Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C004708.829ON42642621350.0
NDAI0K004708.829ON38638615210.0
Smik_13.4858.829ON38438414380.0
YMR272C (SCS7)8.829ON38438414340.0
Skud_13.4448.829ON38438414250.0
SAKL0D01760g8.829ON38137914100.0
CAGL0F03399g8.829ON38038213950.0
TDEL0B006808.829ON38338413800.0
Suva_13.4608.829ON38438413450.0
KLLA0D01639g8.829ON38138313370.0
ZYRO0G13948g8.829ON38438212981e-178
Kpol_541.98.829ON37438012961e-178
KNAG0J003208.829ON37338012951e-178
Kwal_27.103328.829ON37837812761e-175
KAFR0B038508.829ON37737912731e-175
KLTH0C04114g8.829ON37837812541e-172
TBLA0D031808.829ON40039712491e-171
Ecym_27128.829ON38138112291e-168
AAL183W8.829ON37737812201e-166
TPHA0C047108.829ON37737911631e-158
Kpol_1069.48.829ON2772768731e-115
ZYRO0B09812g2.166ON183621571e-11
TDEL0F012102.166ON126561531e-11
Kpol_505.142.166ON123571512e-11
TBLA0B013102.166ON123571485e-11
CAGL0L03828g2.166ON121521477e-11
NCAS0G025702.166ON121571432e-10
NDAI0F027302.166ON121571414e-10
Skud_14.2212.166ON120571406e-10
Kwal_47.18167na 1ON227671458e-10
Suva_14.2282.166ON120571362e-09
NDAI0D047104.304ON616611437e-09
Smik_14.2162.166ON120571318e-09
KAFR0B045502.166ON126571328e-09
KLTH0D09284g2.166ON123571292e-08
KNAG0I020402.166ON119521292e-08
KLTH0A04026gna 1ON233561352e-08
KLLA0F27577gna 1ON172561322e-08
YNL111C (CYB5)2.166ON120571282e-08
Kwal_26.84612.166ON123571283e-08
SAKL0E10626g2.166ON123571256e-08
TPHA0F017902.166ON182571287e-08
NCAS0A02770na 2ON609691349e-08
KLTH0C11770gsingletonON618801341e-07
AFL223W2.166ON165831251e-07
ZYRO0B13728g4.304ON598711321e-07
KAFR0I005204.304ON586611312e-07
TPHA0B018204.304ON576571293e-07
Kpol_1014.54.304ON596571284e-07
TDEL0H02180na 1ON203701225e-07
ADL085Cna 1ON273531239e-07
KNAG0E038604.304ON604541241e-06
Ecym_54202.166ON145501152e-06
NDAI0D04700na 2ON625651232e-06
CAGL0K10736g4.304ON593521222e-06
SAKL0F08316gna 1ON178541153e-06
YML054C (CYB2)4.304ON591521213e-06
KLTH0D06930g2.536ON204531164e-06
Smik_13.924.304ON591521204e-06
Ecym_4346na 1ON209501164e-06
KLLA0B14795gna 3ON556471196e-06
Suva_13.1054.304ON591521196e-06
KLLA0F23672g2.166ON123571106e-06
Skud_13.924.304ON591521171e-05
KLLA0D02640g4.304ON589971161e-05
SAKL0G16852g4.304ON580471161e-05
TDEL0D011404.304ON584481161e-05
CAGL0K03069g2.536ON194491093e-05
NCAS0A027804.304ON602481124e-05
TDEL0D00190singletonON552511098e-05
ZYRO0D16654gna 1ON190551059e-05
Kwal_14.807singletonON578541081e-04
Kwal_23.2823na 3ON560471081e-04
KLTH0C11858gsingletonON555461071e-04
SAKL0F16610gsingletonON564481072e-04
ZYRO0C18524gsingletonON554461034e-04
Kwal_26.80462.536ON19853995e-04
Kpol_348.122.536ON21753940.003
TPHA0G035502.536ON21853920.005
CAGL0I00418g6.106ON490107920.010
NDAI0H013702.536ON22456880.014
NCAS0F008702.536ON18948860.023
SAKL0A09570g2.536ON211101860.029
ZYRO0B02090g2.536ON19454850.032
Suva_13.2502.536ON20148850.033
Skud_13.2292.536ON20148850.038
Smik_13.2522.536ON20143810.12
KLLA0C05566g6.106ON477106810.19
Ecym_2214na 4ON531132800.26
TBLA0I015302.536ON22148780.33
YMR073C (IRC21)2.536ON20143760.55
Kpol_1072.198.668ON896124780.55
AAR153C6.106ON478105770.62
KAFR0A047406.106ON483106770.69
KAFR0A018902.536ON16159730.75
Skud_7.2266.106ON509105760.79
KLLA0E18459g2.536ON14842730.86
KLLA0E19471gna 4ON57348760.96
Suva_7.2166.106ON470104741.4
KLTH0H04488gna 4ON57438732.1
TDEL0A031102.536ON20053702.4
SAKL0A07326g6.106ON480105722.7
TPHA0B027006.106ON488105712.9
Kpol_478.176.106ON48454704.3
SAKL0A04774gna 4ON56852704.5
AFL079Wna 4ON53854696.1
KLTH0H06798g6.106ON488105687.1
TPHA0K018804.64ON84957688.1
KNAG0J012703.186ON54723679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00470
         (426 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      827   0.0  
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   590   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   558   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   556   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   553   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   547   0.0  
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   541   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   536   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   522   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   519   0.0  
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   504   e-178
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   503   e-178
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   503   e-178
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   496   e-175
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   494   e-175
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   487   e-172
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   485   e-171
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   478   e-168
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   474   e-166
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   452   e-158
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   340   e-115
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    65   1e-11
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    64   1e-11
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    63   2e-11
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    62   5e-11
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    61   7e-11
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    60   2e-10
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      59   4e-10
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    59   6e-10
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    60   8e-10
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    57   2e-09
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    60   7e-09
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    55   8e-09
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    55   8e-09
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    54   2e-08
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    54   2e-08
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    57   2e-08
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    55   2e-08
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    54   2e-08
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    54   3e-08
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    53   6e-08
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    54   7e-08
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               56   9e-08
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    56   1e-07
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    53   1e-07
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    55   1e-07
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    55   2e-07
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    54   3e-07
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    54   4e-07
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                52   5e-07
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    52   9e-07
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    52   1e-06
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    49   2e-06
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             52   2e-06
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    52   2e-06
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    49   3e-06
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    51   3e-06
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    49   4e-06
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    51   4e-06
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    49   4e-06
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    50   6e-06
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    50   6e-06
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    47   6e-06
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    50   1e-05
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    49   1e-05
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    49   1e-05
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    49   1e-05
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    47   3e-05
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     48   4e-05
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 47   8e-05
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    45   9e-05
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    46   1e-04
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    46   1e-04
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    46   1e-04
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    46   2e-04
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    44   4e-04
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    43   5e-04
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    41   0.003
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    40   0.005
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    40   0.010
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      39   0.014
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    38   0.023
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    38   0.029
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    37   0.032
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    37   0.033
Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {O...    37   0.038
Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {O...    36   0.12 
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    36   0.19 
Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar t...    35   0.26 
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    35   0.33 
YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}  ...    34   0.55 
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    35   0.55 
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    34   0.62 
KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.1...    34   0.69 
KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON...    33   0.75 
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    34   0.79 
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    33   0.86 
KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]...    34   0.96 
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    33   1.4  
KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON} conser...    33   2.1  
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    32   2.4  
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    32   2.7  
TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.1...    32   2.9  
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    32   4.3  
SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON} unipro...    32   4.5  
AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; N...    31   6.1  
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    31   7.1  
TPHA0K01880 Chr11 (393869..396418) [2550 bp, 849 aa] {ON} Anc_4....    31   8.1  
KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3....    30   9.0  

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/426 (94%), Positives = 402/426 (94%)

Query: 1   MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK 60
           MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK
Sbjct: 1   MAFTYVWINEKVIIYIMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSK 60

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKIXXXXX 120
           DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKI     
Sbjct: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKIDQQTD 120

Query: 121 XXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY 180
                  IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY
Sbjct: 121 LLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDY 180

Query: 181 EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW 240
           EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW
Sbjct: 181 EKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKTAW 240

Query: 241 YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN 300
           YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN
Sbjct: 241 YLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPEHN 300

