAFTLTSPIAVAVGIG 344

Query: 354 VRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYF 413
           VR SWIPGSR ALIANG+FDSISSGILIYTGLVELMAHEFLYSNQFKGP GL+KML+AYF
Sbjct: 345 VRHSWIPGSRRALIANGIFDSISSGILIYTGLVELMAHEFLYSNQFKGPDGLRKMLSAYF 404

Query: 414 IMCMGAGLMALLGKWA 429
           IMC GA LMALLGKWA
Sbjct: 405 IMCCGAALMALLGKWA 420

 Score =  213 bits (542), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 98/129 (75%), Positives = 115/129 (89%), Gaps = 1/129 (0%)

Query: 1   MIDIILARD-VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWC 59
           MID+++  D  D+C+ SN YNGH+GLRILA+FIILISSGLGV+FPI++SRYSFI LP+ C
Sbjct: 1   MIDLLIRDDSTDSCQASNDYNGHSGLRILAVFIILISSGLGVYFPILSSRYSFIRLPDCC 60

Query: 60  FFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIV 119
           FF+AKFFGSGVIVATAFIHLL PAAEALGN CLGGTF EYPWAFGICL+SLF+LF  EI+
Sbjct: 61  FFIAKFFGSGVIVATAFIHLLQPAAEALGNECLGGTFAEYPWAFGICLISLFLLFFTEII 120

Query: 120 THYYVAKSF 128
           THY+VAK+ 
Sbjct: 121 THYFVAKTL 129

>NCAS0B03580 Chr2 complement(635005..636048) [1044 bp, 347 aa] {ON}
           Anc_8.325
          Length = 347

 Score =  307 bits (786), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 146/198 (73%), Positives = 163/198 (82%), Gaps = 2/198 (1%)

Query: 234 SSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXX 293
            S PGK HF H++ HQD+ QIGTP  ++ KEQY NQ+ AVFILEFGI+FH          
Sbjct: 150 DSRPGKQHFSHEEDHQDAIQIGTPANDKAKEQYTNQVFAVFILEFGILFHSIFIGLSLAV 209

Query: 294 XXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKS--KRYTPWLMGLAFTITSPIAVAIG 351
             +EF TLFIVLIFHQMFEGLGLGTRVAETNWP S  K++TPWLMGLAFT  +P+A+AIG
Sbjct: 210 SGDEFHTLFIVLIFHQMFEGLGLGTRVAETNWPDSGPKKWTPWLMGLAFTFVTPVAIAIG 269

Query: 352 IGVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTA 411
           +GVR SW+PGSR ALIANGVFDS+SSGILIYTGLVELMAHEFLYSNQFKGPGG KKML A
Sbjct: 270 LGVRHSWVPGSRRALIANGVFDSLSSGILIYTGLVELMAHEFLYSNQFKGPGGFKKMLYA 329

Query: 412 YFIMCMGAGLMALLGKWA 429
           YF MC GAG+MALLGKWA
Sbjct: 330 YFFMCCGAGIMALLGKWA 347

 Score =  194 bits (494), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 103/119 (86%)

Query: 10  VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSG 69
            DTC+  N YNG   +RIL++F+I+ISSGLGVFFP++AS+YSFI LP+WCFFLAKFFGSG
Sbjct: 2   TDTCQAQNDYNGETNIRILSVFMIMISSGLGVFFPLLASKYSFIRLPDWCFFLAKFFGSG 61

Query: 70  VIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           VIVATAF+HLL PA+EAL + CLGGTF +YPWAFGICLMSLF LF  EI +HYY++K+F
Sbjct: 62  VIVATAFVHLLQPASEALSDPCLGGTFADYPWAFGICLMSLFFLFFTEIFSHYYISKAF 120

>Kpol_543.64 s543 complement(147560..148834) [1275 bp, 424 aa] {ON}
           complement(147560..148834) [1275 nt, 425 aa]
          Length = 424

 Score =  309 bits (792), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/197 (72%), Positives = 165/197 (83%)

Query: 233 VSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXX 292
           + S+PGK+H+ HD  HQD SQ+GTPVEE +KEQYL Q++ V ILE G+IFH         
Sbjct: 228 LESIPGKNHYSHDKNHQDPSQLGTPVEEIDKEQYLGQIVGVTILEIGVIFHSIFVGLSLA 287

Query: 293 XXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGI 352
              EEF TLFIVL+FHQMFEGLGLGTR+AE NWP SKRYTPWLM L FT+T+PIA+AIGI
Sbjct: 288 VSGEEFITLFIVLVFHQMFEGLGLGTRLAEANWPHSKRYTPWLMALGFTLTTPIAIAIGI 347

Query: 353 GVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAY 412
           GVR SWIPGSR +LIANGVFD+ISSGILIYTGLVELMAHEFL+SNQFKGPGG K+ML+AY
Sbjct: 348 GVRYSWIPGSRKSLIANGVFDAISSGILIYTGLVELMAHEFLFSNQFKGPGGFKRMLSAY 407

Query: 413 FIMCMGAGLMALLGKWA 429
           F+MC GA LMA+LG+WA
Sbjct: 408 FVMCCGAALMAVLGRWA 424

 Score =  204 bits (520), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 111/128 (86%), Gaps = 4/128 (3%)

Query: 5   ILARD----VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60
           +L RD    VDTCE +N ++G   LR+L+IF+I+ISSGLGVFFP++ASRYSFI LPEWCF
Sbjct: 6   LLVRDTEGVVDTCEATNDFDGRINLRVLSIFMIMISSGLGVFFPLLASRYSFIRLPEWCF 65

Query: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120
           F+AKFFGSGVIV+TAFIHLL PAAEALGN CLGGTF EYPWAFGICLMSLF+LF  EI+T
Sbjct: 66  FIAKFFGSGVIVSTAFIHLLVPAAEALGNDCLGGTFVEYPWAFGICLMSLFLLFFTEIIT 125

Query: 121 HYYVAKSF 128
           HY+++KS 
Sbjct: 126 HYFMSKSL 133

>KAFR0H02250 Chr8 (429002..430141) [1140 bp, 379 aa] {ON} Anc_8.325
           YLR130C
          Length = 379

 Score =  304 bits (779), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (82%)

Query: 233 VSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXX 292
           ++S+ GKDHF HD  HQD SQ+GT  EE  KEQYLNQ++A+FILE GIIFH         
Sbjct: 183 LASILGKDHFSHDSTHQDPSQLGTSTEEFQKEQYLNQIVALFILESGIIFHSIFIGLSLA 242

Query: 293 XXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGI 352
               EF+TLFIVL FHQMFEGLGLGTR++E NWP+SK+Y PWLMGLAF +T+ IAVAIGI
Sbjct: 243 VTGAEFKTLFIVLTFHQMFEGLGLGTRISEANWPQSKKYIPWLMGLAFALTTAIAVAIGI 302

Query: 353 GVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAY 412
           GVR SW+PGSRNALIA+G+FDSIS+GILIYTGLVELMAHEFLYSNQFKGP G K+ML AY
Sbjct: 303 GVRHSWVPGSRNALIASGIFDSISAGILIYTGLVELMAHEFLYSNQFKGPDGFKRMLFAY 362

Query: 413 FIMCMGAGLMALLGKWA 429
           FIMC GA LMALLGKWA
Sbjct: 363 FIMCCGAALMALLGKWA 379

 Score =  199 bits (505), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 110/124 (88%)

Query: 5   ILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAK 64
           ++ R +DTC  SN Y+G+  LRIL++FI+LIS+ +GVFFPI+ASRYSFI+LP WCFF+AK
Sbjct: 7   LIPRAIDTCSTSNDYDGNNNLRILSVFILLISASIGVFFPILASRYSFINLPGWCFFIAK 66

Query: 65  FFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYV 124
           FFGSGVIVATAFIHLL+PA+E LG+ CLGGTF EYPWAFGICLMSLF LFL+EI++HY+V
Sbjct: 67  FFGSGVIVATAFIHLLEPASEELGDDCLGGTFAEYPWAFGICLMSLFFLFLVEIISHYFV 126

Query: 125 AKSF 128
            K+F
Sbjct: 127 NKNF 130

>SAKL0H15510g Chr8 (1350297..1351496) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 399

