Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C004308.837ON36936917160.0
KAFR0B039008.837ON37938311551e-157
CAGL0M02937g8.837ON37337611451e-156
Skud_13.4488.837ON36437710931e-148
NDAI0K004408.837ON40440210971e-148
Smik_13.4898.837ON37238910931e-148
YMR276W (DSK2)8.837ON37339010781e-146
Kpol_1068.118.837ON38138810741e-145
TDEL0B006008.837ON36937810641e-144
Suva_13.4648.837ON36639010361e-140
SAKL0D01540g8.837ON36537810011e-134
Kwal_27.102758.837ON3793859991e-134
ZYRO0G14124g8.837ON3693869961e-133
TPHA0I002208.837ON3773839961e-133
KLTH0C03938g8.837ON3763889781e-131
TBLA0D032308.837ON3753849271e-123
Ecym_46088.837ON4064169281e-123
KLLA0D01859g8.837ON3713889231e-123
ABL129W8.837ON3453739071e-120
KNAG0J002908.837ON3673997751e-100
TBLA0B032408.837ON2842461547e-11
Kpol_1036.628.311ON77561163e-07
SAKL0D11814g1.480ON400971257e-07
ZYRO0D05962g8.311ON77561102e-06
TPHA0C008908.311ON77711102e-06
TDEL0F043808.311ON77561092e-06
KLTH0G12540g8.311ON77561093e-06
SAKL0H15818g8.311ON77561074e-06
NCAS0B035208.311ON77561075e-06
KAFR0E005301.480ON379761176e-06
CAGL0B01589g8.311ON77561058e-06
AFR358W1.480ON413951168e-06
Skud_5.531.480ON397801132e-05
NDAI0J010708.311ON77561013e-05
Smik_5.561.480ON397791096e-05
Suva_5.321.480ON409781061e-04
YEL037C (RAD23)1.480ON398781061e-04
KLTH0C03410g1.480ON391731042e-04
CAGL0L01309g1.480ON392951042e-04
KAFR0C030008.142ON397491025e-04
Kwal_27.101521.480ON381501016e-04
TDEL0G017504.16ON7756926e-04
ZYRO0G06622g5.701ON128122956e-04
NDAI0G003301.480ON427531016e-04
YDR139C (RUB1)8.311ON7756917e-04
NCAS0B045908.142ON447421008e-04
Ecym_35721.480ON443661008e-04
NDAI0H002704.16ON7756908e-04
KLLA0F17974g8.311ON7773909e-04
TPHA0O004401.480ON36985999e-04
KAFR0D022305.701ON128122920.002
KAFR0H002205.701ON128122920.002
Suva_11.3305.701ON128122920.002
Skud_11.3335.701ON128122920.002
YIL148W (RPL40A)5.701ON128122920.002
YKR094C (RPL40B)5.701ON128122920.002
Suva_10.32singletonON6256870.002
Ecym_40195.701ON128122910.002
KLLA0A00616g5.701ON128122900.002
TPHA0E002405.701ON128122900.002
TPHA0D046005.701ON128122900.002
TBLA0E021105.701ON128122900.002
CAGL0G02475g5.701ON128122900.002
Skud_9.205.701ON125107900.003
Smik_11.3575.701ON125107900.003
Kpol_1043.695.701ON128122900.003
Smik_9.215.701ON124107900.003
AFR285C5.701ON128122890.003
KNAG0L021205.701ON128122890.003
NDAI0E050305.701ON128122890.003
NCAS0A032105.701ON128122890.003
NCAS0G002405.701ON128122890.003
Kwal_YGOB_Anc_5.7015.701ON128122890.004
KLTH0E01078g5.701ON128122890.004
Suva_9.405.701ON144107890.005
TDEL0B022005.701ON128122870.006
SAKL0E14894g5.701ON128122870.007
SAKL0H24772g8.142ON41443920.007
KNAG0C065805.701ON149122870.009
NDAI0F003005.701ON187129870.016
TBLA0D022108.142ON56338890.016
Kwal_56.238838.311ON5249790.020
Ecym_41818.386ON15271840.026
ZYRO0C04026g8.386ON15271840.027
NCAS0C029408.386ON15271840.027
KLTH0F08734g8.386ON15071830.028
TPHA0C023908.386ON15071830.030
SAKL0H13926g8.386ON15471830.031
KLLA0D18304g8.386ON15071830.033
NDAI0G022808.386ON15271830.034
KAFR0H020008.386ON15271830.034
Kwal_23.33118.386ON15071830.034
Ecym_84084.16ON15378830.038
AGL128W8.386ON15271830.038
YLR167W (RPS31)8.386ON15271820.039
Smik_7.918.142ON39938850.044
KLTH0E05852g4.16ON40971850.045
TPHA0K022504.16ON15371820.046
KNAG0J028804.16ON15371820.047
KNAG0A027308.386ON15071820.048
YGL181W (GTS1)8.142ON39638850.049
CAGL0G08173g8.386ON15271810.053
TDEL0C025901.480ON36891840.068
TDEL0F051008.386ON15071810.068
Kpol_1030.58.386ON15271800.072
Kpol_1024.168.386ON15271800.072
TBLA0G006704.16ON22971820.087
NDAI0D049304.16ON22971820.087
KAFR0I014704.16ON22971820.087
Kwal_55.206074.16ON23171820.090
Suva_10.2668.386ON15271800.090
Skud_12.2348.386ON15271800.090
Smik_12.2298.386ON15271800.090
Smik_12.184.16ON46078830.094
SAKL0H25784g4.16ON30571820.097
Suva_10.33singletonON25471820.100
Suva_10.34singletonON15171790.10
TDEL0B046908.142ON44238820.11
ACL062C4.16ON38278820.11
TBLA0H031808.386ON15271790.12
Suva_7.818.142ON40138820.12
Suva_10.304.16ON38171820.12
Skud_12.294.16ON38171820.12
YLL039C (UBI4)4.16ON38171820.12
ZYRO0G07854g4.16ON46078820.12
Kpol_1070.64.16ON53371820.13
KLLA0E00749g4.16ON38171810.14
CAGL0D05082g4.16ON53371820.14
NCAS0C058504.16ON38871810.16
KLLA0E22133g1.480ON38385800.19
NDAI0B01850singletonON40344800.20
CAGL0L06028g8.142ON50538800.23
Kpol_370.61.480ON40480790.25
NCAS0G041201.480ON39250790.26
AGL185W8.311ON5035690.42
TBLA0C012001.369ON50347770.49
Kpol_541.508.142ON51138741.1
TBLA0B021601.480ON40442731.3
Skud_7.908.142ON39638731.5
Ecym_42448.311ON5034632.3
NCAS0C001808.874ON20534684.4
KAFR0D021905.709ON42639694.4
ZYRO0F05192g1.480ON38455685.3
NCAS0C040908.142ON39651685.3
Kpol_1026.104.76ON84863686.2
TPHA0H004008.142ON46638677.3
KLTH0E02178g5.617ON593108678.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00430
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   665   0.0  
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   449   e-157
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   445   e-156
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   425   e-148
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   427   e-148
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   425   e-148
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   419   e-146
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   418   e-145
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   414   e-144
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   403   e-140
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   390   e-134
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   389   e-134
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   388   e-133
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   388   e-133
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   381   e-131
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   361   e-123
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   362   e-123
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   360   e-123
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   353   e-120
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   303   e-100
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    64   7e-11
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    49   3e-07
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    53   7e-07
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    47   2e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    47   2e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    47   2e-06
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    47   3e-06
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    46   4e-06
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    46   5e-06
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    50   6e-06
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    45   8e-06
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    49   8e-06
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    48   2e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    44   3e-05
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    47   6e-05
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    45   1e-04
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    45   1e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    45   2e-04
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    45   2e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    44   5e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    44   6e-04
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    40   6e-04
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    41   6e-04
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    44   6e-04
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    40   7e-04
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    43   8e-04
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    43   8e-04
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    39   8e-04
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    39   9e-04
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    43   9e-04
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    40   0.002
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    40   0.002
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    40   0.002
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    40   0.002
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    40   0.002
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    40   0.002
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    38   0.002
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    40   0.002
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    39   0.002
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    39   0.002
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    39   0.002
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    39   0.002
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    39   0.002
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     39   0.003
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    39   0.003
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    39   0.003
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     39   0.003
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    39   0.003
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    39   0.003
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    39   0.003
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    39   0.003
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    39   0.003
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    39   0.004
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    39   0.004
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     39   0.005
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    38   0.006
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    38   0.007
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    40   0.007
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    38   0.009
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        38   0.016
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.016
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    35   0.020
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    37   0.026
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    37   0.027
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    37   0.027
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    37   0.028
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    37   0.030
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    37   0.031
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    37   0.033
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    37   0.034
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    37   0.034
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    37   0.034
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    37   0.038
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    37   0.038
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    36   0.039
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    37   0.044
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    37   0.045
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    36   0.046
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    36   0.047
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    36   0.048
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    37   0.049
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    36   0.053
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    37   0.068
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    36   0.068
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    35   0.072
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    35   0.072
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    36   0.087
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              36   0.087
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    36   0.087
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    36   0.090
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    35   0.090
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    35   0.090
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    35   0.090
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    37   0.094
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    36   0.097
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    36   0.100
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    35   0.10 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    36   0.11 
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    36   0.11 
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    35   0.12 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    36   0.12 
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    36   0.12 
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    36   0.12 
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    36   0.12 
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    36   0.12 
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    36   0.13 
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    36   0.14 
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    36   0.14 
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             36   0.16 
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    35   0.19 
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    35   0.20 
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    35   0.23 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    35   0.25 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    35   0.26 
AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic homo...    31   0.42 
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    34   0.49 
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    33   1.1  
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    33   1.3  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    33   1.5  
Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON} s...    29   2.3  
NCAS0C00180 Chr3 (16537..17154) [618 bp, 205 aa] {ON} Anc_8.874 ...    31   4.4  
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...    31   4.4  
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    31   5.3  
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     31   5.3  
Kpol_1026.10 s1026 complement(20542..23088) [2547 bp, 848 aa] {O...    31   6.2  
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    30   7.3  
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    30   8.1  