Query: 301 FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG 360
           FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG
Sbjct: 301 FAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGMFG 360

Query: 361 YICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWDKKFGTYLSPDSPL 420
           YICYDLCHYFLHHSKLPPFMR            NYQLGYGVTSWYWDKKFGTYLSPDSPL
Sbjct: 361 YICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWDKKFGTYLSPDSPL 420

Query: 421 SKMKYQ 426
           SKMKYQ
Sbjct: 421 SKMKYQ 426

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/386 (74%), Positives = 321/386 (83%), Gaps = 6/386 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHP-DGDKSIL-KHAGK 104
           MS N SKTLELFSKD+VA HNT +DCW+T  DRKIYDV+KFL D+P D +K +L + AGK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 105 DITELLKDE----KIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFD 160
           DIT+ LKD+    K             IGY+ATD EE+ LLTNKDHKVEV+LNE+TN FD
Sbjct: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120

Query: 161 STTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHY 220
           STTFVKDLPTEDKLSIATD +KDL+KH FLDL+KPLLKQILFGNFTKDFYLDQIHRPRHY
Sbjct: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180

Query: 221 GQESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTF 280
           G +SAPLFGN LEP TKT+WYLVPI WLPVVFYHIA+A  N+N +FAI+LF IG+YVWT 
Sbjct: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240

Query: 281 IEYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKL 340
           IEYCMHRFLFHFDERLPEHN  Y+IHFLLHGCHHYLPMDKYRLVVPP LFIFLC PFYK+
Sbjct: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300

Query: 341 VFALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYG 400
           VF LLP YWA AGFAGG+FGY+CYDLCHYFLHHSK+PP +R            NYQLGYG
Sbjct: 301 VFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYG 360

Query: 401 VTSWYWDKKFGTYLSPDSPLSKMKYQ 426
           VTSWYWDK FGTYLSPDSP+SKMKY+
Sbjct: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/384 (69%), Positives = 304/384 (79%), Gaps = 4/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+N SKTLELFSK  V KHNT +DCWVT  +RKIYDV+KFL +HP GD+SIL +AGKDI
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDI 60

Query: 107 TELLKD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           TE++KD    E              IGY+ATD E  +LLTNK+HKVEV+L+     FDST
Sbjct: 61  TEVMKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDST 120

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
           TFVKDLP E+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 121 TFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGK 180

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP TKTAW++VP AWLPVV YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLP YWA AGFAGG+FGY+CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426
           SW+WD+ FGTYL PD+PLSKMKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/384 (67%), Positives = 304/384 (79%), Gaps = 4/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+N SKTLELFSK  V +HNT  DCWVT  +RKIYDV++FL +HP GD+SIL +AGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 107 TELLKDEKIXXXXXXXXXXXX----IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           TE++KD  +                IGY+ATD E  +LLTNK+HKVEV+L+     FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
           TFVK+LP E+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP TKTAW++VP+AWLPVV YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLP YWA AGFAGG+FGY+CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426
           SW+WD+ FGTYL PD+PLSKMKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/384 (67%), Positives = 304/384 (79%), Gaps = 4/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+N SKTLELFS+  V +HNT +DCWVT  +RKIYDV+KFL +HP GD+SIL +AGKD+
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 107 TELLKDEKIXXXXXXXXXXXX----IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           TE++KD  +                IGY+ATD E  +LLTNK HKVEV+L+     FDST
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
           TFVK+LPTE+KLSIATDY  D KKH FLDLN+PLL QIL  +F KDFY+DQIHRPRHYG+
Sbjct: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP TKTAW++VP+ WLPVV YH+ +A KN+N LFA  LFC+GV+VWT IE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMDKYRLV+PP LF+ LCAPFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLP YWA AGFAGG+FGY+CYD CH+FLHHSKLPPFMR            NYQLG+GVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426
           SW+WD+ FGTYL PD+PLSKMKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/379 (67%), Positives = 303/379 (79%), Gaps = 5/379 (1%)

Query: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           SKTL L SK Q+++HNT+EDCWV++Y+RK+Y+V+ FL +HP GD+ IL HAG+DITE++K
Sbjct: 4   SKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEIMK 63

Query: 112 D----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167
           D    E              +GY+A + EE+KLLTN+DH VEVKLNEST  FDSTTFVK+
Sbjct: 64  DKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQ-FDSTTFVKE 122

Query: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227
           LPTEDKLSIATDY  D KKH FLDL+KPLL Q++FGNFTKDFYLDQ+HRPRHYG+ SAPL
Sbjct: 123 LPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPL 182

Query: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287
           FGNFLEP +KT WY +PIAWLPVVFYH+ +A  N+N  FA+ LF +GV+VWT IEYC+HR
Sbjct: 183 FGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHR 242

Query: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347
           FLFH D+ LPE   A+ +HFLLHG HHYLPMD+YRLV+PP LF+ LC PFYKLVF+LLPY
Sbjct: 243 FLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPY 302

Query: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWD 407
           YWACAGFAGGM GY CYDL HYFLHH+KLPP+MR            NY+LG+GVTSW+WD
Sbjct: 303 YWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWD 362

Query: 408 KKFGTYLSPDSPLSKMKYQ 426
           K FGTYL  D+PLSKMKY+
Sbjct: 363 KVFGTYLGSDAPLSKMKYE 381

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/382 (68%), Positives = 302/382 (79%), Gaps = 4/382 (1%)

Query: 46  QMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHA-GK 104
            ++++ SKTLELF +  +AKHN+++DCWV+ ++RKIYDVSK+L DHP+   ++ K   GK
Sbjct: 2   SVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGK 61

Query: 105 DITELLKDEKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTF 164
             T++ + E              +GY+AT  EE+KLLTNK HKVEVKLN + NTFDSTTF
Sbjct: 62  HGTDISQME--LTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLN-ADNTFDSTTF 118

Query: 165 VKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQES 224
           VKDLPTEDKLSI TDYE+D KKH FLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG+ S
Sbjct: 119 VKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGS 178

Query: 225 APLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYC 284
           APLFGNFLE FTKTAW++VP  W PVV Y I  A  N+N   A+ LF +G++VWT IEYC
Sbjct: 179 APLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYC 238

Query: 285 MHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFAL 344
           +HRFLFHFDE LPEH+  +MIHFLLHGCHHYLPMD YRLVVPP LF+ LCAP YKLVFA 
Sbjct: 239 LHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAA 298

Query: 345 LPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSW 404
           LPYYWACAGFAGGM GYICYDLCHYFLHHSK+PPFMR            NYQLG+GVTSW
Sbjct: 299 LPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSW 358

Query: 405 YWDKKFGTYLSPDSPLSKMKYQ 426
           +WDK FGTYL PD+PLSKMKY+
Sbjct: 359 FWDKVFGTYLGPDAPLSKMKYE 380

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 300/384 (78%), Gaps = 7/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS + SKTLELFS+ QV++HN   DCWVTV +RKIYDV+KFL +HP G + IL +AGKDI
Sbjct: 1   MSQDQSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDI 60

Query: 107 TELLKDEKIXXXXXXXX-----XXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDS 161
           TE+LKD  I                 +GYMAT+ EE++LLTN  HKVEVKL  +T  FDS
Sbjct: 61  TEVLKDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKL--ATLDFDS 118

Query: 162 TTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYG 221
           TTFVKDLPTE+KLSIATDY +D K+H+FLDL KPLL Q++FG FTKDFY+DQIHRPRHYG
Sbjct: 119 TTFVKDLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYG 178

Query: 222 QESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFI 281
           + SAPLFGNFLEP +KT+WY++P+ WLPVV YH+ +AFKN+N +F I  FC+G +VWT I
Sbjct: 179 KGSAPLFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLI 238

Query: 282 EYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLV 341
           EY +HRFLFHFD+ LPE N  + +HFLLHG HHYLPMDKYRLV+PP LF+ LC PFYKLV
Sbjct: 239 EYGLHRFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLV 298

Query: 342 FALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGV 401
           F LLP Y A AGFAGG+FGY+CYDL HYFLHHSKLP FMR            NYQLG+GV
Sbjct: 299 FGLLPLYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGV 358