 Score =  299 bits (765), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 138/195 (70%), Positives = 163/195 (83%)

Query: 235 SVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXX 294
           SVPGKDHF H+  HQD SQ+GT V ++ +EQYL+Q+ AVFILEFG++FH           
Sbjct: 205 SVPGKDHFSHEQDHQDLSQLGTLVRQKEREQYLSQVFAVFILEFGVVFHSVFVGLSLAVA 264

Query: 295 XEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGV 354
            +EF TLFIVL+FHQMFEGLGLGTR+AET WP SKRYTPWL+GL +T+++PIA+AIGIGV
Sbjct: 265 GDEFNTLFIVLVFHQMFEGLGLGTRIAETTWPASKRYTPWLLGLGYTLSTPIAIAIGIGV 324

Query: 355 RKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFI 414
           R S+ PGS+ ALI NGVFDSIS+GILIYTGLVELMAHEFLYS QFKG GG K+M+ AYFI
Sbjct: 325 RHSFAPGSKKALITNGVFDSISAGILIYTGLVELMAHEFLYSQQFKGEGGCKRMIGAYFI 384

Query: 415 MCMGAGLMALLGKWA 429
           MC+GAGLMALLG+WA
Sbjct: 385 MCLGAGLMALLGRWA 399

 Score =  184 bits (468), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 100/123 (81%), Gaps = 2/123 (1%)

Query: 7   ARD--VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAK 64
           ARD  VD C+  N Y+G   LRILA+F+ILISSGLG FFPI++SRYS I LP WCFF+AK
Sbjct: 5   ARDDEVDVCDNDNEYDGRDSLRILAVFMILISSGLGAFFPILSSRYSVIRLPAWCFFIAK 64

Query: 65  FFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYV 124
           FFGSGVIVAT FIHLL PA + LGN+CLGGTF +YPWAFGICLMSLF LF  EI+TH++ 
Sbjct: 65  FFGSGVIVATGFIHLLKPATDNLGNTCLGGTFADYPWAFGICLMSLFALFFSEIITHHFF 124

Query: 125 AKS 127
            K+
Sbjct: 125 IKA 127

>SAKL0H14388g Chr8 (1247106..1248248) [1143 bp, 380 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 380

 Score =  294 bits (752), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 164/197 (83%)

Query: 233 VSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXX 292
           V+SVPG DH+GHD+VHQD +Q    V +++KE+YLNQ++AVFILEFG++FH         
Sbjct: 184 VNSVPGADHYGHDEVHQDPAQAQNLVSQKDKEKYLNQIVAVFILEFGVVFHSVFVGLSLA 243

Query: 293 XXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGI 352
              +EF TLFIVL+FHQMFEGLGLGTR+AET WP+S+R+TPWL+ L +TI +PIA+AIGI
Sbjct: 244 VAGDEFNTLFIVLVFHQMFEGLGLGTRIAETPWPESERFTPWLLALGYTIATPIAIAIGI 303

Query: 353 GVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAY 412
           GVR S+ PGSR ALI+NG FD+IS+GILIYTGLVELMAHEFLY+N FKGP G K M+ A+
Sbjct: 304 GVRHSFAPGSRKALISNGCFDAISAGILIYTGLVELMAHEFLYANSFKGPNGFKWMMLAF 363

Query: 413 FIMCMGAGLMALLGKWA 429
           FIMC+GAGLMALLGKWA
Sbjct: 364 FIMCLGAGLMALLGKWA 380

 Score =  187 bits (476), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 102/123 (82%), Gaps = 4/123 (3%)

Query: 9   DVD----TCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAK 64
           DVD     C + N Y+G   LRILA+F+ILISS LG FFPI++SRYSFI LP+WCFF+AK
Sbjct: 24  DVDEEPVACPIDNDYDGRDNLRILAVFMILISSALGTFFPILSSRYSFIRLPDWCFFIAK 83

Query: 65  FFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYV 124
           +FGSGVIVAT FIHLL+PA++ALG  CLGGTF +YPWAFGICLMSLF LF +EI+THY+ 
Sbjct: 84  YFGSGVIVATGFIHLLEPASDALGEECLGGTFADYPWAFGICLMSLFALFFVEIITHYFA 143

Query: 125 AKS 127
           AK+
Sbjct: 144 AKA 146

>KNAG0A05180 Chr1 (764235..765422) [1188 bp, 395 aa] {ON} Anc_8.325
           YLR130C
          Length = 395

 Score =  288 bits (737), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 133/200 (66%), Positives = 162/200 (81%)

Query: 230 SRFVSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXX 289
           S  ++S+PGK H+ H   HQD +Q+G+P+EE NKE+Y NQ+MAV  LEFGI+FH      
Sbjct: 196 SDKMASMPGKGHYDHAVFHQDPAQLGSPLEEPNKEKYANQIMAVLFLEFGILFHSVFIGL 255

Query: 290 XXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVA 349
                 +EF+TLFIVL+FHQMFEGLGLGTR+AET WP+++R TPW++ L FT+T+P+A+A
Sbjct: 256 SLAVAGDEFKTLFIVLVFHQMFEGLGLGTRIAETKWPENRRLTPWMLALGFTLTTPVAIA 315

Query: 350 IGIGVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKML 409
           IG+GVR S+IPGSR AL++NGVFDSISSGILIYTGLVELMAHEFLYSNQF G  G KKM+
Sbjct: 316 IGLGVRHSFIPGSRKALVSNGVFDSISSGILIYTGLVELMAHEFLYSNQFNGADGFKKMI 375

Query: 410 TAYFIMCMGAGLMALLGKWA 429
            AY IMC G GLMALLGKWA
Sbjct: 376 LAYVIMCFGVGLMALLGKWA 395

 Score =  142 bits (358), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/130 (66%), Positives = 106/130 (81%), Gaps = 5/130 (3%)

Query: 4   IILARDVDT-----CEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEW 58
           ++  RD D+     C  +N Y+G + LRIL+IFIILISS +G FFPI++S+YSFI LP+W
Sbjct: 7   LLFKRDDDSGPAPACADTNEYDGRSNLRILSIFIILISSAMGSFFPILSSKYSFIRLPDW 66

Query: 59  CFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEI 118
           CFFLAKFFGSGVIVATAF+HLL PA EAL + CL GTF  YPWAFGICLMSLF+LFLME+
Sbjct: 67  CFFLAKFFGSGVIVATAFVHLLQPANEALTDECLTGTFQSYPWAFGICLMSLFLLFLMEL 126

Query: 119 VTHYYVAKSF 128
           V+HY +AK+F
Sbjct: 127 VSHYLIAKTF 136

>KAFR0B05730 Chr2 complement(1182121..1183239) [1119 bp, 372 aa]
           {ON} Anc_8.325 YLR130C
          Length = 372

 Score =  282 bits (721), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 155/196 (79%)

Query: 234 SSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXX 293
           S +PG+DH+ HD VHQD SQ+GTP E  +KE Y NQ+ AV ILEFGI+FH          
Sbjct: 177 SFIPGRDHYSHDAVHQDPSQLGTPAESSDKENYANQIFAVSILEFGIVFHSVFIGLSLAV 236

Query: 294 XXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIG 353
             EEF+TLF+VLIFHQMFEGLGLGTR+AETNWPKSK+ TPW+M L ++IT+PI+ AIGIG
Sbjct: 237 AGEEFKTLFVVLIFHQMFEGLGLGTRLAETNWPKSKKLTPWIMALGYSITTPISTAIGIG 296

Query: 354 VRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYF 413
           VR S++P SR ALI NGVFD+ S+GILIYTGLVELMAHEFLYS+ FK   GLK+ML AY 
Sbjct: 297 VRHSFLPESRKALIVNGVFDAFSAGILIYTGLVELMAHEFLYSSTFKQKDGLKRMLLAYL 356

Query: 414 IMCMGAGLMALLGKWA 429
            M  GAG+MALLGKWA
Sbjct: 357 CMATGAGIMALLGKWA 372

 Score =  189 bits (480), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 101/118 (85%)