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/369 (92%), Positives = 342/369 (92%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARYAG 120
           KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARYAG
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARYAG 120

Query: 121 YLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQLQ 180
           YLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQLQ
Sbjct: 121 YLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQLQ 180

Query: 181 AMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAPGGDD 240
           AMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAPGGDD
Sbjct: 181 AMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAPGGDD 240

Query: 241 DNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAAGSGNPPAF 300
           DNTVSE                           LFNPAMNPFAAGMANTNAAGSGNPPAF
Sbjct: 241 DNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGMANTNAAGSGNPPAF 300

Query: 301 DPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESA 360
           DPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESA
Sbjct: 301 DPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESA 360

Query: 361 LNALLNGDV 369
           LNALLNGDV
Sbjct: 361 LNALLNGDV 369

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 242/383 (63%), Positives = 280/383 (73%), Gaps = 18/383 (4%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI+IH+KSGQN W V+ + + +I  LKEEI+K+SE+PATNQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQA------NTTATPVAP-NMAAGETGGFNPLSDL 113
           KI +G SIH+VKSGG  A  + +           NT + P  P N+A+G+TGGFNPL+DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 114 TSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFII 173
           TSARYAGYLN+PSAD FGPDGGLN SGP+QD+MLRMLDNPVFQSQMNEMLSNPQM+DF+I
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGLN-SGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMI 179

Query: 174 QANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDF 233
           Q+NPQLQAMGPQARQ+LQ+PMFRQML NPDMIRQSMQ AR MNGG DP   G  N  S F
Sbjct: 180 QSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATG--NDPSAF 237

Query: 234 PAPG-----GDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMAN 288
           PAPG      ++ NT +                            LFNPA NPF A  +N
Sbjct: 238 PAPGEASASTNEQNTNASGESTTAGGATNNTNSTSAPAAANPFDALFNPAANPFGAMSSN 297

Query: 289 TNAAGSGNPPAFDPSFFASMFQPPAAQQQ--QEDTRPPEERYEHQLRQLNDMGFFDFDRN 346
           TN +     PAFDP+  ASM   P +QQ   Q+D RPPEERYE QLRQLNDMGFFDFDRN
Sbjct: 298 TNGS-QPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLNDMGFFDFDRN 356

Query: 347 VAALRRSGGNVESALNALLNGDV 369
           VAALRRSGG+V+ AL+ALLNGDV
Sbjct: 357 VAALRRSGGSVQGALDALLNGDV 379

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  445 bits (1145), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 238/376 (63%), Positives = 276/376 (73%), Gaps = 10/376 (2%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI+IH+KSGQN W VSIDP+ TIL LKEEIAKVSE+P+ NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKN--KSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARY 118
            I D  +IHMVKSGG ++  N   +    +N++ T V  N+A+G+TGGFNPL+DLT ARY
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASGQTGGFNPLADLTGARY 120

Query: 119 AGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQ 178
           AGY NLPSAD FGPDGG+NN+ P+QDEMLRM++NP+FQSQMNEMLSNP+MLDF+IQ+NPQ
Sbjct: 121 AGYANLPSADMFGPDGGINNA-PDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNPQ 179

Query: 179 LQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNG-GVDPNGNGQANTSSDFPAPG 237
           LQAMGPQARQ+LQ+P FRQMLTNP MIRQSMQ AR MNG G  P  +  A  +S FPAPG
Sbjct: 180 LQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGAD--ATDASAFPAPG 237

Query: 238 GDD-DNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTN--AAGS 294
           GDD + T                              L +PA NPFAA M N N    G+
Sbjct: 238 GDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASNPFAAMMGNMNNQQGGA 297

Query: 295 G-NPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRS 353
           G   PAFDP+  AS+         QED RPPEERYE QLRQLNDMGFFDFDRNVAALRRS
Sbjct: 298 GVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRS 357

Query: 354 GGNVESALNALLNGDV 369
           GG+V+ AL+ALLNGDV
Sbjct: 358 GGSVQGALDALLNGDV 373

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  425 bits (1093), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 225/377 (59%), Positives = 267/377 (70%), Gaps = 21/377 (5%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MS++IH+KSGQ+ W+V++ P  T+LQ KE I+K + +P  NQRLI+SGKILKDDQTV+ Y
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KILDGLSIHMVKS----GGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSA 116
            I DG S+H+VKS      G A    +    +    T   PNM++G++ GFNPL+DLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 117 RYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQA 175
           RYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNPQMLDF+IQ+
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 176 NPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPA 235
           NPQLQAMGPQARQ+LQ+PMFRQMLTNP+M+RQSMQ AR M    DPN +  A  +S FPA
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMM----DPNADNSA--ASAFPA 234