Query: 402 TSWYWDKKFGTYLSPDSPLSKMKY 425
           TSW+WDK FGTYLSP SP+S+MKY
Sbjct: 359 TSWFWDKVFGTYLSPTSPISQMKY 382

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/384 (67%), Positives = 304/384 (79%), Gaps = 4/384 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+N SKTLELFSK  V +HNT +DCWVT  +RKIYDV+KFL +HP G++SIL +AGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 107 TELLKDEKIXXXXXXXXXXXX----IGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           TE++KD  +                +GY+ATD E  +LLTNK+HKVEV+L+     FDST
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDST 120

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
           TFVKDLPTE+KLSIATDY  D KKH FLDLNKPLL QIL  +FT+DFY+DQIHRPRHYG+
Sbjct: 121 TFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGK 180

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP TKTAW++VP+AW+PVV YH+ +A KN+N LFA  LF +G++VWT IE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIE 240

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFHFD+ LPE N A+  HFLLHGCHHYLPMD YRLV+PP LF+ LCAPFYKLVF
Sbjct: 241 YSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVF 300

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLP YWA AGFAGG+FGY+CYD CHYF+HHSKLPPFMR            NYQLG+GVT
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 403 SWYWDKKFGTYLSPDSPLSKMKYQ 426
           SW+WD  FGTYL PD+PLSKMKY+
Sbjct: 361 SWFWDDVFGTYLGPDAPLSKMKYE 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/383 (64%), Positives = 295/383 (77%), Gaps = 7/383 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MSS  S+ L L+SK  + KHN + DCWV++Y RKIY+V++FL +HP G + IL +AG DI
Sbjct: 1   MSS--SRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDI 58

Query: 107 TELLKD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDST 162
           T+++KD    E              +GY+AT+ EE+KLLTNKDH VEV L +  N FDST
Sbjct: 59  TDVMKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNL-KGNNEFDST 117

Query: 163 TFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQ 222
            FVK+LPTEDKLSIATDY+ D KKH FLDLNKPLL Q+LFG FTKDFYLDQ+HRPRHYG+
Sbjct: 118 VFVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGK 177

Query: 223 ESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIE 282
            SAPLFGNFLEP +KT W++VP+ WLPVV YHI  A  N+N  FAI LF +GV+VWT IE
Sbjct: 178 GSAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIE 237

Query: 283 YCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVF 342
           Y +HRFLFH D+RLPE  +A+ +HFLLHG HHYLPMD++RLV+PP LF+ LC PFYKLVF
Sbjct: 238 YGLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVF 297

Query: 343 ALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVT 402
           ALLPYYWACAGFAGGM GY+CYDL HYFLHHS+LPP+MR            NY+LG+GVT
Sbjct: 298 ALLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVT 357

Query: 403 SWYWDKKFGTYLSPDSPLSKMKY 425
           SW+WDK FGTYL  ++PLS MKY
Sbjct: 358 SWFWDKVFGTYLGENAPLSNMKY 380

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  504 bits (1298), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 291/382 (76%), Gaps = 5/382 (1%)

Query: 49  SNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           S  S TL+LFS++Q++KHN E+DCWV+VY RKIY+V++FL +HP G + ILK+AG+DITE
Sbjct: 2   STKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDITE 61

Query: 109 LLKDEKIXXXXXXXXXXX----XIGYMATDAEEEKLLTNKDHKVEVKLNESTNT-FDSTT 163
           +LKD  +                +GY+AT  E  KLLTNK H+VEV L +  N+ FDSTT
Sbjct: 62  VLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDSTT 121

Query: 164 FVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQE 223
           FV +LP E+KL+IATDY +D KKH FLDLN+ LL Q++FGNF+KDFYLDQ+HRPRHYG+ 
Sbjct: 122 FVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKG 181

Query: 224 SAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEY 283
           SAPLFGNFLEP +KT W+ +PI W+PVV +H  + F N+N LF+  LFC+G++VWT IEY
Sbjct: 182 SAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEY 241

Query: 284 CMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFA 343
           C+HRFLFH DE LP++N A  +HFLLHG HHYLPMD+YRLV+PP L I L AP YK VF 
Sbjct: 242 CLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFG 301

Query: 344 LLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTS 403
           LLP YWA +GFAGG+FGY+CYDL HYFLHH+KLP +MR            NYQLG+GVTS
Sbjct: 302 LLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTS 361

Query: 404 WYWDKKFGTYLSPDSPLSKMKY 425
           W+WD  FGTYL PD+PL+ MKY
Sbjct: 362 WFWDNVFGTYLGPDAPLAHMKY 383

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  503 bits (1296), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 290/380 (76%), Gaps = 6/380 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MS+  SKTLELF+K +  +HNTE DCWV+V +R IYDVS +L D+ D D SIL+HAGKDI
Sbjct: 1   MSAKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDI 60

Query: 107 TELLKDEKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166
           T+L K  +             +GY+AT+ EE +LLTNKDHKVEV L + T  +DST FVK
Sbjct: 61  TKLTKTREFKFISDEYL----VGYLATEEEEVRLLTNKDHKVEVNLQDGT--YDSTVFVK 114

Query: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226
           +LP E+K ++ATD  KD + H+FLDLNKP+L Q+LFGNFT+DFY+DQ+HRPRHYG+ SAP
Sbjct: 115 ELPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAP 174

Query: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286
           LFGNFLEP + T W+L+PI W PVV YH+++A  N+N +FA  LFC+G++VWT IEYC+H
Sbjct: 175 LFGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLH 234

Query: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346
           RFLFH D+ +P+HN  Y +HFLLHG HHYLPMD+YRLVVPP LF+ LC P YKLVF LLP
Sbjct: 235 RFLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLP 294

Query: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYW 406
            YWA AGFAGG+ GYICYDL HYF+HH KLP FMR            NYQLG+GV++++W
Sbjct: 295 LYWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFW 354

Query: 407 DKKFGTYLSPDSPLSKMKYQ 426
           DK FGTYL PDSP S M+Y+
Sbjct: 355 DKVFGTYLGPDSPASIMRYK 374

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  503 bits (1295), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/380 (63%), Positives = 291/380 (76%), Gaps = 7/380 (1%)

Query: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           MSSN S+TLEL SKD VA HN + D WV V  RK+ D+S ++ + P+ ++ +L  AGKDI
Sbjct: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59

Query: 107 TELLKDEKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166
           T+     +             +GY+ATD EE++LL+NKDHKVEVKL E   TFDS+TFVK
Sbjct: 60  TD-----RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFDSSTFVK 113

Query: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226
           DLPTEDKLSIATD ++D +KH+FLDL KPL+ Q+LFG+FTKDFY+DQIHRPRHYG+ SAP
Sbjct: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173

Query: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286
           LFGNFLEP +KTAWY+VPI W PVV Y +  + K I+ +FA+MLF +G +VWT IEYCMH
Sbjct: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233

Query: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346
           RFLFHFD+ LPE+N A+ IHFLLHG HHYLPMD YRLVVPP LF+ LC PFYKLVF LLP
Sbjct: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293

Query: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYW 406
           +Y ACAGFAGGMFGYICYDL HYFLHHSK+P FMR            NYQLG+GV++W+W
Sbjct: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353

Query: 407 DKKFGTYLSPDSPLSKMKYQ 426
           DK F TYL  D+P+S MKY 
Sbjct: 354 DKVFDTYLGKDAPISPMKYD 373

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  496 bits (1276), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 230/378 (60%), Positives = 286/378 (75%), Gaps = 7/378 (1%)

Query: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           +KTL L+S  QV +HN+ +DCWVT+ +RKIYDV+KFL DHP G   I+++AGKDITE++K
Sbjct: 3   TKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMK 62

Query: 112 DEKIXXXXXXXXXXX----XIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167
           D  +                +GY+AT  EE+KLL N  HKVEVKL +    +DST FV +
Sbjct: 63  DGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119

Query: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227
           +P E+KLSI TDY +D  +H FLDLN+PLL Q+L  +FTK+FYLDQ+HRPRHYG+ SAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287
           FGNFLEP +KT+WY++PI WLPVV YHI  A +N+N LFA+ LF +G++VWT IEY MHR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347
           FLFH D  LP +  AY +HFLLHG HHYLPMD+YRLV+PP LF+ LC PFYKLVFALLPY
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWD 407
           YWACAGFAGGM GY+CYDL HYFLHH+KLP  ++            NY+LG+GVTSW WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 408 KKFGTYLSPDSPLSKMKY 425
           K FGTYL+ ++PLS+MK+
Sbjct: 360 KVFGTYLAENAPLSQMKF 377