Query: 11  DTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGV 70
           DTC+ SN YNG   LRILA+F+ILISS LG FFP+++S+YSFI LP WCFF+AKFFGSGV
Sbjct: 8   DTCQTSNDYNGSDNLRILAVFMILISSALGAFFPLLSSKYSFIKLPNWCFFIAKFFGSGV 67

Query: 71  IVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IVATAFIHLL+PA++AL N CLGGTF +YPWAFGICLMSLF LF  EI +HY++ +++
Sbjct: 68  IVATAFIHLLEPASDALTNDCLGGTFADYPWAFGICLMSLFFLFFSEICSHYFILRAY 125

>NDAI0J01010 Chr10 (230625..231779) [1155 bp, 384 aa] {ON} Anc_8.325
          Length = 384

 Score =  276 bits (707), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 130/192 (67%), Positives = 152/192 (79%)

Query: 238 GKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEE 297
           G +H+ H  VHQD  Q+GT + +  KEQY NQ++AV ILEFGI+FH            EE
Sbjct: 193 GSNHYDHALVHQDPGQMGTSLNDSAKEQYANQLLAVTILEFGIVFHSVFIGLSLAVSGEE 252

Query: 298 FETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKS 357
           F TLFIVLIFHQMFEGLGLGTR+AE  W KSKR+TPWLM L F++T+PIA+AIG+GVR S
Sbjct: 253 FTTLFIVLIFHQMFEGLGLGTRLAEVPWDKSKRFTPWLMALGFSLTTPIAIAIGLGVRHS 312

Query: 358 WIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCM 417
           ++P SR ALI+NG FD+IS+GILIYTGLVELMAHEFLYSNQFKG  G KKM++AY  MC 
Sbjct: 313 FVPTSRRALISNGCFDAISAGILIYTGLVELMAHEFLYSNQFKGENGFKKMISAYICMCF 372

Query: 418 GAGLMALLGKWA 429
           GAGLMALLGKWA
Sbjct: 373 GAGLMALLGKWA 384

 Score =  186 bits (472), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 82/119 (68%), Positives = 102/119 (85%)

Query: 10  VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSG 69
            DTC  +N +NG   +RIL+IF+IL+SS +G FFP++++RYS+I LP WCFFLAKFFGSG
Sbjct: 2   TDTCLNTNDFNGRTNIRILSIFMILLSSAIGTFFPLLSTRYSYIRLPPWCFFLAKFFGSG 61

Query: 70  VIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           VIVATAFIHLL+PA++ALG+ CLGGTF +YPWAFGICLMSLF LF  EIV+H+YV K+F
Sbjct: 62  VIVATAFIHLLEPASDALGDPCLGGTFADYPWAFGICLMSLFFLFFTEIVSHFYVNKAF 120

>CAGL0E01353g Chr5 (127845..129146) [1302 bp, 433 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130c ZRT2
           or uniprot|P32804 Saccharomyces cerevisiae YGL255w ZRT1
          Length = 433

 Score =  273 bits (698), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 158/197 (80%)

Query: 233 VSSVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXX 292
           +  +PG +HF HD+VHQD +QIG+   ++ KEQYLNQ+ ++FILEFGI+FH         
Sbjct: 237 LEHMPGHNHFSHDEVHQDITQIGSKANDQQKEQYLNQLTSLFILEFGILFHSVFVGLSLS 296

Query: 293 XXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGI 352
              +EF+TLF+V++FHQMFEG+GLG R+ E  WP SKR+ P+L+G  +TIT+PIA+AIGI
Sbjct: 297 VSGDEFKTLFVVIVFHQMFEGMGLGARITECYWPHSKRWLPYLLGFGYTITTPIAIAIGI 356

Query: 353 GVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAY 412
           GVR S++PGSR +LI NGVFD+IS+GIL+Y GLVELMAHEFL++NQFKG  GL+ ML AY
Sbjct: 357 GVRHSFVPGSRRSLIVNGVFDAISAGILVYAGLVELMAHEFLFTNQFKGEHGLRNMLAAY 416

Query: 413 FIMCMGAGLMALLGKWA 429
           F+M +GAGLMALLG+WA
Sbjct: 417 FVMALGAGLMALLGRWA 433

 Score =  190 bits (483), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 109/132 (82%), Gaps = 5/132 (3%)

Query: 1   MIDIILARDVD-----TCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHL 55
           ++ ++  RD D      C V N +NGH  LRIL++F++LISS +GV+FP++ASRYSFI+L
Sbjct: 3   IVQLLFKRDDDDGPPPACAVDNDFNGHTNLRILSVFMVLISSAIGVYFPLLASRYSFINL 62

Query: 56  PEWCFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFL 115
           P W FF+AKFFGSGVIVATAFIHLL+PA+++LGN CLGGTF  YPWAFGICLM+LF LFL
Sbjct: 63  PSWVFFIAKFFGSGVIVATAFIHLLEPASDSLGNPCLGGTFANYPWAFGICLMALFALFL 122

Query: 116 MEIVTHYYVAKS 127
           +EIV+H+YV K+
Sbjct: 123 IEIVSHHYVGKT 134

>TBLA0H01270 Chr8 (286413..287618) [1206 bp, 401 aa] {ON} Anc_8.325
           YLR130C
          Length = 401

 Score =  259 bits (661), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 139/168 (82%)

Query: 262 NKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVA 321
            +EQYLNQ++AV +LE G+I H            + F TLFIVL FHQMFEGLGLGTRVA
Sbjct: 234 EREQYLNQLVAVMVLEAGVIVHSVFIGLSLAVTGDNFVTLFIVLTFHQMFEGLGLGTRVA 293

Query: 322 ETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSGILI 381
           ET WPKSKR TPWLM LAFT+T+P+AVAIG+GVR SW+PGSR +LIANG+FD+IS+GILI
Sbjct: 294 ETPWPKSKRMTPWLMALAFTLTTPVAVAIGLGVRNSWVPGSRTSLIANGIFDAISAGILI 353

Query: 382 YTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           YTGLVELMAHEFLYS QFKG  GLK+ML+AYF+MC GA LMALLGKWA
Sbjct: 354 YTGLVELMAHEFLYSGQFKGENGLKQMLSAYFVMCCGAALMALLGKWA 401

 Score =  189 bits (480), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 109/134 (81%), Gaps = 8/134 (5%)

Query: 1   MIDIILARD--------VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSF 52
           ++D+I+ R         V  CE SN Y+G   LRIL++FI+LISSG+GV FPI+AS+YSF
Sbjct: 7   LLDVIVKRHGADDDSDHVPACETSNDYDGRMNLRILSVFILLISSGIGVNFPILASQYSF 66

Query: 53  IHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFM 112
           I LP+WCFF+AKFFGSGVI+ATAF+HLL+PAA+ALGN+CLGGTF EYPWAFGICLMSLF 
Sbjct: 67  IRLPKWCFFIAKFFGSGVIIATAFVHLLEPAADALGNACLGGTFAEYPWAFGICLMSLFF 126

Query: 113 LFLMEIVTHYYVAK 126
           LF  EI++H+ + +
Sbjct: 127 LFFTEIISHHIIDQ 140

>TPHA0D00970 Chr4 complement(195530..196681) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  253 bits (645), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 115/192 (59%), Positives = 146/192 (76%)

Query: 238 GKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEE 297
           G +H+ H + HQD  Q+ + +EE  KE Y +Q++++ ILEFG+IFH            +E
Sbjct: 192 GANHYSHAEHHQDIEQMNSALEETGKESYSSQIVSLLILEFGVIFHSIFVGLSLAVSGDE 251

Query: 298 FETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKS 357
           F+TLF+V+IFHQMFEGLGLG+R+AE NW     YTPWL+ L FT+ +PIA+AIGIGVR S
Sbjct: 252 FKTLFVVIIFHQMFEGLGLGSRIAEQNWGVRNTYTPWLLALGFTVATPIAIAIGIGVRYS 311

Query: 358 WIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCM 417
           + PGSRNALI++G+FDS+S+GILIYTGLVELMAHEFL+S QF+G  G KKML AY  MC 
Sbjct: 312 YFPGSRNALISSGIFDSLSAGILIYTGLVELMAHEFLFSKQFQGENGFKKMLLAYVCMCC 371