Query: 236 PGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAAGSG 295
           PGGD      E                           L NPA+NPF A   NT   G  
Sbjct: 235 PGGD---ASEEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPF-ANAGNTAPTGM- 289

Query: 296 NPPAFDPSFFASMFQPPAAQQQQ---EDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 352
             PAFDP+  ASMFQP  A  Q    ED+RPPEERYEHQLRQLNDMGFFDFDRNVAALRR
Sbjct: 290 --PAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRR 347

Query: 353 SGGNVESALNALLNGDV 369
           SGG+V+ AL++LLNGDV
Sbjct: 348 SGGSVQGALDSLLNGDV 364

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 237/402 (58%), Positives = 274/402 (68%), Gaps = 34/402 (8%)

Query: 2   SISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61
           +ISIH+KSGQNNWQVSID  ++I  LK+EIAKVSE+PATNQRLI+SGKILKDDQ V+FY 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  ILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARYAGY 121
           I DG S+H+V+SG  S     +     N +   V  N++AG+TGGFNPL+DLTSARYAGY
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTSARYAGY 122

Query: 122 -LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQLQ 180
            LNLPSAD FGPDGG+N SG N DE L MLDNP+ QSQMNEMLSNPQM+DF+IQ+NPQLQ
Sbjct: 123 NLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSNPQLQ 182

Query: 181 AMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNG--NGQANTSSDFPAPGG 238
           AMGPQARQ+ Q+PMFRQMLTNPDMIRQSMQ+A  M  G    G  N   N +S FPAPGG
Sbjct: 183 AMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFPAPGG 242

Query: 239 DD------------DNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNP--------- 277
           DD             NT ++                           LFNP         
Sbjct: 243 DDIINNNNTNTNTNTNTNNDTNDTATSNNDNANNNASSANTQNPFASLFNPTANNDSTGL 302

Query: 278 AMNPF-------AAGMANTNAAGSGNPPAFDPSFFASMFQ---PPAAQQQQEDTRPPEER 327
           A NPF        AG    NA  +G  P FDPS FAS+F     P+   QQ+DTRPPEER
Sbjct: 303 APNPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEER 362

Query: 328 YEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369
           YE QLRQLNDMGFFDFDRN+AALRR+GG+VE+A+NALLNGDV
Sbjct: 363 YETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  425 bits (1093), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 233/389 (59%), Positives = 271/389 (69%), Gaps = 37/389 (9%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MS++IH+KSGQ+ W+VS+ P ST+ Q KE I+K + VP  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQ-------------ANTTATPVAPNMAAGETGGF 107
            I DG S+H+VKS          P PQ                  T   PNM++G++ GF
Sbjct: 61  HIQDGHSVHLVKS---------QPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGF 111

Query: 108 NPLSDLTSARYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNP 166
           NPL+DLTSARYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNP
Sbjct: 112 NPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNP 171

Query: 167 QMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPN-GNG 225
           QMLDF+IQ+NPQLQAMGPQARQ+LQ+PMFRQMLTNPDMIRQSMQ AR M    DPN G G
Sbjct: 172 QMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGTG 227

Query: 226 Q-ANTSSDFPAPGGDD-DNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFA 283
                +S FPAPGGD  + + +                            L NPA+NPFA
Sbjct: 228 STGGAASAFPAPGGDAPEESANTNTNTNTASSPNAGSNASSSTAANPFASLLNPALNPFA 287

Query: 284 AGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQ---EDTRPPEERYEHQLRQLNDMGF 340
           +     NA G+G  PAFDP+  ASMFQP  A  Q    EDTRPPEERYEHQLRQLNDMGF
Sbjct: 288 SA---GNATGTGM-PAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGF 343

Query: 341 FDFDRNVAALRRSGGNVESALNALLNGDV 369
           FDFDRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 344 FDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 229/390 (58%), Positives = 266/390 (68%), Gaps = 38/390 (9%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MS++IH+KSGQ+ W+V++ P ST+LQ KE I K + +P  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVA-------------PNMAAGETGGF 107
            I DG S+H+VKS          P PQ  + A                 PNM++G++ GF
Sbjct: 61  HIQDGHSVHLVKS---------QPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGF 111

Query: 108 NPLSDLTSARYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSNP 166
           NPL+DLTSARYAGYLN+PSAD FGPDGG LNN   NQDE+LRM++NP+FQSQMNEMLSNP
Sbjct: 112 NPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNP 171

Query: 167 QMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPN--GN 224
           QMLDF+IQ+NPQLQAMGPQARQ+LQ+PMFRQMLTNPDMIRQSMQ AR M    DPN    
Sbjct: 172 QMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGMG 227

Query: 225 GQANTSSDFPAPGGD-----DDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAM 279
                +S FPAPGGD      +   +                            L NPA+
Sbjct: 228 SAGGAASAFPAPGGDAPEEGSNTNTTSSSNTGNNAGTNAGTNAGANTAANPFASLLNPAL 287

Query: 280 NPFAAGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMG 339
           NPF    AN   A S   PAFDP+  ASMFQPP    Q EDTRPPEERYEHQLRQLNDMG
Sbjct: 288 NPF----ANAGNAASTGMPAFDPALLASMFQPPVQASQAEDTRPPEERYEHQLRQLNDMG 343

Query: 340 FFDFDRNVAALRRSGGNVESALNALLNGDV 369
           FFDFDRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 344 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 373

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  418 bits (1074), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/388 (62%), Positives = 281/388 (72%), Gaps = 26/388 (6%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I IH+KSGQN W+V++D ++T+LQLKEEIAKVSE+P  NQRLI+SGKILKDDQ +EFY
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANT-------TATPVAPNMAAGETGGFNPLSDL 113
           KI D  SIH+VKSGG S     +    A+T       +  P+  N+AAG++GGFNPLSDL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 114 TSARYAGY-LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172
           TSARYAGY LNLPSAD FGPDGG+N S PNQD+MLRML+NPVFQSQMNEMLSNPQM+DF+
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMN-SMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFM 179

Query: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQAN-TSS 231
           IQ+NPQLQAMGP+ARQ+ Q+P FRQMLTNP+MIRQSMQMA  M G    NG   AN  +S
Sbjct: 180 IQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMMGG----NGQFGANAAAS 235

Query: 232 DFPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPF--------- 282
            FPAPG  D    +E                           LFNPAMNPF         
Sbjct: 236 SFPAPGETDTTAAAE--TNTETTSTPAATGAAAAGQQNPFASLFNPAMNPFAAMMNNNAA 293

Query: 283 -AAGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFF 341
            AAG   T AAG+   PAFDPS FASMFQPP  QQQ++D RPPEERYE QLRQLNDMGFF
Sbjct: 294 AAAGAGATGAAGATGTPAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQLRQLNDMGFF 353

Query: 342 DFDRNVAALRRSGGNVESALNALLNGDV 369
           DFDRNVAALRRSGG+V+ AL+ALL+ DV
Sbjct: 354 DFDRNVAALRRSGGSVQGALDALLSNDV 381