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  494 bits (1273), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 288/379 (75%), Gaps = 5/379 (1%)

Query: 50  NVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
             +KTLELFSK +VA H   EDCWVT++ RKIYDV+KFL ++ D D  +L +AG DIT+ 
Sbjct: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61

Query: 110 LKDEKIXXXXXXXXX-XXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKDL 168
           L + K+             +GY+AT  EE+KLLTNKDHKVEV L +    FD  T V +L
Sbjct: 62  LVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLATLVVEL 118

Query: 169 PTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLF 228
           P E+KL+IAT+Y++D KKH FLDLNKPLL QIL G FT++FY+DQI+RPRHYGQ+SAPLF
Sbjct: 119 PPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLF 178

Query: 229 GN-FLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287
           GN FLEPF+KTAW++VP  WLPVVF+   +A KN+N   A+ LFC+GV+VWT +EYC+HR
Sbjct: 179 GNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHR 238

Query: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347
           FLFHFD  LPE+N A+ +HFLLHG HHYLPMD YRLVVPP LFI LCAP YK VF LLPY
Sbjct: 239 FLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPY 298

Query: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWD 407
           YWACAGFAGG+FGY+ YD+CHY LHHSKLPPFMR            NY+LGYG+TSW+WD
Sbjct: 299 YWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWD 358

Query: 408 KKFGTYLSPDSPLSKMKYQ 426
           K FGTYLS D+P S MK+ 
Sbjct: 359 KVFGTYLSKDAPASVMKFD 377

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  487 bits (1254), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 225/378 (59%), Positives = 286/378 (75%), Gaps = 7/378 (1%)

Query: 52  SKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           +KTL L+S+ Q+ +HNT +DCWV+++ RKIY+V+ FL +HP G + I ++AGKD+TE++K
Sbjct: 3   TKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIMK 62

Query: 112 D----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVKD 167
           D    E              +GY+AT  EE+KLL N +H VEVKL E    +DST FV +
Sbjct: 63  DGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLEED---YDSTVFVPE 119

Query: 168 LPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPL 227
           +P E+KLSI TDY KD  +H FLDLN+PLL Q+L  +F+K+FYLDQ+HRPRHYG+ SAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 228 FGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHR 287
           FGNFLEP +KTAWY++P+ W PVV YH+  A +N+N + A+ LFC+GV+VWT IEY +HR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 288 FLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPY 347
           FLFH D  LP +  AY +HFLLHG HHYLPMD+YRLV+PP LF+ LC PFYKLVFALLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 348 YWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYWD 407
           YWACAGFAGGMFGY+CYDL HYFLHH+KLP +MR            NY+LG+GVTSW+WD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 408 KKFGTYLSPDSPLSKMKY 425
           K FGTYL  ++PLS+MK+
Sbjct: 360 KVFGTYLGDNAPLSQMKF 377

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  485 bits (1249), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 224/397 (56%), Positives = 288/397 (72%), Gaps = 6/397 (1%)

Query: 36  TPAKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGD 95
           +P+  T      +S+   T ELFS + V KHNT++DCWV   +RKIYDVS++L D+P G+
Sbjct: 4   SPSTATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGN 63

Query: 96  KSILKHAGKDITELLKDEKI------XXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVE 149
             I+  AGKDIT   K+++                   +GY+A + E  KLL+N  HKVE
Sbjct: 64  SKIIDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVE 123

Query: 150 VKLNESTNTFDSTTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDF 209
           VKL E  +T+DSTTFVK+LP+ED   IATDY+KD  +H+FLDL KPL+ Q+    F + F
Sbjct: 124 VKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAF 183

Query: 210 YLDQIHRPRHYGQESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIM 269
           Y+DQIHRPRH+G +SAPLFGNFLEP TKTAW+++P+ WLPVVFYH+ +AF N+N +FA  
Sbjct: 184 YIDQIHRPRHFGNKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATF 243

Query: 270 LFCIGVYVWTFIEYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVL 329
           LFC+GV+VWT IEY +HRFLFH D R+P+H   Y++HF +HGCHHYLPMD YRLV+PP L
Sbjct: 244 LFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTL 303

Query: 330 FIFLCAPFYKLVFALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXX 389
           F+ LC PFYKLVF++LP YWA AGFAGG+FGY+CYD  HY+LHHS++P FMR        
Sbjct: 304 FLILCTPFYKLVFSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLE 363

Query: 390 XXXXNYQLGYGVTSWYWDKKFGTYLSPDSPLSKMKYQ 426
               NYQL +GV++++WDK FGTYL PDSPLS MKY+
Sbjct: 364 HHYKNYQLAFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  478 bits (1229), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/381 (60%), Positives = 284/381 (74%), Gaps = 6/381 (1%)

Query: 49  SNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           S+  KTL L+SK +  KH     CWV++  RKIY+VSKFL ++P+G + +L HAG+D+T+
Sbjct: 2   SSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQ 61

Query: 109 LLKD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTF 164
           LLKD    E              IGY+AT  EE KLLTN +H VEVK   + N  DS  F
Sbjct: 62  LLKDMQTDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVK-PANGNRVDSG-F 119

Query: 165 VKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQES 224
           VK LPTE+KL+IATD++ D +KH+FLDL+KPL  Q+LFGNFTK+FY+DQ+HRPRHYG+ES
Sbjct: 120 VKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKES 179

Query: 225 APLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYC 284
           APLFGNFLEP +KT+W+++PI W P V Y+I  A  NI+   A+ LF +GV+VWT IEY 
Sbjct: 180 APLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYG 239

Query: 285 MHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFAL 344
           +HRFLFHFD+R+PE N  + +HFLLHG HHYLPMDKYRLV+PP LF+ LC PFYKLVF++
Sbjct: 240 LHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSI 299

Query: 345 LPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSW 404
           LPYY ACAGFAGG+FGY+ YD+ HYFLHH KLPPFMR            NY+LG+GVTSW
Sbjct: 300 LPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSW 359

Query: 405 YWDKKFGTYLSPDSPLSKMKY 425
           YWDK F TYLSP +PLS+ KY
Sbjct: 360 YWDKVFNTYLSPTAPLSRAKY 380

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  474 bits (1220), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 224/378 (59%), Positives = 278/378 (73%), Gaps = 8/378 (2%)

Query: 51  VSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELL 110
           VSKTL L+SK  + KH     CWV+V +RKIYDVS+FL +HP GD+ IL +AGKDIT +L
Sbjct: 2   VSKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVL 61

Query: 111 KD----EKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166
           KD    E              +GY+AT+ EE KLLTN+ H +EV    +    D+TTFVK
Sbjct: 62  KDKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEV----TPENLDTTTFVK 117

Query: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226
           +LP E+ LS+ATD+  D  KH+FLDLNKPLL Q+L GNFT+DFY+DQIHRPRHYG+ SAP
Sbjct: 118 ELPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAP 177

Query: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286
           LFGNFLEP +KT W++VP+ W PVV Y++  A +N+ A  A+  F  GV+VWT IEY +H
Sbjct: 178 LFGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLH 237

Query: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346
           RFLFHFD+ +PE N A+ +HFLLHG HHYLPMDKYRLV+PP LF+ LCAPFY+LVF++ P
Sbjct: 238 RFLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFP 297

Query: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWYW 406
            Y AC  FAGG+FGY+CYD+ HYFLHH KLPPFMR            NY+LG+GVTSWYW
Sbjct: 298 EYCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYW 357

Query: 407 DKKFGTYLSPDSPLSKMK 424
           DK FGTYL+ +SP+S+ K
Sbjct: 358 DKVFGTYLASNSPVSRPK 375

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  452 bits (1163), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 218/379 (57%), Positives = 277/379 (73%), Gaps = 8/379 (2%)

Query: 48  SSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDG--DKSILKHAGKD 105
            SN SKTLELFS ++   HNTE+DCWV+V DR IYDVSKF+ ++ D   + ++LK AGKD
Sbjct: 3   ESNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKD 62

Query: 106 ITELLKDEKIXXXXXXXXXXXXIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFV 165
           I++LL+ +              +GY+A   EE +LLTNKDHKVEV L + T  +DST FV
Sbjct: 63  ISDLLETKSFKFVDDKYL----VGYLANSTEEARLLTNKDHKVEVNLKDGT--YDSTVFV 116