Query: 418 GAGLMALLGKWA 429
           G  LMAL+GKWA
Sbjct: 372 GCALMALIGKWA 383

 Score =  178 bits (452), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 81/120 (67%), Positives = 101/120 (84%), Gaps = 1/120 (0%)

Query: 9   DVDTCEVSNTYNGHA-GLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFG 67
           ++  C++ + Y+G +  LRILA+F++LISSGLG FFPI++S+YS I LP WCFF+AKFFG
Sbjct: 19  ELPICDIESDYDGQSDNLRILAVFMVLISSGLGSFFPILSSKYSVIRLPNWCFFIAKFFG 78

Query: 68  SGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS 127
           SGVI ATAFIHLL+PA + LGN CLGGTF EYPWAFGICLMSLF LFL+EIVTH+ + K+
Sbjct: 79  SGVITATAFIHLLEPATDELGNDCLGGTFAEYPWAFGICLMSLFTLFLVEIVTHHLMEKN 138

>Kpol_1006.10 s1006 complement(43032..44207) [1176 bp, 391 aa] {ON}
           complement(43032..44207) [1176 nt, 392 aa]
          Length = 391

 Score =  252 bits (644), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 115/192 (59%), Positives = 141/192 (73%), Gaps = 1/192 (0%)

Query: 238 GKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEE 297
           GKDHF H D HQD +    P+   + E + NQ++AV   E GI+FH             E
Sbjct: 201 GKDHFSHKDTHQDRNPSNPPLNNTD-EGFYNQLVAVLFFESGIVFHSVFIGLSLAVAGSE 259

Query: 298 FETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKS 357
           F+TLF+VL+FHQMFE LGLG R+ E  W K KR+ PWL+ L F++ +PIA+AIGIGVR S
Sbjct: 260 FKTLFVVLVFHQMFEALGLGARLVEVEWKKDKRWMPWLLALGFSLCTPIAIAIGIGVRNS 319

Query: 358 WIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCM 417
           W P S+ ALI NG+FDSIS+GILIYTGLVEL+AHEFL+SNQFK P G K+M+ AYF+MC+
Sbjct: 320 WTPESKGALITNGIFDSISAGILIYTGLVELIAHEFLFSNQFKNPNGFKQMMLAYFVMCI 379

Query: 418 GAGLMALLGKWA 429
           GAGLMALLGKWA
Sbjct: 380 GAGLMALLGKWA 391

 Score =  144 bits (364), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 89/118 (75%)

Query: 10  VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSG 69
           V  C  +N YNG   LRIL++F+ILISS +G F P++ S     ++P W FF+AKFFGSG
Sbjct: 19  VPVCAANNEYNGDLNLRILSVFMILISSAIGSFAPLILSNTKMFNVPSWFFFIAKFFGSG 78

Query: 70  VIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS 127
           VI+AT+FIHLL PA +AL N CLG  FT+YPW+F I L+SLF+LF +E++ ++Y++K+
Sbjct: 79  VIIATSFIHLLSPATDALSNDCLGPGFTDYPWSFAIALISLFVLFFVELIVYHYMSKA 136

>AGL143C Chr7 complement(431959..433083) [1125 bp, 374 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR130C
           (ZRT2) and YGL255W (ZRT1)
          Length = 374

 Score =  246 bits (629), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 111/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (0%)

Query: 239 KDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEE- 297
             HF HD+ HQD  Q  +   + N+EQYLNQ++++FILEFG++FH            E+ 
Sbjct: 183 SQHFAHDECHQDLEQAKSLAADPNREQYLNQLISLFILEFGVVFHSVLIGLSLAVTAEDH 242

Query: 298 FETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKS 357
           F TLF+VLIFHQMFEG+GLG R+AET W   +++TPWL+GL + +++PIA+AIG+GVR S
Sbjct: 243 FTTLFVVLIFHQMFEGMGLGARIAETEWGVHRKWTPWLLGLGYCLSTPIAIAIGLGVRHS 302

Query: 358 WIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCM 417
           + P SR +LI NGVFDS+S+GI++YTGL+ELMAHEFL+SN FKG GG  KM+  +  MC+
Sbjct: 303 FAPESRPSLIVNGVFDSLSAGIMLYTGLIELMAHEFLFSNSFKGEGGFNKMMQGFVYMCL 362

Query: 418 GAGLMALLGKWA 429
           GAGLMALLGKWA
Sbjct: 363 GAGLMALLGKWA 374

 Score =  152 bits (384), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%)

Query: 7   ARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFF 66
           + + + C   N Y+G  G+RIL++FIIL++S +G FFP++ SR+S + LP W FF AK+F
Sbjct: 22  SEEPEECPTENEYDGSDGIRILSVFIILLASAIGTFFPMLGSRFSRVRLPTWAFFFAKYF 81

Query: 67  GSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAK 126
           GSGVIVAT FIHLL    E+L N CLGG  +EYPWAF IC+MSLF LF +EI +H++V K
Sbjct: 82  GSGVIVATGFIHLLLHGHESLSNPCLGGVLSEYPWAFAICMMSLFTLFFVEINSHHFVNK 141

Query: 127 S 127
           +
Sbjct: 142 A 142

>CAGL0M04301g Chr13 complement(472227..473396) [1170 bp, 389 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
           YGL255w ZRT1
          Length = 389

 Score =  247 bits (630), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 120/186 (64%), Positives = 140/186 (75%), Gaps = 1/186 (0%)

Query: 245 DDVHQDSSQIGTPVEEEN-KEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFI 303
           D+   D + + T   E      Y++++  + +LEFGIIFH             EF+ LFI
Sbjct: 204 DETWIDENTLTTGNSEHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFI 263

Query: 304 VLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSR 363
           V+ FHQMFEGLGLGTR+AET WP SK YTPW+M  AFTITSPIA+AIGIGVR SW+PGSR
Sbjct: 264 VITFHQMFEGLGLGTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSR 323

Query: 364 NALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMA 423
            ALIANGVFDSISSGILIYTGL+ELMAHEF++SNQFKG   L+ MLTAYFIMC GA LMA
Sbjct: 324 KALIANGVFDSISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMA 383

Query: 424 LLGKWA 429
           LLG+WA
Sbjct: 384 LLGRWA 389

 Score =  199 bits (507), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (82%)

Query: 1   MIDIILARDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCF 60
           M + +L R VDTC   N YNG   LRILA+FI++ISSGLG +FPI++S+YSFI LP WCF
Sbjct: 1   MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPILSSQYSFIRLPNWCF 60

Query: 61  FLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVT 120
           F+AKFFGSGVI+ATAFIHLL PAAEAL + CLGGTF +YPWAFGICLMSLFMLFL EIV 
Sbjct: 61  FVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFGICLMSLFMLFLAEIVA 120

Query: 121 HYYVAKSF 128
           H++V K F
Sbjct: 121 HHFVDKKF 128

>KLTH0F09064g Chr6 (779431..780516) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q12436 Saccharomyces cerevisiae YLR130C ZRT2
           Low-affinity zinc transporter of the plasma membrane
           transcription is induced under low- zinc conditions by
           the Zap1p transcription factor
          Length = 361

 Score =  246 bits (627), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 149/195 (76%), Gaps = 3/195 (1%)

Query: 235 SVPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXX 294
           S PG D    D V+Q++ ++ +       E +L+Q++ VFILEFG+IFH           
Sbjct: 170 SKPGSDG---DAVYQEAHRVLSASSSTVTEGFLSQVVTVFILEFGVIFHSVFIGLSLAVS 226

Query: 295 XEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGV 354
             EF TLFIVLIFHQMFEGLGLGTR+AE +WP +KRYTPW++ L F+I++PIA+AIG+GV
Sbjct: 227 GSEFITLFIVLIFHQMFEGLGLGTRIAEISWPANKRYTPWILALGFSISTPIAIAIGLGV 286

Query: 355 RKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFI 414
           R S    SR+ LIANG FD+ISSGILIYTGLVELMAHEF++S+QFKGPGGLKKML A+ +
Sbjct: 287 RHSLSTNSRSGLIANGCFDAISSGILIYTGLVELMAHEFIFSSQFKGPGGLKKMLFAFTM 346