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  414 bits (1064), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 223/378 (58%), Positives = 265/378 (70%), Gaps = 18/378 (4%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI++ VK GQ+ W+VS++P  T+ + K+EIAKVSE+PA NQRLI+SGKILKDDQ VE Y
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KILDGLSIHMVKSGGGSANK--NKSPPPQANTTATP----VAPNMAAGETGGFNPLSDLT 114
           KI DG +IH+VKSGGG  N     S   Q + TA P    V  N+A+G+TGGFNPLSDLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 115 SARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQ 174
           SARYAG+ NLPSAD FGPDGGL N  PNQD+ML ML+NP+FQSQMNEMLSNPQM+DF+IQ
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNM-PNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179

Query: 175 ANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFP 234
           +NPQLQAMGPQARQ+LQ+P FRQMLTNP M+RQSMQ +  MN    P+G   A  +S FP
Sbjct: 180 SNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMN----PSGGNDAAAAS-FP 234

Query: 235 APGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAAGS 294
           APG   D+T                              +FNP  NP A+   N     +
Sbjct: 235 APG---DSTTEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAA 291

Query: 295 GNP--PAFDPSFFASMFQPPAAQQQQE-DTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 351
            N     FDPS  AS+    AAQQ+ E D RPPEERYE QLRQLNDMGFFDF++NVAALR
Sbjct: 292 DNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALR 351

Query: 352 RSGGNVESALNALLNGDV 369
           RSGG+V+ AL++LLNGDV
Sbjct: 352 RSGGSVQGALDSLLNGDV 369

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  403 bits (1036), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 227/390 (58%), Positives = 267/390 (68%), Gaps = 45/390 (11%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MS++++VKSGQ+ W+VS+ P ST+LQ KE I++ + +P  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQA--------------NTTATPVAPNMAAGETGG 106
            I DG S+H+VKS          P PQA                 +    PNM++G++ G
Sbjct: 61  HIQDGHSVHLVKS---------QPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAG 111

Query: 107 FNPLSDLTSARYAGYLNLPSADTFGPDGG-LNNSGPNQDEMLRMLDNPVFQSQMNEMLSN 165
           FNPL+DLTSARYAGYLN+PSAD FGPDGG LNN   NQDE+LRM+DNP+FQSQMNEMLSN
Sbjct: 112 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSN 171

Query: 166 PQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDP--NG 223
           PQMLDF+IQ+NPQLQAMGPQARQ+LQ+PMFRQMLTNPDMIRQSMQ AR M    DP    
Sbjct: 172 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM----DPNAGN 227

Query: 224 NGQANTSSDFPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFA 283
                 +S FPAPGGD     ++                           L NPA+NPFA
Sbjct: 228 GSAGGAASAFPAPGGDAPEETTD-------TDAAPSSNAGANAAANPFASLLNPALNPFA 280

Query: 284 -AGMANTNAAGSGNPPAFDPSFFASMF---QPPAAQQQQEDTRPPEERYEHQLRQLNDMG 339
            AG    N+A +   PAFDP+  ASMF   Q  A   Q EDTRPPEERYE QLRQLNDMG
Sbjct: 281 NAG----NSAAATGMPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMG 336

Query: 340 FFDFDRNVAALRRSGGNVESALNALLNGDV 369
           FFDFDRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 337 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 366

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  390 bits (1001), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 251/378 (66%), Gaps = 22/378 (5%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI++H+KSGQN W VSI+P +T+++LKE I+KVSE+P  NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATP----VAPNMAAGETGGFNPLSDLTSA 116
           KI D  ++H+V+SGG     +KS    A  T       V  N+++G+TGGFNPL+DLT A
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGA 120

Query: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176
           RYAGY NLPSAD FGPDGGL N+ PN DE+L MLDNP+ QSQMNEMLSNPQM+DF+IQ N
Sbjct: 121 RYAGYANLPSADMFGPDGGLTNA-PNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQN 179

Query: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAP 236
           PQLQAMGP+AR++LQ+  FRQM+TNPDMIRQSMQ AR                   FPAP
Sbjct: 180 PQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEG------AEGAGGAFPAP 233

Query: 237 GGDDDNTVSEXX-XXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAAGSG 295
           G       +E                            LFN   NPFA+   N      G
Sbjct: 234 GTATQTASTEGGPAGTTASPSTTGNGSANSEAANPFASLFNGQANPFASMFPN------G 287

Query: 296 NPPAFDPSFFASMF----QPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALR 351
             P FDPS  +S        P  QQQ +D RPPEERYE QLRQLNDMGFFDFDRNVAALR
Sbjct: 288 RAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAALR 347

Query: 352 RSGGNVESALNALLNGDV 369
           RSGG+V+ AL+ALLNGDV
Sbjct: 348 RSGGSVQGALDALLNGDV 365

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  389 bits (999), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 208/385 (54%), Positives = 260/385 (67%), Gaps = 22/385 (5%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI++HVKSGQ+ W VS+D  ST+ Q K  IA+ S++   NQRLI+SGKILKDDQT+E Y
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTAT--------PVAPNMAAGETGGFNPLSD 112
           KILDG ++H+VKSG  S +     P   +T  T            ++++G+ GGFNPLSD
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 113 LTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172
           LTSARYAGYLNLPSAD+FGPDGG+  S PN D+MLRML+NPV QSQMNEMLSNPQM+DF+
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMT-SAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL 179

Query: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSD 232
           IQ +PQLQ+MGPQARQ+LQ+P FRQM+TNP+MIRQSMQ +  + G  DP+  G    ++ 
Sbjct: 180 IQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVLGGAGDPSAAG----ANA 235

Query: 233 FPAPGGDDDNTVSEXXXXXXXXXXXXXXXX------XXXXXXXXXXXLFNPAMNPFAAGM 286
           FPAPG  D +  ++                                   +   NPF + M
Sbjct: 236 FPAPGTADSDASAQPASTNTSTADAAQSATNANPFASLLAGQAAAPGGASAPANPFLS-M 294

Query: 287 ANTNAAGSGNPPAFDPSFFASMFQPPA--AQQQQEDTRPPEERYEHQLRQLNDMGFFDFD 344
               A G+G  PAFDP+  +++       A QQ +DTRPPEERYE QLRQLNDMGFF+FD
Sbjct: 295 LGQQAPGAGGLPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDMGFFEFD 354

Query: 345 RNVAALRRSGGNVESALNALLNGDV 369
           RNVAALRRSGG+V+ AL+ALLNGDV
Sbjct: 355 RNVAALRRSGGSVQGALDALLNGDV 379

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 260/386 (67%), Gaps = 37/386 (9%)

Query: 2   SISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61
           +I++ +KSGQN W+V++DP ST+   KEEI+KVSE+PA++QRLI+SGKILKDDQT++FY 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  ILDGLSIHMVKSGGGSANKNKSP---------------PPQANTTATPV--AP-NMAAGE 103
           + DG S+H+VKS     N +                  PP  N + TP   AP N++AG+
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 104 TGGFNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEML 163
           +GGFNPL+DLTSARYAG+ +LPSAD FGPDGG  N  PNQ+++L MLDNP+FQSQMNEML
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNM-PNQEDLLNMLDNPIFQSQMNEML 181

Query: 164 SNPQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNG 223
           SNPQM+DF+IQ+NPQLQAMGPQARQ+ Q+P FRQMLTNP MIRQSMQ AR MN      G
Sbjct: 182 SNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMN-----PG 236