Query: 166 KDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESA 225
           K+LP+E+  +I+TDY+KD   H+FLDL KPLL Q+L GNFT++FY+DQIHRPRHYG+ SA
Sbjct: 117 KELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSA 176

Query: 226 PLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCM 285
            LFGN+LEP + T W+L+PI W PVV YH  +  ++++ L A+  + +G++VWTFIEYC+
Sbjct: 177 KLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCL 236

Query: 286 HRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALL 345
           HRFLFH D+ +P+HNF Y IHFLLHG HHYLPMD+YRLVVPP LF+ LC PFYK VFALL
Sbjct: 237 HRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALL 296

Query: 346 PYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXXXXXXNYQLGYGVTSWY 405
           P Y A  GFAGG+ GYI YDL HYF+HH KLP   R            NYQLG+GV++++
Sbjct: 297 PLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYF 356

Query: 406 WDKKFGTYLSPDSPLSKMK 424
           WD  FGTYL PDSP S M+
Sbjct: 357 WDLVFGTYLGPDSPASIMR 375

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  340 bits (873), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 201/276 (72%), Gaps = 3/276 (1%)

Query: 150 VKLNESTNTFDSTTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDF 209
           +K+ ES  T+      K   TE+KL + TDY KD  ++ FL L++PL  Q+L  NFT+DF
Sbjct: 1   MKIEESIETYIHIR--KTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDF 58

Query: 210 YLDQIHRPRHYGQESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIM 269
           Y+DQ+H+PRHYG ESAP+FGNFLEPFTKT W++VP+ W PVV Y+  ++ + I+ + AI 
Sbjct: 59  YIDQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAIT 118

Query: 270 LFCIGVYVWTFIEYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVL 329
           LF IGV+VWT IEYCMHR+LFH D+ +PE    +++HFLLHG HHYLPMDKYRLV+PP L
Sbjct: 119 LFSIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPAL 178

Query: 330 FIFLCAPFYKLVFALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRXXXXXXXX 389
           F  LC PFY L FA+ P YWA AGFAGG+FGY+CYD+ HYFLHH K+P FMR        
Sbjct: 179 FSILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLE 238

Query: 390 XXXXNYQLGYGVTSWYWDKKFGTYLSPDS-PLSKMK 424
               N+QLG+GVTS +WD+ FGTYL P + P ++ K
Sbjct: 239 HHYKNFQLGFGVTSSFWDRVFGTYLDPKTIPYARSK 274

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (70%), Gaps = 1/62 (1%)

Query: 51  VSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELL 110
           V +  ++++ +QVA+HNT ED W+ V D K+YDV+KF+ DHP GD+ IL  AG+D TE  
Sbjct: 54  VVEMSKVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAF 112

Query: 111 KD 112
            D
Sbjct: 113 ND 114

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
           Anc_2.166 YNL111C
          Length = 126

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 1/56 (1%)

Query: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           ++S  Q+A+HN+ ED W+ V D K+YDV+KF+ +HP GD+ IL  AG+D +E  +D
Sbjct: 4   VYSYQQIAEHNSAEDIWIVV-DGKVYDVTKFMDEHPGGDEIILDLAGQDASEPFRD 58

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
           (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 41/57 (71%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           ++++  ++A+HNT E CW+ + D K+YD +KFL +HP GD+ IL  AG+D TE  +D
Sbjct: 3   KVYTYQEIAEHNTTESCWIVI-DGKVYDTTKFLDEHPGGDEIILDLAGQDATESFED 58

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
           YNL111C
          Length = 123

 Score = 61.6 bits (148), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 41/57 (71%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L+S +++A HNT E  W+ + D K+YDV+KFL  HP GD+ IL+ AG+D T+  +D
Sbjct: 3   KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDFED 58

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
           to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 61.2 bits (147), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           ++++  QV++HN E DCW+ + D  +YDVSKFL +HP GD+ I +H G D T
Sbjct: 3   KVYTYKQVSEHNKEGDCWIII-DGSVYDVSKFLDEHPGGDEIIFEHRGTDAT 53

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
           Anc_2.536 YMR073C
          Length = 121

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  Q+A+HN  +D W+ + + K+YDVSKFL +HP GD+ I + AG+D TE   D
Sbjct: 3   QVYSYQQIAEHNKPDDAWIII-EGKVYDVSKFLDEHPGGDEIIFELAGQDATEHFLD 58

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 58.9 bits (141), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 42/57 (73%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           ++++ +++AKHN+ +D W+ + + K+YDVSKFL +HP G++ I + AG D TE  +D
Sbjct: 3   QIYTYEEIAKHNSPDDTWIVI-EGKVYDVSKFLDEHPGGEEIIFELAGTDATENFED 58

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  +VA+HN  E+CW+ + D K+YDVS+F  +HP GD+ I+   G+D TE   D
Sbjct: 3   KVYSYQEVAEHNGPENCWIII-DDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD 58

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {ON}
           YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 41  TTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK 100
           T   +  +S  S  L   S D+VA H   +DCW++++  K+YDVS +L  HP G + +LK
Sbjct: 17  TPGPDDSTSQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLK 75

Query: 101 HAGKDIT 107
            AGKD T
Sbjct: 76  LAGKDAT 82

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  +VA+HN  E+CW+ + D K+YDVS+F  +HP GD+ I+   G+D T+   D
Sbjct: 3   KVYSYQEVAEHNGPENCWIII-DDKVYDVSQFKDEHPGGDEIIMDLGGQDATDSFVD 58

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 41/61 (67%), Gaps = 1/61 (1%)

Query: 49  SNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +N++    L S D+VAKH+T  DCWV ++D K+YD++ F+  HP G   I  +AGKD+T 
Sbjct: 87  ANINDEKPLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTN 145

Query: 109 L 109
           +
Sbjct: 146 I 146

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {ON}
           YNL111C (REAL)
          Length = 120

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  +VA+HN  E+ W+ + D K+YDVSKF  +HP GD+ I+   G+D TE   D
Sbjct: 3   KVYSYQEVAEHNGPENFWIII-DDKVYDVSKFKDEHPGGDEIIMDLGGQDATESFVD 58

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
           YNL111C
          Length = 126

 Score = 55.5 bits (132), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           ++++   VA+H   +DCW+ + D K+Y+VSKFL +HP GD+ I + AG D TE   D
Sbjct: 3   QVYTYADVAEHVLPDDCWIAI-DGKVYNVSKFLDEHPGGDEIIYELAGSDATEYFLD 58

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 123

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L+S  ++A+HNTE D W+ + D K+YD +KF+ +HP G++ +L   G+D T    D
Sbjct: 3   KLYSYKEIAEHNTENDLWMII-DGKVYDCTKFMDEHPGGEEVLLDLGGQDATGPFAD 58

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
           YNL111C
          Length = 119

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 39/52 (75%), Gaps = 1/52 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           ++++ + VA+H+T ED W+ + D ++Y+V+KFL +HP G++ +L+ AG D T
Sbjct: 3   KIYTYEDVAQHSTSEDAWIVI-DNRVYEVTKFLDEHPGGEEILLEMAGADAT 53

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {ON}
           weakly similar to uniprot|P40312 Saccharomyces
           cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
           sterol and lipid biosynthesis pathways
          Length = 233

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           + S++++A H + EDCW+ ++   +YDVS++L  HP G + +LK AGKD T    D
Sbjct: 33  VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDD 87

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
           similarities with uniprot|P40312 Saccharomyces
           cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           L + D+VA+H++  DCW TV   K+YD++ FL  HP G + +LK+AGKD T    D
Sbjct: 5   LITMDEVARHSSRSDCW-TVIHGKVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDD 59

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
           CYB5Cytochrome b5, involved in the sterol and lipid
           biosynthesis pathways; acts as an electron donor to
           support sterol C5-6 desaturation
          Length = 120

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +++S  +VA+HN  E+ W+ + D K+YDVS+F  +HP GD+ I+   G+D TE   D
Sbjct: 3   KVYSYQEVAEHNGPENFWIII-DDKVYDVSQFKDEHPGGDEIIMDLGGQDATESFVD 58

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
           (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L+S  ++A+HNTE+D W+ + D K+YD +KF+ +HP G++ ++   G+D T    D
Sbjct: 3   KLYSYKEIAEHNTEKDLWMII-DGKVYDCTKFMDEHPGGEEVLVDLGGQDATGPFAD 58