Query: 415 MCMGAGLMALLGKWA 429
           MC G+GLMALLG+WA
Sbjct: 347 MCAGSGLMALLGRWA 361

 Score =  167 bits (424), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 73/116 (62%), Positives = 94/116 (81%)

Query: 11  DTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGV 70
           + C  SN ++G  GLR+ A+F+I+ SS LG FFPIMAS YS + LP+WCFF+AKFFGSGV
Sbjct: 14  EQCSTSNEFDGREGLRVGALFVIMASSALGAFFPIMASNYSAVSLPDWCFFVAKFFGSGV 73

Query: 71  IVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAK 126
           I+AT F+HLL PA EAL + CL GTF +YPWAFGICLMSL+ +FL+EIVTH+ +++
Sbjct: 74  IIATGFVHLLQPANEALTDPCLTGTFQDYPWAFGICLMSLYAIFLVEIVTHHMLSR 129

>TBLA0F02390 Chr6 (588534..589817) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score =  241 bits (614), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 136/171 (79%)

Query: 259 EEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGT 318
           E+ +  +Y+ ++++V ILE GII H            +EF+TLF+VLIFHQMFEGLGLGT
Sbjct: 257 EDVSNSEYVRELVSVMILESGIIAHSIFIGLSLSVAGKEFDTLFVVLIFHQMFEGLGLGT 316

Query: 319 RVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSG 378
           RVAE  WP SKRYTPW++G  F +T+PI+ AIGIGVR SW+PGSR+ALI NG+FDSIS+G
Sbjct: 317 RVAEVEWPYSKRYTPWILGACFGVTTPISAAIGIGVRHSWVPGSRSALIVNGIFDSISAG 376

Query: 379 ILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           ILIYTGLVELMAHEFLY+N F+G   LKK+L AYF+MC G GLMALLGKWA
Sbjct: 377 ILIYTGLVELMAHEFLYANNFEGKNSLKKLLLAYFVMCCGCGLMALLGKWA 427

 Score =  162 bits (410), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 92/116 (79%)

Query: 12  TCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVI 71
            C   N Y+G   LRILA+F++LISS +GVFFPI+ASRYSFI +P   FF+AKFFGSGVI
Sbjct: 19  ACPTQNDYDGRDNLRILAVFMLLISSSIGVFFPILASRYSFIRIPPIFFFIAKFFGSGVI 78

Query: 72  VATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS 127
           VATAFIHLL PA + L + CLGG + EYPWAFGICLM+LF++F  E++ HY++ ++
Sbjct: 79  VATAFIHLLQPAYDELNDPCLGGVWQEYPWAFGICLMALFLIFFSELMAHYFIERN 134

>Ecym_4202 Chr4 (419650..420777) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii AGL143C
          Length = 375

 Score =  239 bits (609), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 140/194 (72%), Gaps = 1/194 (0%)

Query: 237 PGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXX-XXXXXXXX 295
           PG  HF HD+ HQD  Q        NKEQY NQ++++FILEFG++FH             
Sbjct: 182 PGNKHFSHDEYHQDIEQANGLATNPNKEQYSNQLISLFILEFGVVFHSILIGLALAVSSS 241

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           EEF TLF+VLIFHQMFEGLGLGTR+AE +W   K  TPWL+   +++ +P+A+A+G+G++
Sbjct: 242 EEFVTLFVVLIFHQMFEGLGLGTRIAEASWGSGKSLTPWLLAFGYSLATPLAIAVGLGIK 301

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIM 415
            S+ P SR +LI NG+FD+IS+G+LIYTGL+ELMAHEFL+SN FKG  G  KM+  + IM
Sbjct: 302 HSFAPESRQSLIVNGIFDAISAGVLIYTGLIELMAHEFLFSNSFKGENGYTKMMYGFIIM 361

Query: 416 CMGAGLMALLGKWA 429
           C GAG M+LLG+WA
Sbjct: 362 CFGAGSMSLLGRWA 375

 Score =  163 bits (413), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 92/120 (76%)

Query: 8   RDVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFG 67
            +V  CEV N+Y+G   LR++AIF+ILI+S +G  FP++++ YS I LP +CFF AK+FG
Sbjct: 27  EEVPQCEVGNSYDGQDHLRVVAIFVILITSAIGTIFPLLSTNYSRIRLPSYCFFFAKYFG 86

Query: 68  SGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS 127
           SGVIVAT FIHLL PA E L N CLGG F +YPWAF IC+M+LF LF +EI TH++V KS
Sbjct: 87  SGVIVATGFIHLLQPANENLSNECLGGVFAQYPWAFAICMMALFSLFFVEINTHHFVHKS 146

>SAKL0F16346g Chr6 complement(1331198..1332337) [1140 bp, 379 aa]
           {ON} similar to uniprot|Q12436 Saccharomyces cerevisiae
           YLR130C ZRT2 Low-affinity zinc transporter of the plasma
           membrane transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 379

 Score =  228 bits (582), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 108/194 (55%), Positives = 140/194 (72%), Gaps = 12/194 (6%)

Query: 248 HQDSSQI---GTPVEEENKEQYLN---------QMMAVFILEFGIIFHXXXXXXXXXXXX 295
             D+S +   G P+++E  E   N         Q++A+F+LEFG++FH            
Sbjct: 186 QDDTSSVLDNGLPLKDEQSESSENYKNNGSHSTQLIAIFVLEFGVLFHSVFVGLSLAVAG 245

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           +EF TLFIVLIFHQMFEGLGLG R+AETNWP  +R+TPW++ LAF + +PI++AIGIGV+
Sbjct: 246 DEFNTLFIVLIFHQMFEGLGLGARIAETNWPHKRRFTPWMLALAFAVCTPISIAIGIGVK 305

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIM 415
           KS+ P S  +LI  GVFD+IS+GILIY G+VELMAHEF +   F+GPG LK ML A+FIM
Sbjct: 306 KSYAPYSSRSLIFTGVFDAISAGILIYAGIVELMAHEFFHETTFQGPGKLKSMLWAFFIM 365

Query: 416 CMGAGLMALLGKWA 429
           C+GAGLM+LLGKWA
Sbjct: 366 CLGAGLMSLLGKWA 379

 Score =  140 bits (353), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 87/119 (73%)

Query: 9   DVDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGS 68
           D   C   + YNG+ G+RILA+FI+LISS +G F P++ S+YSFI LP+W FF+AK+FGS
Sbjct: 32  DSSACPGGSGYNGNDGIRILAVFILLISSAIGSFSPLLGSKYSFIRLPDWFFFIAKYFGS 91

Query: 69  GVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKS 127
           GVI+AT FIHLL  ++ +LG  CLG  FT YPWA+ ICL S+F +F +E++ H    K+
Sbjct: 92  GVIIATGFIHLLFHSSHSLGEECLGDGFTSYPWAYLICLASIFTVFFVELLAHRLFIKA 150

>Suva_7.6 Chr7 (15340..16458) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  159 bits (401), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 114/172 (66%), Gaps = 8/172 (4%)

Query: 261 ENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRV 320
           +  + + +Q  A  ILEFG+IFH            EEF TL+ VL+FHQ FEGLG+G R+
Sbjct: 206 DTVQSFQSQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATLYPVLVFHQSFEGLGMGARL 265

Query: 321 AETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSGIL 380
           +   +PKSKR+ PW + +A+ +T+PI VAIG+G+R  ++ GS  A + +GV D+IS+GIL
Sbjct: 266 SGIEFPKSKRWWPWALCIAYGLTTPICVAIGLGIRTKYVSGSYTASVVSGVLDAISAGIL 325

Query: 381 IYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYF-IMC--MGAGLMALLGKWA 429
           IYTGLVEL+A +FL++     P   K M    F ++C   GAG+MAL+GKWA
Sbjct: 326 IYTGLVELLARDFLFN-----PHRTKDMKELSFNVLCTLFGAGIMALIGKWA 372