Query: 224 NGQANTSSDFPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFA 283
            G+ + ++ FPAPG  ++NT  E                                 NPFA
Sbjct: 237 GGENDAANAFPAPG--NENTEGESAAGANDGGNPAAAATNAGAPPAG---------NPFA 285

Query: 284 AGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDF 343
           A +              DP   ASM   P+ QQQ +D RPPEERYE QLRQLN+MGFFDF
Sbjct: 286 ALLGGGGPLQQPG--GLDPQLLASMLGAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDF 343

Query: 344 DRNVAALRRSGGNVESALNALLNGDV 369
           DRNVAALRRSGG+V+ AL++LLNGDV
Sbjct: 344 DRNVAALRRSGGSVQGALDSLLNGDV 369

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  388 bits (996), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/383 (59%), Positives = 269/383 (70%), Gaps = 20/383 (5%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSIS+ +KSGQN W V+++P++TIL+ KE I+K S++PA NQRLI+SGKILKD +TVE Y
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTA-------TPVAPNMAAGETGGFNPLSDL 113
           KI DG SIH+VKSG  SAN  KS    A T         + V  N+ +G+T GFNPL+DL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 114 TSARYAGY-LNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFI 172
           TSARYAGY L +PSAD FGPDGG+ N  PNQD+ML ML+NPVFQSQMNEMLSNPQM++++
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNM-PNQDDMLSMLENPVFQSQMNEMLSNPQMVEYM 179

Query: 173 IQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSD 232
           I +NPQLQA+GPQAR++ Q+P FRQMLTNPDMIRQSM+MAR M G     G G    SS 
Sbjct: 180 INSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSS- 238

Query: 233 FPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAA 292
           FPAPG  + +T S                            LFNP MNPF AG+ N  AA
Sbjct: 239 FPAPG--ETSTESATAEDNAAARNPAATNPAAANPANPFAALFNPGMNPF-AGLGNPAAA 295

Query: 293 GS----GNP--PAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRN 346
           GS    G P  P F+PS  ASM Q P  Q  QEDTRPPE RYE QLRQLNDMGFF+FDRN
Sbjct: 296 GSTGAPGTPQYPGFNPSMLASMLQQP-RQPAQEDTRPPEVRYESQLRQLNDMGFFEFDRN 354

Query: 347 VAALRRSGGNVESALNALLNGDV 369
           +AALRRSGG+V+ AL+ALLN DV
Sbjct: 355 IAALRRSGGSVQGALDALLNNDV 377

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 217/388 (55%), Positives = 259/388 (66%), Gaps = 31/388 (7%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSI++H+KSGQN W V+IDP+STI Q K  IA  SE+   NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQA---------NTTATPVA-------PNMAAGET 104
           KILD  S+H+VKSGG  + K  SP   A           T+TP A        N++ G+ 
Sbjct: 61  KILDDHSVHLVKSGG--SKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQG 118

Query: 105 GGFNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLS 164
            GFNPLSDLTSARYAG+LNLPSAD+FGPDGG+  S PN D++LRML+NPV QSQMNEMLS
Sbjct: 119 NGFNPLSDLTSARYAGFLNLPSADSFGPDGGMT-SAPNSDDVLRMLENPVMQSQMNEMLS 177

Query: 165 NPQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGN 224
           NPQM+DF+IQ +PQLQ+MGPQAR +LQ+P FRQM+TNPDMIRQSMQ +  +       G+
Sbjct: 178 NPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML------GGD 231

Query: 225 GQANTSSDFPAPG--GDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPF 282
             A   S FPAPG   + D                                  +PA NPF
Sbjct: 232 SAAGGGSSFPAPGTPAEADAPSQPAANPSAAPSAGTANPFASLLGGQAGASGASPAANPF 291

Query: 283 AAGMANTNAAGSGNPPAFDPSFFASMF-QPPAAQQQQEDTRPPEERYEHQLRQLNDMGFF 341
            + +   +A   G PPA DP   +S+     AA QQ +DTRPPEERYEHQLRQLNDMGFF
Sbjct: 292 LSMLGGGSA---GTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFF 348

Query: 342 DFDRNVAALRRSGGNVESALNALLNGDV 369
           +FDRNVAALRRSGG+V+ AL+ALLNGDV
Sbjct: 349 EFDRNVAALRRSGGSVQGALDALLNGDV 376

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/384 (54%), Positives = 255/384 (66%), Gaps = 29/384 (7%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M+IS+H+KSGQN W V I+ +STI   K++IA VSE+PA NQRLI+SGKILKDDQT+E Y
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPN----MAAGETGGFNPLSDLTSA 116
           KI DG SIHMVKSG  +   + +       T  P   N    M+ G   GFNPLSDLTSA
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176
           RYAGY NLPSAD FGPDGG + +  +QD+ML ML+NPVFQSQMNEMLSNP+++DF+I +N
Sbjct: 121 RYAGYTNLPSADMFGPDGG-SFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSN 179

Query: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAP 236
           PQLQ++GPQAR + Q+PMFRQMLTNPDMIRQSM+MA+ MNGG      G A+ SS FPAP
Sbjct: 180 PQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGG-----EGTASASS-FPAP 233

Query: 237 GG-------------DDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFA 283
           G               D N  +                            LF+P+MNP+A
Sbjct: 234 GDSTTTTQPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNPYA 293

Query: 284 AGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQ-EDTRPPEERYEHQLRQLNDMGFFD 342
           A       A +     F+P+ FA   Q  A   Q+ ED RPPEERYEHQLRQLNDMGFFD
Sbjct: 294 ALGGGNGNANN----MFNPAAFAQALQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFD 349

Query: 343 FDRNVAALRRSGGNVESALNALLN 366
           FD+NVAALRRSGG+V+ A+NALL+
Sbjct: 350 FDKNVAALRRSGGSVQGAVNALLS 373

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  362 bits (928), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 210/416 (50%), Positives = 257/416 (61%), Gaps = 57/416 (13%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           MSIS+HVKSGQN WQVS DP+S+I  LK+ IA+VS +PA NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVK------------SGGGSANKNKSPPPQANTTA---TPVAPNMAAGETG 105
           KI DG SIH+V+            +GG S +         N+TA   + V  N+ AG+ G
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 106 GFNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSN 165
           GFNPL+DLT ARYAGY NLPS D FGPDGGL NS   Q+E+L MLDNP+FQSQ+NEML+N
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGL-NSAIGQEEILGMLDNPIFQSQVNEMLAN 179

Query: 166 PQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNG 225
           PQM+DF+IQ +P LQAMGP AR++LQ+P FRQM+TNPD+IRQ  +    M        NG
Sbjct: 180 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRFQMDMGA-----ANG 234

Query: 226 QANTSSDFPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAG 285
           Q  +++DFPAPG  +++  +                            LFN   NPFAA 
Sbjct: 235 Q--STNDFPAPGSANNSATTS--GDNATLTSTGTGTNTNAAAANPLTSLFNAQSNPFAAM 290

Query: 286 MA---------NTNAAGSG---NP-----------------PAFDPSFFASMFQ---PPA 313
            A          TNA  +    NP                 P  DP+  +++        
Sbjct: 291 FAPPANSGPNPGTNAGATNSTTNPAAAFGADSQQPSRGFSLPPLDPAMLSALLSGGFTAT 350

Query: 314 AQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369
            +QQ ED RPPEERY+ QL QLN+MGF DFDRNVAALRRSGG+V+ ALNALLNGDV
Sbjct: 351 GRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  360 bits (923), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/388 (55%), Positives = 250/388 (64%), Gaps = 41/388 (10%)