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 123

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +LF+  ++A+HNTE D W+ + D K+YD +KF+ +HP G++ ++   G+D T    D
Sbjct: 3   KLFTYQEIAEHNTEGDLWMII-DGKVYDCTKFIDEHPGGEEVLVDLGGQDATGPFAD 58

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           ++++ +++A+HNT E  W+ + + K+Y+V+KFL +HP GD+ I   AG D TE  +D
Sbjct: 61  KIYTYEEIAEHNTTESSWIVI-EGKVYNVTKFLDEHPGGDEIIFDLAGTDATENFED 116

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 41  TTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK 100
           T  +N +   +S T    S D+V KHN+E DCW+ V + ++YD++ F+  HP G   I  
Sbjct: 78  TNIQNDVKLELSSTKSPISTDEVTKHNSENDCWI-VINGQVYDLTSFMSIHPGGSDIIKL 136

Query: 101 HAGKDITEL 109
           +AGKD++ +
Sbjct: 137 NAGKDVSAI 145

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 43/80 (53%), Gaps = 13/80 (16%)

Query: 30  FSIFRNTPAKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLL 89
            S+ +N  AK + RR+             S  +V +HN E+DCWV V D  +YDV+ F+ 
Sbjct: 103 ISLIKNDAAKHSKRRH------------VSATEVIRHNKEDDCWV-VIDGYVYDVTAFID 149

Query: 90  DHPDGDKSILKHAGKDITEL 109
            HP G   I  +AGKD++ L
Sbjct: 150 QHPGGSAVIRGNAGKDVSAL 169

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 13/83 (15%)

Query: 30  FSIFRNTPAKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLL 89
            S+F + P + T  +            L++  ++A+HN+E D W+ + + K+YD +KF  
Sbjct: 28  LSLFTSPPTETTMPK------------LYTYQEIAEHNSENDLWLII-NGKVYDCTKFAE 74

Query: 90  DHPDGDKSILKHAGKDITELLKD 112
           +HP GD+ ++  AG+D TE   D
Sbjct: 75  EHPGGDEVLIDLAGQDATEPFAD 97

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 39  KLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSI 98
           KL++R       V  +    S D+VAKHN+ +DCWV V D  +YD+++F   HP G   I
Sbjct: 65  KLSSRPLDNGPKVDMSKPAISPDEVAKHNSPDDCWV-VIDGYVYDLTEFAPVHPGGPTVI 123

Query: 99  LKHAGKDITEL 109
             +AGKD++ +
Sbjct: 124 KSNAGKDVSAI 134

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%), Gaps = 1/61 (1%)

Query: 49  SNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           SN + T  L   ++VAKH T +DCWV V +  +YD++ F++ HP G   +  +AGKD+T 
Sbjct: 74  SNEAITTRLILPEEVAKHKTPDDCWV-VINGYVYDITSFIMSHPGGPDVLETNAGKDVTA 132

Query: 109 L 109
           +
Sbjct: 133 I 133

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 53  KTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           K  ++ + ++VA+HN  +DCWV + D  +Y+++ F+  HP G   I+ ++GKD+T+L
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVIND-SVYNLTDFIDSHPGGKNVIVANSGKDVTKL 123

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 53  KTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           K+L++ +  +V KHN+++DCWV + D  +YD++ F+  HP G   I+ +AGKD++ +
Sbjct: 86  KSLKIITPQEVIKHNSKDDCWVVINDI-VYDLTFFIKKHPGGQDVIVGNAGKDVSNI 141

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 1/70 (1%)

Query: 38  AKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKS 97
           ++ +TR   + +   + L      +V +HNT  DCW+ ++ R +YDV+  L  HP G + 
Sbjct: 5   SRTSTREGALENFEDRNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQI 63

Query: 98  ILKHAGKDIT 107
           +LK+AG D T
Sbjct: 64  LLKYAGMDAT 73

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           L   S ++V++H + +DCW  ++ R +YD++  L +HP G K +LK+AG+D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (66%), Gaps = 1/54 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
            S  +VAKHNT +DCWV V +  +Y++++F+  HP G   I  +AGKD+T + K
Sbjct: 92  ISPSEVAKHNTPDDCWV-VIEGYVYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
           Ashbya gossypii AFL223W
          Length = 145

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           F+  ++A HN+E+D W+ + + K+YD SKF  +HP GD+ +L   G+D T
Sbjct: 5   FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHPGGDEVLLDLGGQDAT 53

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 45  NQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGK 104
           ++M  +  K+    + +++ KHNT EDCWV V + ++YD++ F+  HP G   I  +AGK
Sbjct: 92  SKMELDPVKSKTPITPNELMKHNTPEDCWV-VINNQVYDLTTFIQVHPGGPNIIRSNAGK 150

Query: 105 DITEL 109
           D+T +
Sbjct: 151 DVTAI 155

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +V KHNT EDCWV V D  +YD++ F+  HP G   I  +AGKD+T +
Sbjct: 90  ISPSEVIKHNTPEDCWV-VIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAI 140

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {ON}
           some similarities with uniprot|P00175 Saccharomyces
           cerevisiae YML054C CYB2 Cytochrome b2 (L-lactate
           cytochrome-c oxidoreductase), component of the
           mitochondrial intermembrane space, required for lactate
           utilization; expression is repressed by glucose and
           anaerobic conditions
          Length = 178

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           + + S  +V KHN  +DCW+ ++  K+Y+++ FL  HP G   IL++ G+D T+
Sbjct: 1   MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATK 53

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +VAKHN  +DCWV V +  +YD+++FL +HP G   I  +AGKD+T +
Sbjct: 91  ISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILK-HAGKDITEL 109
            +K Q+ KHNT EDCW  V ++++Y VS +L  HP G + +L+  AGKD T L
Sbjct: 129 VTKAQLQKHNTAEDCWC-VLNQRVYCVSSYLDFHPGGAEILLRTAAGKDATAL 180

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +VAKHN  +DCWV V +  +YD+++FL +HP G   I  +AGKD+T +
Sbjct: 91  ISPAEVAKHNKPDDCWV-VINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAI 141

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
           Ashbya gossypii ADL085C
          Length = 209

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
            S  +V +H + +DCW  +++ K+YD++  L  HP G K++LK+AG+D T
Sbjct: 6   ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +V  HN  +DCW+ V D ++YD++KFL  HP G   +++ AG+D TE
Sbjct: 85  EVKMHNRIDDCWI-VIDNEVYDITKFLSQHPGGVARLMEFAGRDATE 130

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +VAKHN+ +DCWV V +  +YD+++F+ +HP G   I  +AG+D+T +
Sbjct: 91  ISPAEVAKHNSADDCWV-VINGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAI 141

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} similar
           to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 123

 Score = 47.0 bits (110), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKD 112
           +L +  +V++H T +D W+ + D K+YD +KF+ +HP GD+ ++   G+D T   +D
Sbjct: 3   KLLTYKEVSEHKTVDDLWMII-DGKVYDCTKFVDEHPGGDEILVDLGGQDATGPFED 58

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            S  +VAKHN  +DCWV V +  +YD+++F+ +HP G   I  +AG+D+T +
Sbjct: 91  ISPAEVAKHNKADDCWV-VINGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAI 141

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 53/97 (54%), Gaps = 6/97 (6%)

Query: 18  STFSLSSQFV--GSFSIFRNTPAKLTTRRNQMSSNVSK---TLELFSKDQVAKHNTEEDC 72
           S FS   + +  G+F +  +    L ++ N    N +K   T    S  +VAKH++ +DC
Sbjct: 45  SAFSFGKKVITGGAFLVAGSVGIALISQFNDSVENGAKVDMTKPKVSPTEVAKHSSPKDC 104

Query: 73  WVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           WV V +  +Y+++ F+  HP G   I  +AGKD+T++
Sbjct: 105 WV-VIEGYVYNLTDFISAHPGGPAIIENNAGKDVTKI 140

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/47 (48%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           VAKHN  +DCWV V D  +YD+++F+  HP G   I  +AGKD+T +
Sbjct: 86  VAKHNDPKDCWV-VIDGYVYDLTEFIHSHPGGPTIIENNAGKDVTAI 131

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           +V KHN  +DCWV V D  +YD+S F+  HP G   I  +AGKD++ +
Sbjct: 82  EVEKHNAPDDCWV-VIDGYVYDLSDFIPSHPGGPAVIRANAGKDVSAI 128