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG+ G RI +IF+I + S     FP+++ R     +P + +  AK+FGSGVIVATAF
Sbjct: 41  NEYNGNLGARISSIFVIFVVSTFFTLFPLISLRVKRFKIPLYAYLFAKYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL+DPA  A+ GNSC+G  G ++ Y W   I L SLF  FL ++ +  +V + +
Sbjct: 101 IHLVDPAYSAIGGNSCVGQTGDWSLYAWCPAIMLTSLFFTFLTDLFSSVWVERKY 155

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  157 bits (398), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/166 (46%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 264 EQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAET 323
           + +  Q  A  ILEFG+IFH            EEF TL+ VL+FHQ FEGLG+G R++  
Sbjct: 209 QSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATLYPVLVFHQSFEGLGIGARLSAI 268

Query: 324 NWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSGILIYT 383
            +P+SKR+ PW + +A+ +T+PI VAIG+GVR  ++ GS  AL+ +GV D+IS+GIL+YT
Sbjct: 269 EFPRSKRWWPWALCIAYGLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYT 328

Query: 384 GLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           GLVEL+A +F+++ Q      LK++         GAG+MAL+GKWA
Sbjct: 329 GLVELLARDFIFNPQRT--KNLKELSFNVICTLFGAGIMALIGKWA 372

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 74/115 (64%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG+ G RI ++F+IL  S     FP+++++   + +P + +  A++FGSGVIVATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKKLKIPLYAYLFARYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL+DPA  A+ GN+C+G  G +  Y W   I L SL + FL ++ +  +V K +
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYAWCPAIMLTSLTITFLTDLFSSVWVEKKY 155

>Skud_7.12 Chr7 (25081..26199) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score =  154 bits (389), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 112/169 (66%), Gaps = 8/169 (4%)

Query: 264 EQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAET 323
           + +  Q  A  ILEFG+IFH            EEF TL+ VL+FHQ FEGLG+G R++  
Sbjct: 209 QSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGEEFSTLYPVLVFHQSFEGLGIGARLSAI 268

Query: 324 NWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSGILIYT 383
            +P+SKR+ PW + +A+ +T+PI VAIG+GVR  +  GS  AL+ +G+ D+IS+GIL+YT
Sbjct: 269 EFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTRYNSGSYTALVVSGILDAISAGILLYT 328

Query: 384 GLVELMAHEFLYSNQFKGPGGLKKMLTAYF-IMC--MGAGLMALLGKWA 429
           GLVEL+A +F+++     P   K +    F ++C   GAG+MAL+GKWA
Sbjct: 329 GLVELLARDFIFN-----PDRTKNLKELSFNVLCTLFGAGIMALIGKWA 372

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 72/115 (62%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG+ G RI ++F+IL  S     FP+++ +   + +P + +  AK+FGSGVI+ATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISKKVKKLRIPLYAYLFAKYFGSGVILATAF 100

Query: 77  IHLLDPAAEAL-GNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL+DPA  A+ GN+C+G  G +  Y W   I L SL   FL ++ +  +V + +
Sbjct: 101 IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVWVERKY 155

>YGL255W Chr7 (20978..22108) [1131 bp, 376 aa] {ON}
           ZRT1High-affinity zinc transporter of the plasma
           membrane, responsible for the majority of zinc uptake;
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 376

 Score =  154 bits (389), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 2/166 (1%)

Query: 264 EQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAET 323
           + +  Q  A  ILEFG+IFH            +EF +L+ VL+FHQ FEGLG+G R++  
Sbjct: 213 QSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSLYPVLVFHQSFEGLGIGARLSAI 272

Query: 324 NWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSGILIYT 383
            +P+SKR+ PW + +A+ +T+PI VAIG+GVR  ++ GS  AL+ +GV D+IS+GIL+YT
Sbjct: 273 EFPRSKRWWPWALCVAYGLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYT 332

Query: 384 GLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           GLVEL+A +F+++ Q      L+++         GAG+MAL+GKWA
Sbjct: 333 GLVELLARDFIFNPQRTKD--LRELSFNVICTLFGAGIMALIGKWA 376

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 72/115 (62%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG+ G RI ++F+IL  S     FP+++++   + +P + +  AK+FGSGVIVATAF
Sbjct: 41  NEYNGNLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF 100

Query: 77  IHLLDPAAEAL-GNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL+DPA  A+ G +C+G  G +  Y W   I L SL   FL ++ +  +V + +
Sbjct: 101 IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKY 155

>ZYRO0F02200g Chr6 (178997..180142) [1146 bp, 381 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 381

 Score =  154 bits (388), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 121/184 (65%), Gaps = 5/184 (2%)

Query: 249 QDSSQIGTPVEEENKEQ---YLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVL 305
           +DS  +     ++  E+   + ++  A  +LEFG++FH            +EF TL+ VL
Sbjct: 200 KDSVDVSVRSSQDTLEKVISFKSEFSAFLVLEFGVLFHSVMIGLNLGTTGDEFSTLYPVL 259

Query: 306 IFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNA 365
           +FHQ FEGLG+G R++  ++P +KR+ P+++ +A+ +T+PIA+AIG+GVRKS+   S   
Sbjct: 260 VFHQAFEGLGIGARLSAIDFPHNKRWWPYVLCMAYGLTTPIAIAIGLGVRKSYQSNSYAV 319

Query: 366 LIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALL 425
            + +GV D+IS+GIL+YTGLVEL+A +FL++ Q      L++++   F +  G GLMALL
Sbjct: 320 NVVSGVLDAISAGILLYTGLVELLARDFLFNRQ--RAKTLRELIFNLFCLSWGVGLMALL 377

Query: 426 GKWA 429
           GKWA
Sbjct: 378 GKWA 381

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 75/115 (65%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG+ G RI +IF+IL++S     FP++A + S++ + ++ +  A+ FG+GVI+ATAF
Sbjct: 44  NEYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATAF 103

Query: 77  IHLLDPAAEALGN-SCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL+DPA + +G  SC+   G ++ Y W   I L +++  FL+++    YV + +
Sbjct: 104 IHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFTFLVDLFGGVYVERKY 158

>KLTH0C00374g Chr3 complement(32017..33147) [1131 bp, 376 aa] {ON}
           similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 376

 Score =  144 bits (364), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 115/194 (59%), Gaps = 7/194 (3%)

Query: 241 HFGHDDVHQDSSQ-----IGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXX 295
           + GH     D S+     +     E   + + +Q+ A  ILEFG+IFH            
Sbjct: 185 NLGHSADSDDKSKKSYDVVSNASTEIVTQSFESQIGAFLILEFGVIFHSVMIGLNLGTTD 244

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           +EF TL+ VL+FHQ FEGLG+G R++   +PK+K + P+ + +A+ +T+PI VAIG+GVR
Sbjct: 245 DEFSTLYPVLVFHQSFEGLGIGARLSAIEFPKNKWWWPYALCVAYGLTTPICVAIGLGVR 304

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIM 415
            ++   S    + +GV D+IS+GIL+YTGLVEL+A +F++         + K+L      
Sbjct: 305 TTYDGNSYTVNVVSGVLDAISAGILMYTGLVELLARDFIFDENRTND--ISKLLFMVNCT 362

Query: 416 CMGAGLMALLGKWA 429
             GAGLMALLGKWA
Sbjct: 363 LWGAGLMALLGKWA 376

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 77/115 (66%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N+Y+G  G RI +IF+IL  S     FP++A+R   + +P++ +  A++FG+GVIVATAF
Sbjct: 40  NSYSGSLGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAF 99

Query: 77  IHLLDPAAEALG-NSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHLLDPA   +G  SC+G  G +++Y +   I L ++F +F++++ +  YV + F
Sbjct: 100 IHLLDPAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRF 154

>TDEL0D06550 Chr4 (1177932..1179077) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  144 bits (362), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 123/198 (62%), Gaps = 14/198 (7%)

Query: 240 DHFGHDDVHQDSSQIGTPVEEENKE-----QYLNQMMAVFILEFGIIFHXXXXXXXXXXX 294
           DH  H +  +D   I T  + +         + ++  A  ILEFG++FH           
Sbjct: 190 DHDHHSNT-KDKKSIDTFTDSDVDSTTADMSFKSEFAAFLILEFGVLFHSVMIGLNLGSV 248