Query: 3   ISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKI 62
           IS+HVKSGQNNW V I+ A+TI   KE I+ VS VPA NQRLI+SGKILKD +TVE YKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  LDGLSIHMVKSGGGSANKNKSPP------PQANTTATPVAPNMAAGETGGFNPLSDLTSA 116
            DG S+HMVKSGG SA    S        P A  +A P   N++AG+TGGFNPL+DLT A
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAP--SNISAGQTGGFNPLADLTGA 121

Query: 117 RYAGYLNLPSADTFGPDGGLNNS-GPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQA 175
           RYAG  NLPSAD FGPDGGLN+S G N + ML+ML+NP+FQSQMNEMLSNPQM+DF+IQ 
Sbjct: 122 RYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQ 181

Query: 176 NPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPA 235
           NPQLQA+GP+AR +LQ+P FRQM+T+P MIRQSMQMA +M  G+ P+G      +S FPA
Sbjct: 182 NPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM--GMSPDG-----AASAFPA 234

Query: 236 PGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFN------PAMNPFAAGMANT 289
           PG       +                            LF        A NPFA      
Sbjct: 235 PGSASGAGGANETSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPFAGLFP-- 292

Query: 290 NAAGSGNPPAFDPSFFASMF--------QPPAAQQQQEDTRPPEERYEHQLRQLNDMGFF 341
                G  P F+    ASMF          PA      D RPPEERYE QLRQLNDMGFF
Sbjct: 293 ----GGQQPQFNQELLASMFGGNSNATGAAPAV-----DNRPPEERYESQLRQLNDMGFF 343

Query: 342 DFDRNVAALRRSGGNVESALNALLNGDV 369
           DFDRNVAALRR+GG+V+ AL+ALLNGDV
Sbjct: 344 DFDRNVAALRRAGGSVQGALDALLNGDV 371

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  353 bits (907), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 201/373 (53%), Positives = 246/373 (65%), Gaps = 32/373 (8%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M+I I VKSGQN W+VS++ + ++ +LK+EIAKVSE+PA NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATP----VAPNMAAGETGGFNPLSDLTSA 116
           KI DG +IH+VKSGG  A    S     +T A      V  +++AG++GGFNPL+DLT A
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176
           RYAGY NLPS D FGPDGGLN S   Q+E++ ML+NP+FQSQMNEML+NPQM+DF+IQ +
Sbjct: 121 RYAGYTNLPSTDMFGPDGGLN-SAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQH 179

Query: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAP 236
           P LQAMGP AR++LQ+P FRQMLTNPD+IRQ  ++   M       G   A   +DFPAP
Sbjct: 180 PHLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRLQMGM-------GGAGAEQGTDFPAP 232

Query: 237 GGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPAMNPFAAGMANTNAAGSGN 296
           G       +                            L   A NP  A  A+   A    
Sbjct: 233 GSAATPDAAA----------------PAPNPLAAILGLQPGAANPLGAAPADRGLA---- 272

Query: 297 PPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGN 356
            P  DP+  +S+F   AA     D RPPEERYE QLRQLNDMGFFDFDRNVAALRR+GG+
Sbjct: 273 MPPLDPAMLSSLFGAGAASPAPADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGS 332

Query: 357 VESALNALLNGDV 369
           V+ AL+ALLNGDV
Sbjct: 333 VQGALDALLNGDV 345

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  303 bits (775), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/399 (50%), Positives = 248/399 (62%), Gaps = 62/399 (15%)

Query: 1   MSISIHVKSGQNNWQVSI--DPA-STILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTV 57
           M I++ VK GQN W V++  +P  +T+ Q KE +A V+ VP  NQRLI+SGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  EFYKILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAA------GETGGFNPLS 111
           E YKI DG ++H+VKSGG  +  + S   +A T A       AA      G+  GFNPL+
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 112 DLTSARYAGY-LNLPSADTFGPDGGLNNSGPNQ-----DEMLRMLDNPVFQSQMNEMLSN 165
           DLTSARYAGY L +PSAD FGPDGGL + G        +E+L ML+NP+FQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 166 PQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMN------GGV 219
           PQM+DF+IQ+NPQLQAMGPQAR++LQ+PMFRQMLTNPDM+RQSMQ ++ M       GG 
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 220 DPNGNGQANTSSDFPAPGGDDDNTVSEXXXXXXXXXXXXXXXXXXXXXXXXXXXLFNPA- 278
           DPN          FPAPGGDD    +                               PA 
Sbjct: 241 DPNA---------FPAPGGDDTGAPTNTSTNASAA---------------------GPAG 270

Query: 279 MNPFAAGMANTNAAGS---GNPPAFDPSFFASMFQ-----PPAAQQQQEDTRPPEERYEH 330
            NPF++      A  +    + P FD + F           PAA  Q  DTRPPEERYE 
Sbjct: 271 ANPFSSLFGGAPAPAAQPFQSAPGFDAAAFMQAMSRNGATAPAAAPQ--DTRPPEERYEQ 328

Query: 331 QLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369
           QLRQLNDMGF DFDRNVAALRR+GG+++ AL+ALLNGDV
Sbjct: 329 QLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 63.9 bits (154), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 111/246 (45%), Gaps = 36/246 (14%)

Query: 3   ISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKI 62
           IS+++K  +  + +  +    I  +  +I    ++P  NQRLI+SG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  LDGLSI------------HMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPL 110
            DG  I            H   +   + N N S  P +NT      P       G  N +
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTP------FGEGNII 115

Query: 111 SDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQ-ML 169
           +  T+          S D +G      +    + E+L++LD+P    Q NEML N Q +L
Sbjct: 116 TITTT----------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQNLL 164

Query: 170 DFIIQANPQLQAMGPQ-ARQILQNPMFRQMLTNPDMIRQSMQMAR-----AMNGGVDPNG 223
            F+IQ NP L+ M    ARQ+L++P  ++   + + + Q + + R     A NG   P  
Sbjct: 165 RFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGS 224

Query: 224 NGQANT 229
           + +  T
Sbjct: 225 SNETIT 230

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 49.3 bits (116), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V I  +  +  +KE + +   +P + QRLIF GK + D+QTV+  K+ DG+ +H+V
Sbjct: 15 VEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 1/97 (1%)

Query: 3  ISIHVKS-GQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61
          I+I+ K   +    + +DP ST+LQ K+++A          +LIFSGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 ILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPN 98
          + DG  +  + S   S     +  P +N  A   + N
Sbjct: 62 LKDGDQVIFMISKKRSTATKTTEAPVSNAAAEITSSN 98

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 35/56 (62%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V ++    I ++KE + +   +P + QRLIF GK + D QTV   K++DG+ +H+V
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + +  +  +  +K+ + +   +P + QRLIF GK + D+QTVE  
Sbjct: 1  MQIKVKTLTGKE-IAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KILDGLSIHMV 71
           ++DG+ +H+V
Sbjct: 60 NLIDGMQLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 36/56 (64%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V +   + I ++K+ + +   +P + QRLIF GK + D QT+E  K++DG+ +H+V
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V +DP   + ++KE + +   +P T QRLIF GK + DD++V    +  G+ +H+V
Sbjct: 15 VVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 36/56 (64%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          +S++    + ++KE + +   +P + QRLIF GK ++DDQTV+   +  G+ +H+V
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 45.8 bits (107), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V I     + ++KE + +   +P + QRLIF GK + D+QTV    ++DG+ +H+V
Sbjct: 15 VDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV---K 72
          V ++ +STIL  K ++A +        +LIFSGK+LKDDQTV    + D   + M+   K
Sbjct: 15 VELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMMISKK 74