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 34/49 (69%), Gaps = 2/49 (4%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSIL-KHAGKDITEL 109
           ++A+HNT EDCW TV + K+Y +S +L  HP G K ++ K +G+D T L
Sbjct: 123 ELARHNTAEDCW-TVINGKVYSISSYLSFHPGGAKILIDKSSGQDSTVL 170

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           +VA+HNT  DCW+ V +  +YD++ F+  HP G   I  +AGKD+T +
Sbjct: 93  EVARHNTPADCWI-VINGVVYDLTSFIPVHPGGADIIKSNAGKDVTAI 139

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            S  ++ KHNT  DCW+ + + ++YDV+ FL  HP G   +++ AG D TE
Sbjct: 75  ISASELRKHNTVHDCWIAL-NGEVYDVTAFLQMHPGGVARLMEVAGGDATE 124

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
           {ON} conserved hypothetical protein
          Length = 190

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 53  KTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           + L   S D++ KH T  DCW+ ++ R +Y+V+  L  HP G + +L + G+D T
Sbjct: 25  EDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 56  ELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
           E     +VAKH+  +DCWV V +  +YD+S F+  HP G   I  +AGKD++ +
Sbjct: 77  ESIRPQEVAKHSKPDDCWV-VINGYVYDLSDFIAVHPGGPAIIKANAGKDVSAI 129

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +V  HN   DCW+ + D ++YDV+ F+  HP G + IL+ AG D TE
Sbjct: 85  EVMLHNKLNDCWIVLND-EVYDVTSFIAAHPGGVQRILEVAGSDATE 130

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           +V +HN  +DCW+ V + ++YDV+ FL  HP G   I++ AG D T
Sbjct: 80  EVMQHNKPDDCWI-VLNGEVYDVTSFLQMHPGGAARIMEVAGNDAT 124

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           D+V  HN  +DCW+ V +  +YD+++F+  HP G   +++ AG+D TE
Sbjct: 91  DEVKLHNNIDDCWI-VLNGDVYDITEFIKIHPGGAARLMEVAGRDATE 137

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDIT 107
           +V  HN   DCW+ V + +IYDV+ F+  HP G   +L+ AG+D T
Sbjct: 80  EVMLHNNVNDCWI-VLNGEIYDVTSFIGKHPGGAARLLEVAGRDAT 124

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITEL 109
            +K Q+A+H   EDCW  V ++K+Y +S +L  HP G   ++K  AGKD T +
Sbjct: 123 INKAQLAQHKAPEDCWC-VINQKVYCISSYLDFHPGGVDILMKGAAGKDCTSM 174

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 57  LFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITE 108
           + +K  VAKH   +DCW  +   K+Y +S +   HP GDK ++   +G+D T+
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCTK 193

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH--AGKDITE 108
            S+  VA+HNT +DCW  +   K+Y ++ +   HP GDK ILK+  +G D TE
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDK-ILKNFCSGVDATE 193

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 52/107 (48%), Gaps = 12/107 (11%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLE---LFSKD 61
           KV IY+ S F LS      SQ +   ++ +    K+   R+  S N    L     ++K+
Sbjct: 335 KVFIYLTSLFGLSYDLKTFSQNIIQQALIQQRQKKID--RDSKSVNWGPKLADLPAWTKE 392

Query: 62  QVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           +  + N E D  V V    ++DVS ++ +HP G+K +    GKD T+
Sbjct: 393 EFLEKNRENDGLVIV-GGIVHDVSGYITEHPGGEKLLKNALGKDATK 438

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITELLKD 112
           F+   + KH +E+DCW TV++ K+Y ++ +L  HP G   +L+  AGKD T L  +
Sbjct: 147 FNHKILQKHVSEDDCW-TVHNGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLFNE 201

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITEL 109
           + +H +  DCW T+Y  K+Y VS +L  HP G   I ++ AGKD T L
Sbjct: 118 LQRHTSRTDCW-TIYKGKVYCVSDYLEYHPGGPDIIFQNCAGKDSTVL 164

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 16  IMSTFSLSSQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELF--------SKDQVAKHN 67
           I +T     + V     + N+P+  T         + + +  F         KD++ KH 
Sbjct: 86  ICTTKGREGKLVTGLDKYLNSPSVQTINHPNALIQLQRGVPTFMINPPLKIDKDELIKHK 145

Query: 68  TEEDCWVTVYDRKIYDVSKFLLDHPDGDKSIL-KHAGKDIT 107
           T +DCW  V   K+Y +S +   HP G + +L K AG+D T
Sbjct: 146 TVDDCWC-VLKGKVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 60  KDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITELLKD 112
           K+ + +HNT++DCW  +   K+Y ++ +   HP G   +L++ AGKD T++  +
Sbjct: 121 KELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNE 173

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKD 105
            +++ V KH   ED +  V + K+YD+S +L  HP G K +L+H   D
Sbjct: 125 INREIVKKHCKGEDEFWCVINGKVYDISGYLKFHPGGSKIVLRHRDSD 172

>Skud_13.229 Chr13 complement(386598..387203) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKD 105
            +K+ V +H   ED    V + K+YD+S +L  HP G K +LK+ G +
Sbjct: 125 INKEIVKRHCKGEDELWCVINSKVYDISSYLKFHPGGTKILLKNCGSE 172

>Smik_13.252 Chr13 complement(396365..396970) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKD 105
           V KH  +ED    V + K+YD+S +L  HP G   +L+H   D
Sbjct: 130 VKKHCKDEDELWCVINNKVYDISSYLKFHPGGTDILLRHRNSD 172

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMS--SNVSKTLELFSKDQ 62
           KV+IY+ S F LS      SQ      + +    KL   R++++  S +SK L ++ KD+
Sbjct: 328 KVLIYLTSLFGLSYDLKKFSQNAIQQGLVQQQQKKLDRTRSKLNWGSPLSK-LPVWDKDE 386

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
             +   + +  + V    ++DVS ++ +HP G+  I    GKD T+
Sbjct: 387 FME-KLKSNNGLVVISGIVHDVSGYITEHPGGETLIQASLGKDATK 431

>Ecym_2214 Chr2 (422005..423600) [1596 bp, 531 aa] {ON} similar to
           Ashbya gossypii AFL079W
          Length = 531

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 57/132 (43%), Gaps = 8/132 (6%)

Query: 74  VTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLKDEKIXXXXXXXXXXXXIGYMAT 133
           + +Y   + +V K++  HP GDK+I    G+D T  + D               IG +  
Sbjct: 20  IVIYRNLVLNVDKWIKYHPGGDKAIFHMIGRDATAEM-DAYHSNLTIATFKKWRIGVI-- 76

Query: 134 DAEEEKL---LTNKDHKVEVKLNESTNTFDSTTFVKDLPTEDKLSIATDYEKDLKKHNFL 190
           D   E +   +    +++  K+++ + T D T  V D+  ++   +    E        +
Sbjct: 77  DYPWENMVPPIQGGVYRLAEKMDQLSETSDDT--VVDIEPDENFELKPRREDSNAGGVSV 134

Query: 191 DLNKPLLKQILF 202
           DLN+   KQI+F
Sbjct: 135 DLNEAFAKQIIF 146

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHA-GKDITEL 109
           +++H   +DCW  +  R +Y +S+++  HP G + ++    GKD++ L
Sbjct: 149 LSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNL 195

>YMR073C Chr13 complement(412268..412873) [606 bp, 201 aa] {ON}
           IRC21Putative protein of unknown function; may be
           involved in resistance to carboplatin and cisplatin;
           null mutant displays increase in spontaneous Rad52p
           foci; contains a lipid-binding domain and binds
           cardiolipin in a large-scale study
          Length = 201

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 63  VAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKD 105
           V KH   ED    V + K+YD+S +L  HP G   ++KH   D
Sbjct: 130 VKKHCKGEDELWCVINGKVYDISSYLKFHPGGTDILIKHRNSD 172

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 54/124 (43%), Gaps = 21/124 (16%)

Query: 173 KLSIATDYEKDLKKHNFLDLNK----PLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLF 228
           K  I   Y K   + N  +LN+     +LKQI  G+F K  YL  +H+P H         
Sbjct: 14  KAIIGNSYNKLYSQLNSNELNEVGNYKILKQIGEGSFGK-VYL-ALHKPTHKKV------ 65