Query: 295 XEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGV 354
            EEF TL+ VL+FHQ FEGLG+G R++  ++P++KR+ P+ + LA+ +T+PI VAIG+GV
Sbjct: 249 GEEFSTLYPVLVFHQSFEGLGIGARLSAIDFPQNKRWWPYALCLAYGLTTPICVAIGLGV 308

Query: 355 RKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQFKGPGGLKKM-LTAYF 413
           R ++   S    + +GV D+IS+G+LIYTGLVE++A ++L++     P   K + L ++ 
Sbjct: 309 RTTYNGESYVVNVVSGVLDAISAGVLIYTGLVEMLARDYLFN-----PHRTKDLRLLSFN 363

Query: 414 IMCM--GAGLMALLGKWA 429
           +M M  GAGLMALLGKWA
Sbjct: 364 VMSMLWGAGLMALLGKWA 381

 Score = 97.1 bits (240), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 74/115 (64%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           N YNG  G RI +IF+IL+ S     +P++A R  ++ + +W +  A+ FG GVI+ATAF
Sbjct: 41  NEYNGWMGARISSIFVILVLSTCCTLYPVVAKRVKWLKINKWFYSFARNFGIGVIIATAF 100

Query: 77  IHLLDPA-AEALGNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHLLDPA AE  G SC+G  G ++ Y W   I L+++F+ FL ++ +  YV K +
Sbjct: 101 IHLLDPAYAEIGGLSCVGMTGNWSIYAWCPAIMLLTIFLTFLTDLFSAVYVEKKY 155

>KLTH0A07722g Chr1 (650427..651605) [1179 bp, 392 aa] {ON} similar
           to uniprot|P32804 Saccharomyces cerevisiae YGL255W ZRT1
           High-affinity zinc transporter of the plasma membrane
           responsible for the majority of zinc uptake
           transcription is induced under low-zinc conditions by
           the Zap1p transcription factor
          Length = 392

 Score =  140 bits (352), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 121/197 (61%), Gaps = 15/197 (7%)

Query: 236 VPGKDHFGHDDVHQDSSQIGTPVEEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXX 295
           +  KD   +D V   +S+I         + + +Q+ A  ++EFGIIFH            
Sbjct: 208 ISNKDDVSYDVVSGVNSEIAV-------KPFESQIGAFLVMEFGIIFHSVMIGLELGTTG 260

Query: 296 EEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVR 355
           EEF  L+ V++FHQ FEGLG+G R+    +P+ K++ P+ + + +  T+PIA+AIG+GVR
Sbjct: 261 EEFSILYPVIVFHQSFEGLGIGARLISIAFPEGKKWWPYALCILYGATTPIAIAIGLGVR 320

Query: 356 KSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYS-NQFKGPGGLKKMLTAYFI 414
            S+   S    I +GV D+I++GILIYTGLVEL+A +F++  N+ K    LKK+   + I
Sbjct: 321 MSYNAHSFKMSIISGVLDAIAAGILIYTGLVELLARDFMFDPNRTK---NLKKL--TFMI 375

Query: 415 MCM--GAGLMALLGKWA 429
           +C   GAGLMALLG+WA
Sbjct: 376 ICTFSGAGLMALLGRWA 392

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 74/113 (65%), Gaps = 3/113 (2%)

Query: 19  YNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIH 78
           Y G    RI +IF+IL  S      P++ ++   I +P+ C+  A++FG+GVI+ATAFIH
Sbjct: 63  YQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKACYLFARYFGTGVIIATAFIH 122

Query: 79  LLDPAAEALG-NSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           L++ +  ++G NSC+G  G + +Y W  GI L ++F++FL+++++  Y+ + F
Sbjct: 123 LMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVVFLVDLLSEVYIERKF 175

>Kwal_23.6522 s23 (1624044..1625213) [1170 bp, 389 aa] {ON} YGL255W
           (ZRT1) - high-affinity zinc transport protein [contig
           18] FULL
          Length = 389

 Score =  139 bits (349), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 116/203 (57%), Gaps = 22/203 (10%)

Query: 246 DVHQDSSQIGTPVEEENK------------------EQYLNQMMAVFILEFGIIFHXXXX 287
           DVH+D + +     E  K                  + + +Q+ A F+LEFGIIFH    
Sbjct: 190 DVHKDENDVECASGEMTKSDDASFDTLFCASSGSSIKSFESQIGAFFVLEFGIIFHSVMI 249

Query: 288 XXXXXXXXEEFETLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIA 347
                    EF  L+ V++FHQ FEGLGLG R+    +P+ K++ P+ +   + IT+PIA
Sbjct: 250 GLELGTTGSEFSVLYPVIVFHQSFEGLGLGARLMSIKFPEGKKWWPYALCGLYGITTPIA 309

Query: 348 VAIGIGVRKSWIPGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYS-NQFKGPGGLK 406
           VAIG+GVR ++   S    I +G+ D+IS+GILIYTGLVEL+A +F+++ N+ K    L 
Sbjct: 310 VAIGLGVRLTYNAHSFTMSIISGILDAISAGILIYTGLVELLAKDFIFNPNRTKDMTKLS 369

Query: 407 KMLTAYFIMCMGAGLMALLGKWA 429
            M+   F    GAGLMA LGKWA
Sbjct: 370 LMI---FATLSGAGLMAFLGKWA 389

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 75/115 (65%), Gaps = 3/115 (2%)

Query: 17  NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAF 76
           + Y G    RI +IF++L  S      PI+ ++   + +P +C+  A++FG+GVIV+TAF
Sbjct: 60  SEYQGSLPARISSIFVLLFVSTSFTLLPIVLNKIKGVKVPRYCYLFARYFGTGVIVSTAF 119

Query: 77  IHLLDPAAEALG-NSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           IHL++ +  ++G NSC+G  G + +Y W   I ++++F++FL+++++  Y+ + +
Sbjct: 120 IHLMEHSYMSIGSNSCVGMTGHWADYTWCSCIVMVTVFVIFLVDLLSDVYIERKY 174

>ZYRO0D17732g Chr4 complement(1471224..1472423) [1200 bp, 399 aa]
           {ON} similar to uniprot|P32804 Saccharomyces cerevisiae
           YGL255W ZRT1 High-affinity zinc transporter of the
           plasma membrane responsible for the majority of zinc
           uptake transcription is induced under low-zinc
           conditions by the Zap1p transcription factor
          Length = 399

 Score =  132 bits (332), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 70/171 (40%), Positives = 110/171 (64%), Gaps = 2/171 (1%)

Query: 259 EEENKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFETLFIVLIFHQMFEGLGLGT 318
           E++ + ++   + A  +LE G++FH            +EF TL+ VL+FHQ FEGLG+G 
Sbjct: 231 EQDVERRFRADLGAFMVLEAGLLFHSVMIGLNLGTIGDEFSTLYAVLVFHQSFEGLGIGA 290

Query: 319 RVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWIPGSRNALIANGVFDSISSG 378
           R+    +P+ K + P+ + LA+ +T+PI VAIG+GVRKS+   S +  + +G+ DSIS+G
Sbjct: 291 RLCAITFPRDKWWWPYALCLAYGLTTPICVAIGLGVRKSYSSNSYSVNVVSGILDSISAG 350

Query: 379 ILIYTGLVELMAHEFLYSNQFKGPGGLKKMLTAYFIMCMGAGLMALLGKWA 429
           IL+YTGLVEL+A +++++        L+++      +  GAGLMALLGKWA
Sbjct: 351 ILMYTGLVELLARDYMFNAHRT--KDLRELFFNVASILTGAGLMALLGKWA 399

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 70/112 (62%), Gaps = 3/112 (2%)

Query: 20  NGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHL 79
           NG  G RI +IF+I I+S     FP++A +  ++ +  + +  A+ FG+GVIV+T++IHL
Sbjct: 45  NGVTGARISSIFVIFITSTALSLFPVVAQKVPWLRIHRYVYQFARSFGTGVIVSTSYIHL 104

Query: 80  LDPAAEALGN-SCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHYYVAKSF 128
           +DPA + +G  SC+   G ++ Y W   I L ++F  FL+++ +  YV + +
Sbjct: 105 MDPAYQEIGGYSCIAQTGNWSIYSWCPAIMLTTVFATFLVDLFSAVYVERKY 156