Query: 73 SGGGSANKNKSPPPQA 88
              SA K   PP Q+
Sbjct: 75 KATPSATKVTEPPQQS 90

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V +     +  +KE + +   +PA+ QRLIF GK + +D T+   K+ DG+ +H+V
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MSISIHVKS-GQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEF 59
          M+I+IH K   +    + + P++TI + K+ +A+  +   +  ++IFSGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKILDGLSIHMVKSGGGSANKNKSPPPQANTTATP 94
           K+ DG  +  + S   +  +   P P +  +  P
Sbjct: 61 CKLKDGDQVIFMISKKKAETRVSEPEPASEPSGGP 95

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 45/80 (56%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMVKSGG 75
          + ++P++TI + K ++A+ +    +  +LI+SGK+L+D +TV    + DG  +  + S  
Sbjct: 16 LDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMISQK 75

Query: 76 GSANKNKSPPPQANTTATPV 95
           S     + PP A  TAT V
Sbjct: 76 KSTKTKVTEPPAAPETATTV 95

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V I     + ++KE + +   +P + QRLIF GK + D+Q+V    ++DG+ +H+V
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG-LSIHMVKSG 74
          + ++P++TI ++K ++A+      +  +LI+SGK+L+D +TV    + DG   + MV   
Sbjct: 16 LDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQK 75

Query: 75 GGSANKNKSPPPQANTTAT 93
            +  K   PP  A  TAT
Sbjct: 76 KSAKTKVTEPPVAAEPTAT 94

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG-LSIHMVKSG 74
          + ++P++TI + K ++A+ S    +  +LI+SGK+L+D +TV    + DG   + M+   
Sbjct: 16 LDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMISQK 75

Query: 75 GGSANKNKSPPPQANTTA 92
            +  K   PP    TTA
Sbjct: 76 KSTKTKVTEPPVVPETTA 93

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMVKSGG 75
          + ++P++TIL+ K ++A+      +  +LI+SGK+L+D +TV    + DG  +  + S  
Sbjct: 16 LDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQK 75

Query: 76 GSANKNKSPPPQANTTAT 93
           S     + PP A  +AT
Sbjct: 76 KSTKTKVTEPPIAPESAT 93

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG-LSIHMVKSG 74
          + +D  STI + K+ +A+  +   +  +LI+SGKIL+DD+T+  YK+ DG   I M+   
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQVIFMISKK 75

Query: 75 GGSANKNKSPPPQ 87
            +  K   PP +
Sbjct: 76 KSTTTKTTVPPSE 88

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%), Gaps = 3/95 (3%)

Query: 3  ISIHVKS-GQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYK 61
          +S+  K+  +  + + ++ + +I+ +KE +++      +  +LIFSGK+LKD  +VE   
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 62 ILDG-LSIHMVKSGGGSANK-NKSPPPQANTTATP 94
            DG   I MV +   +A K  +S  P+A +  TP
Sbjct: 62 FKDGNEVIFMVSAKKATATKVTESSAPKAQSEETP 96

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 31/49 (63%)

Query: 316 QQQEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           Q+  D    E  Y  Q+RQL +MGF D ++N+ AL++S GN+  A++ L
Sbjct: 178 QEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 36/50 (72%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG 65
          + ++ +ST+ + K+++A+  E   +  +LI+SGKIL+DD+T+  YK+ DG
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDG 65

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 40.0 bits (92), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P14796 Saccharomyces
           cerevisiae YKR094C RPL40B
          Length = 128

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   Q      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 36/53 (67%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSI 68
          + ++P++TIL +K ++A+      +  ++I+SGK+L+D QTVE  ++ +G  I
Sbjct: 16 LDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          V +  +  +  +KE + +   +P + QRLIF GK + D  TV    +++G+ +H+V
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGD 368
           +Y  QLR L DMGF D D NV AL    GN+   +N L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 1  MSISIHVKS-GQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEF 59
          M I+I+ K   +    + + P +TI + K+ +AK  +   +  ++IFSGK+L+D  T++ 
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKILDG 65
           K+ DG
Sbjct: 61 CKLKDG 66

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 39.3 bits (90), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V
Sbjct: 15 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 39.3 bits (90), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 5/73 (6%)

Query: 1  MSISIHVKSGQNNWQVSIDPAS--TILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVE 58
          M + +   +G+   ++S+D  S  T+  +KE + +   +P + Q+LIF GK + D+ T+ 
Sbjct: 1  MQLKVKTLTGK---EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIG 57

Query: 59 FYKILDGLSIHMV 71
             + DG  +H+V
Sbjct: 58 SADLQDGSLLHLV 70

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 12 NNWQVSID--PASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIH 69
             ++S+D   +ST+L  K+++A+  E   +  +LI+SGK+L+D  ++E   + DG  + 
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQVI 69

Query: 70 MVKSGGGSANKNKSPPPQANTTATP 94
           + S   S     + P ++   A P
Sbjct: 70 FMISKKKSTVTQVTEPTESKEVAAP 94

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
           {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {ON} 
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
           bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
           RPL40AFusion protein, identical to Rpl40Bp, that is
           cleaved to yield ubiquitin and a ribosomal protein of
           the large (60S) ribosomal subunit with similarity to rat
           L40; ubiquitin may facilitate assembly of the ribosomal
           protein into ribosomes
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
           128 aa] {ON}  RPL40BFusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV 71
          + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
           similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YKR094C RPL40B Fusion protein, identical to
           Rpl40Ap, that is cleaved to yield ubiquitin and a
           ribosomal protein of the large (60S) ribosomal subunit
           with similarity to rat L40; ubiquitin may facilitate
           assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {ON}
           Anc_5.701 YIL148W
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [387
           bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 bp,
           128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
           bp, 128 aa] {ON} highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)
          Length = 125

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV---- 71
           + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V    
Sbjct: 12  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 71

Query: 72  --------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPL 110
                   K+     N +KS   +      P A N    + G  N L
Sbjct: 72  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 118

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {ON}
           YKR094C (REAL)
          Length = 125

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV---- 71
           + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V    
Sbjct: 12  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 71

Query: 72  --------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPL 110
                   K+     N +KS   +      P A N    + G  N L
Sbjct: 72  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 118

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {ON}
           complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSICRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)
          Length = 124

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV---- 71
           + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V    
Sbjct: 11  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 70

Query: 72  --------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPL 110
                   K+     N +KS   +      P A N    + G  N L
Sbjct: 71  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 117

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, 128
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YKR094C (RPL40B) and YIL148W (RPL40A); 1-intron
          Length = 128

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
           bp, 128 aa] {ON} 
          Length = 128

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [387
           bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K      N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
           {ON} Anc_5.701
          Length = 128

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K      N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {ON}
           Anc_5.701
          Length = 128

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K      N +KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
           aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 aa]
           {ON} highly similar to uniprot|P61864 Saccharomyces
           cerevisiae YKR094c RPL40B and highly similar to
           uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLPPKATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)
          Length = 144