Query: 229 GNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRF 288
              L+   KT   +V       +FYH    F  I  L+ +++      VW  IEYC ++ 
Sbjct: 66  --VLKSSDKTDPNVVR-----EIFYHRQFDFPYITKLYEVII--TETKVWMVIEYCPNKE 116

Query: 289 LFHF 292
           L+ +
Sbjct: 117 LYDY 120

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVS-KTLELFSKDQV 63
           KV IY  S   L+      SQ      + +    KL   R++++       L ++ + + 
Sbjct: 327 KVFIYCASLVGLAYDLKKFSQNAIQQGLIQQKQKKLDNARSRLNWGTPLSQLPVWDRSEF 386

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            +  + E+  + V    ++DVS ++ +HP G+  I    GKD T 
Sbjct: 387 VR-ASRENSGLVVISGIVHDVSGYITEHPGGETLIQAALGKDATR 430

>KAFR0A04740 Chr1 (942850..944301) [1452 bp, 483 aa] {ON} Anc_6.106
           YGL055W
          Length = 483

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 50/106 (47%), Gaps = 7/106 (6%)

Query: 11  KVIIYIMSTFSLSS------QFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KV IY+ S   LSS      Q      + +    K+ +++  ++     T L +++  + 
Sbjct: 330 KVFIYLSSIIGLSSNLKKFPQNAIEQGLIQQIEKKINSQKRNLNWGPRLTDLPVWNYSEF 389

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
            +   + +  +T+    ++DV+ F+ +HP G+  I +  GKD T +
Sbjct: 390 QRQIEKNERKLTIIGGVVHDVTDFINEHPGGEPLIKEALGKDATRV 435

>KAFR0A01890 Chr1 complement(392001..392486) [486 bp, 161 aa] {ON}
           Anc_2.536 YMR073C
          Length = 161

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 7/59 (11%)

Query: 48  SSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106
           S N++K  ++  + Q++K    ED W  VY  K+Y +S++L  HP G + IL +  K++
Sbjct: 81  SININK--KILQRHQISK----EDFW-GVYKGKVYSLSRYLEYHPGGIEIILNNCKKNV 132

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMS-SNVSKTLELFSKDQV 63
           KVIIY+ S   L+      SQ     ++ +    K+  ++ +++   V   L L+ K Q 
Sbjct: 357 KVIIYLTSLVGLAYDLKKFSQNAIEEALIQQEQKKINQKKAKINWGPVLTDLPLWDK-QT 415

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
               ++E+  + +    ++DVS ++ +HP G+  I    GKD T+
Sbjct: 416 FLAKSKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATK 460

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 68  TEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITEL 109
             +D +  V +RK+Y +  +L  HP G+  + + AGKD+T L
Sbjct: 79  ANKDNFWCVINRKVYCIKAYLSYHPGGEVILKQCAGKDVTSL 120

>KLLA0E19471g Chr5 complement(1730651..1732372) [1722 bp, 573 aa]
           {ON} conserved hypothetical protein
          Length = 573

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 5/48 (10%)

Query: 61  DQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           D++AK  T     + +Y+  + ++ K++  HP GDKSI    G+D T+
Sbjct: 12  DRIAKGQT-----IVIYEDSVLNLDKWIKFHPGGDKSIYHMIGRDATD 54

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKTLELFSKDQVA 64
           KVIIY+ S   L+      SQ     ++ +    K+  ++ +++   + T       Q  
Sbjct: 354 KVIIYLTSLVGLAYDLKKFSQNAIEEALIQQEQKKINQKKAKINWGPALTDLPVWDKQTF 413

Query: 65  KHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
              T+++  + +    ++DVS ++ +HP G+  I    GKD T+
Sbjct: 414 LAKTKDNKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATK 457

>KLTH0H04488g Chr8 (401548..403272) [1725 bp, 574 aa] {ON} conserved
           hypothetical protein
          Length = 574

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 74  VTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           + +YD  +  + K++  HP GDK+I    G+D T+ +K
Sbjct: 20  IVIYDGNVLRLDKWIKYHPGGDKAIHHMIGRDATDEMK 57

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  FSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKH-AGKDITEL 109
             ++ + KH T +DCW  +  R +Y ++ +   HP G   + K  AGKD TE+
Sbjct: 125 IDRELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEM 176

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KV IY  S   L+      SQ      + +    KL   R++++     T L ++ K++ 
Sbjct: 328 KVFIYTSSLLGLAYNLKKFSQNAIQQGLVQQQQKKLDRSRSKLNWGTPLTQLPVWDKEEF 387

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            K + + +  + +    ++DVS ++ +HP G+  I   AGKD T+
Sbjct: 388 MK-SLKSNPGLVIVSGIVHDVSGYITEHPGGETLIQAAAGKDATK 431

>TPHA0B02700 Chr2 (620423..621889) [1467 bp, 488 aa] {ON} Anc_6.106
           YGL055W
          Length = 488

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 47/105 (44%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KVIIY+ S   LS      S      ++ +    KL  ++N ++   S T L  + K Q 
Sbjct: 335 KVIIYLTSLVGLSYDLKTFSSLAIKQALVQQEQKKLDKKKNALTWGPSLTNLPKWDKAQF 394

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            +  ++ +  + V    ++DV  ++ +HP G   I    GKD T 
Sbjct: 395 IE-ESKTNGNLIVISGIVHDVKGYITEHPGGQLLIKSALGKDATS 438

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           L ++SKDQ  + N + D  + V    +++V  ++ DHP G   I    GKD T 
Sbjct: 382 LPVWSKDQFLE-NLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATS 434

>SAKL0A04774g Chr1 (435965..437671) [1707 bp, 568 aa] {ON}
           uniprot|Q8NKG9 Saccharomyces kluyveri Putative delta 8-
           sphingolipid desaturase
          Length = 568

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 60  KDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITELLK 111
           +D++A+        + +Y+  + ++ K++  HP GDK+I    G+D T+ +K
Sbjct: 11  EDRIARGQA-----IVIYEGLVLNLEKWIKFHPGGDKAIHHMIGRDATDEMK 57

>AFL079W Chr6 (290134..291750) [1617 bp, 538 aa] {ON} NOHBY604; No
           homolog in Saccharomyces cerevisiae
          Length = 538

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 55  LELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
           + + SK +V +     +  + +Y   +  + K++  HP GDK+I    G+D T+
Sbjct: 1   MAVLSKSEVEERIANGEV-IVIYKSAVLKLDKWIKYHPGGDKAIYHMVGRDATD 53

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 8/105 (7%)

Query: 11  KVIIYIMSTFSLS------SQFVGSFSIFRNTPAKLTTRRNQMSSNVSKT-LELFSKDQV 63
           KV I++ S   LS      SQ      + +    K+  +R+ ++     T L ++ K Q 
Sbjct: 336 KVFIFLSSLVGLSFNLKKFSQNAIQQGLVQQQQKKIDRQRSHLNWGTPLTQLPVWDKQQF 395

Query: 64  AKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDITE 108
            + N + +  + +    ++DVS ++ +HP G+  I    GKD T+
Sbjct: 396 ME-NIKTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATK 439

>TPHA0K01880 Chr11 (393869..396418) [2550 bp, 849 aa] {ON} Anc_4.64
           YGR157W
          Length = 849

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 40  LTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDK 96
           +T+  + +S+ +  +L     D   +HNT +   V+  D+ I+  SK+ L+H + DK
Sbjct: 577 VTSFVDIVSNKMMHSLSYLDSDSETEHNTSDTDSVSSGDKDIFKFSKYKLEHNNTDK 633

>KNAG0J01270 Chr10 (226858..228501) [1644 bp, 547 aa] {ON} Anc_3.186
           YDL013W
          Length = 547

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 16/23 (69%)

Query: 179 DYEKDLKKHNFLDLNKPLLKQIL 201
           D E+D +  NF D +KPLLK IL
Sbjct: 358 DTERDTRVKNFTDKSKPLLKSIL 380

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,925,056
Number of extensions: 2093805
Number of successful extensions: 7806
Number of sequences better than 10.0: 133
Number of HSP's gapped: 7950
Number of HSP's successfully gapped: 133
Length of query: 426
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 314
Effective length of database: 40,638,807
Effective search space: 12760585398
Effective search space used: 12760585398
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 67 (30.4 bits)