>Kwal_14.824 s14 complement(65415..66539) [1125 bp, 374 aa] {ON}
           YGL255W (ZRT1) - high-affinity zinc transport protein
           [contig 245] FULL
          Length = 374

 Score =  126 bits (316), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 65/159 (40%), Positives = 95/159 (59%), Gaps = 1/159 (0%)

Query: 241 HFGHDDVHQDSSQIGTPVEEE-NKEQYLNQMMAVFILEFGIIFHXXXXXXXXXXXXEEFE 299
           H   DD  + S  + +    E   E + +Q  A  ILEFG+IFH            +EF 
Sbjct: 187 HADSDDKSKKSYDVISDASSEIATESFESQFAAFLILEFGVIFHSVMIGLNLGTVGDEFS 246

Query: 300 TLFIVLIFHQMFEGLGLGTRVAETNWPKSKRYTPWLMGLAFTITSPIAVAIGIGVRKSWI 359
            L+ VL+FHQ FEGLG+G R++   +PK K + P+ + + + + +PI VAIG+GVR S+ 
Sbjct: 247 VLYPVLVFHQSFEGLGIGARLSSIAFPKGKAWWPYALCITYGLATPICVAIGLGVRTSYN 306

Query: 360 PGSRNALIANGVFDSISSGILIYTGLVELMAHEFLYSNQ 398
             S    I +GV D+IS+GILIYTGLVEL+A +F++  +
Sbjct: 307 GNSFTVNIVSGVLDAISAGILIYTGLVELLARDFIFDEK 345

 Score =  107 bits (268), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 89/158 (56%), Gaps = 12/158 (7%)

Query: 12  TCEVS------NTYNGHAGLRILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKF 65
           TC ++      N YNG  G RI +IF+I   S L   FP++A+R   I +P++ +  A++
Sbjct: 29  TCTIAGVYFGENEYNGSMGARISSIFVIFFVSTLFTLFPVVAARVKSIRIPKYVYLFARY 88

Query: 66  FGSGVIVATAFIHLLDPA-AEALGNSCLG--GTFTEYPWAFGICLMSLFMLFLMEIVTHY 122
           FG+GVIVATAFIHLLDPA  E  G+SC+G  G + +Y W   I L+++F++FL+++ +  
Sbjct: 89  FGTGVIVATAFIHLLDPAYGEIGGDSCVGKTGHWADYSWCPAIVLLTIFIIFLVDLASDV 148

Query: 123 YVAKSFXXXXXXXXXXXXXXXXITSFEADGFTDLERQN 160
           YV + F                +   + D   DLE  N
Sbjct: 149 YVKRRF---GVAHNHGDVIEDAVVKRQGDAHEDLESHN 183

>NDAI0G03980 Chr7 complement(947806..949518) [1713 bp, 570 aa] {ON}
           Anc_3.50
          Length = 570

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 28  LAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEAL 87
           +AIF+ L+   LG    +  SR   +HLP+W  ++  FF    I+AT         AE +
Sbjct: 118 IAIFLQLLCIKLGTVTGLDLSRACRMHLPKWMNYIIYFFAECAIIATDI-------AEVI 170

Query: 88  GNSCLGGTFTEYPWAFGICL 107
           G +       + P   G+ +
Sbjct: 171 GTAIALNILIKVPLPAGVAI 190

>CAGL0E01969g Chr5 complement(195338..196978) [1641 bp, 546 aa] {ON}
           highly similar to uniprot|P38925 Saccharomyces
           cerevisiae YOL122c SMF1 manganese transporter
          Length = 546

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%), Gaps = 7/89 (7%)

Query: 28  LAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEAL 87
           +AIF+  +   LG    +  SR    HLP W  +   FF    I+AT         AE +
Sbjct: 111 IAIFLQCLCIKLGSVTGMDLSRACRKHLPRWANWTVYFFAECAIIAT-------DVAEVI 163

Query: 88  GNSCLGGTFTEYPWAFGICLMSLFMLFLM 116
           G +       + P   G+C+  + +L +M
Sbjct: 164 GTAIALNILIKVPLPAGVCITLVDVLAIM 192

>Kwal_55.21955 s55 (1054213..1055778) [1566 bp, 521 aa] {ON} YOL122C
           (SMF1) - has been localized to both the plasma membrane
           and the mitochondrial membrane [contig 124] FULL
          Length = 521

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 7/90 (7%)

Query: 27  ILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEA 86
           I+AIF+  +   LG    +  SR    +LP W  ++  FF    I+AT         AE 
Sbjct: 86  IIAIFLQSLCIKLGTVTGLDLSRACRKYLPPWLNYILYFFAEVAIIAT-------DVAEV 138

Query: 87  LGNSCLGGTFTEYPWAFGICLMSLFMLFLM 116
           +G++       + P A G+ +  + +LF+M
Sbjct: 139 IGSAVALNILIKVPLAAGVAITVVDVLFVM 168

>KLTH0F18744g Chr6 (1519346..1520896) [1551 bp, 516 aa] {ON} similar
           to uniprot|P38925 Saccharomyces cerevisiae YOL122C SMF1
           Divalent metal ion transporter
          Length = 516

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 7/90 (7%)

Query: 27  ILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEA 86
           I+AIF+  +   LG    +  SR    +LP W  +   FF    I+AT         AE 
Sbjct: 78  IIAIFLQSLCIKLGTVTGLDLSRACRKYLPRWMNWTLYFFAEAAIIAT-------DVAEV 130

Query: 87  LGNSCLGGTFTEYPWAFGICLMSLFMLFLM 116
           +G++       + P A G+ +  + +LF+M
Sbjct: 131 IGSAVALNILIKVPLAAGVAITVVDVLFVM 160

>KAFR0C01670 Chr3 (340899..342518) [1620 bp, 539 aa] {ON} Anc_3.50
           YOL122C
          Length = 539

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 47/122 (38%), Gaps = 18/122 (14%)

Query: 10  VDTCEVSNTYNGHAGLRILAIFIILISSGLGVFFPIMA-----------SRYSFIHLPEW 58
           +D    S + N  A  +   + IILIS+ + +F   +            SR    HLP W
Sbjct: 67  IDPGNYSTSINAGATNQYSLLCIILISNVIAIFLQCLCIKLGSVTGMDLSRNCKKHLPTW 126

Query: 59  CFFLAKFFGSGVIVATAFIHLLDPAAEALGNSCLGGTFTEYPWAFGICLMSLFMLFLMEI 118
              +  FF    I+AT         AE +G +       + P   G+ L  + +L +M  
Sbjct: 127 LNLILYFFAECAIIATDL-------AEVIGTAIALNILIKVPLPAGVVLTVIDVLTVMAA 179

Query: 119 VT 120
            T
Sbjct: 180 YT 181

>KLLA0A03740g Chr1 complement(335548..337287) [1740 bp, 579 aa] {ON}
           similar to uniprot|P38925 Saccharomyces cerevisiae
           YOL122C SMF1 Divalent metal ion transporter
          Length = 579

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 7/90 (7%)

Query: 27  ILAIFIILISSGLGVFFPIMASRYSFIHLPEWCFFLAKFFGSGVIVATAFIHLLDPAAEA 86
           I+AIF+  +   LG    +  SR    HLP+W       F    I+AT         AE 
Sbjct: 132 IIAIFLQSLCIKLGSVTGLDLSRACKKHLPKWLNLTIYVFAECAIIAT-------DVAEV 184

Query: 87  LGNSCLGGTFTEYPWAFGICLMSLFMLFLM 116
           +G +         P   G+ +  + +LF++
Sbjct: 185 IGTAVALNILLRIPLPAGVVITCIDVLFVL 214

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,176,171
Number of extensions: 1265870
Number of successful extensions: 3343
Number of sequences better than 10.0: 45
Number of HSP's gapped: 3370
Number of HSP's successfully gapped: 82
Length of query: 429
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 317
Effective length of database: 40,638,807
Effective search space: 12882501819
Effective search space used: 12882501819
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 67 (30.4 bits)