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMV---- 71
           + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y I    ++H+V    
Sbjct: 31  LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 90

Query: 72  --------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPL 110
                   K+     N +KS   +      P A N    + G  N L
Sbjct: 91  GGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQL 137

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
           {ON} 
          Length = 128

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K      N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKVLASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
           [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
           Saccharomyces cerevisiae YLR167W RPS31 and highly
           similar to uniprot|P04838 Saccharomyces cerevisiae
           YIL148W and highly similar to uniprot|P04838
           Saccharomyces cerevisiae YKR094C and highly similar to
           uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
           proteins that are cleaved to yield a ribosomal protein
           of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  K+   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKAVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369
           R+ HQLR L ++G+ D D NV AL  + G++  AL+ +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [450
           bp, 149 aa] {ON} 
          Length = 149

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 13/122 (10%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1   MQIFVKTLTGKTI-TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61  KILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFN 108
            I    ++H+V            K+     N  KS   +      P A N    + G  N
Sbjct: 60  NIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYARLPPRATNCRKRKCGHTN 119

Query: 109 PL 110
            L
Sbjct: 120 QL 121

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 20/129 (15%)

Query: 1   MSISIHVK-------SGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKD 53
           + + IH+K       +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D
Sbjct: 53  LLLHIHIKYSFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED 111

Query: 54  DQTVEFYKILDGLSIHMV------------KSGGGSANKNKSPPPQANTTATPVAPNMAA 101
            +T+  Y I    ++H+V            K      N +KS   +      P A N   
Sbjct: 112 GRTLSDYNIQKESTLHLVLRLRGGIIEPSLKVLASKYNCDKSVCRKCYARLPPRATNCRK 171

Query: 102 GETGGFNPL 110
            + G  N L
Sbjct: 172 RKCGHTNQL 180

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           +Y  QL++LNDMGF + D N  AL  S G++  AL+ L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 35.0 bits (79), Expect = 0.020,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGK 49
          M +++   +G+    V +DP+  + ++KE + +   +P T Q+LIF GK
Sbjct: 1  MKLTVKTLTGKE-IAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 36.6 bits (83), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 36.6 bits (83), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
           Ashbya gossypii ACL062C
          Length = 153

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMVKSGGGSA 78
            I    ++H+V    G A
Sbjct: 136 NIQKESTLHLVLRLRGGA 153

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  QL +L DMGF D ++N+ AL  + GN+  A++ L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 164 NIQKESTLHLV 174

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 240 NIQKESTLHLV 250

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 316 NIQKESTLHLV 326

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 392 NIQKESTLHLV 402

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 36.2 bits (82), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  QL +L DMGF D ++N+ AL  + GN+  A++ L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {ON}
           Anc_1.480 YEL037C
          Length = 368

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 14/91 (15%)

Query: 16  VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG-LSIHMV--- 71
           + +D +S++L  K ++A+  E      +LI+SGK+L+D ++++   + DG   I M+   
Sbjct: 16  LDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQVIFMISKK 75

Query: 72  ----------KSGGGSANKNKSPPPQANTTA 92
                     +S   SA  ++SP PQ+ T A
Sbjct: 76  KSTTTTVTEPQSKETSAPVSQSPAPQSETPA 106

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 35.8 bits (81), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 35.4 bits (80), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 35.4 bits (80), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..49546)
           [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV--KSGGG 76
            I    ++H+V    GGG
Sbjct: 136 NIQKESTLHLVLRLRGGG 153

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KILDGLSIHMV--KSGGG 76
            I    ++H+V    GGG
Sbjct: 290 NIQKESTLHLVLRLRGGG 307

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 214 NIQKESTLHLV 224

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 368 NIQKESTLHLV 378

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 444 NIQKESTLHLV 454

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  +LR L +MG+ D D N  AL  + G++  A++ L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL039C
           (UBI4)
          Length = 382

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMVKSGGGSA 78
            I    ++H+V    G A
Sbjct: 364 NIQKESTLHLVLRLRGGA 381

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  QL +L DMGF D ++N+ AL  + GN+  A++ L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+ K L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGLSIHMVKSGGGSA 78
            I    ++H+V    G A
Sbjct: 440 NIQKESTLHLVLRLRGGA 457

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 440 NIQKESTLHLV 450

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 516 NIQKESTLHLV 526

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 440 NIQKESTLHLV 450

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 516 NIQKESTLHLV 526

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
          M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDGLSIHMV 71
           I    ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60
           M I +   +G+    + ++ + TI  +K +I     +P   QRLIF+GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDGLSIHMV 71
            I    ++H+V
Sbjct: 364 NIQKESTLHLV 374

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
           {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037C RAD23
          Length = 383

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 22  STILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG----LSIHMVKSGGGS 77
           +TI   KE IA+  +  A+  +LI++GKIL+D +TV    + +G      I   K     
Sbjct: 21  ATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIFMISKTKKKADV 80

Query: 78  ANKNKSPPPQANTTATPVAPNMAAG 102
                +  PQ  + AT  A   A  
Sbjct: 81  KVTESTTEPQDESQATASAETSAVA 105

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALL--NGD 368
           +Y  +LR+L +MGF D D N  AL  + G++  A++ L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 25/38 (65%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           +Y  +LRQL ++GF +  +N+ A+  S G+V  AL+ L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 7/80 (8%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDGLSIHMVKSGG 75
          + ++ + T+L  K++IA   +   +  +LI+SGK+L++D T+    + DG  +  + S  
Sbjct: 16 LDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIFMIS-- 73

Query: 76 GSANKNKSPPPQANTTATPV 95
              K KS   +  T ATPV
Sbjct: 74 ----KKKSTGTKV-TEATPV 88

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 32/50 (64%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG 65
          ++++  +T+L  K ++A+      +  +LI+SGK+L+D +T+E   + DG
Sbjct: 16 LALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDG 65

>AGL185W Chr7 (350325..350477) [153 bp, 50 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YDR139C (RUB1)
          Length = 50

 Score = 31.2 bits (69), Expect = 0.42,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 15 QVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGK 49
          Q+ + P   + ++KE + +   +P + QRLIF GK
Sbjct: 14 QIDVAPEDKVYRIKELLEEQEGIPPSQQRLIFQGK 48

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
          bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 30/47 (63%)

Query: 2  SISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSG 48
          ++  +VK   N + +SI  ++T+ +LKE++ +++ VP + Q+ +  G
Sbjct: 5  TLEFNVKHSGNVYPISITSSTTVQELKEQVQELTNVPVSRQKFMVKG 51

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  +L +L +MGF D D N  A+  + G++  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTV 57
          + +D  STI   K +IA          +LI+SGKILK+D T+
Sbjct: 16 LELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATI 57

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           RY  QL +L DMG+ D  +N+ AL  + GN+  +++ L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>Ecym_4244 Chr4 complement(507884..508036) [153 bp, 50 aa] {ON}
          similar to Ashbya gossypii AGL185W
          Length = 50

 Score = 28.9 bits (63), Expect = 2.3,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 16 VSIDPASTILQLKEEIAKVSEVPATNQRLIFSGK 49
          + ++P   +  +KE + +   +P   QRLIF GK
Sbjct: 15 IDVEPEDRVYSIKELLEEKEGIPPAQQRLIFQGK 48

>NCAS0C00180 Chr3 (16537..17154) [618 bp, 205 aa] {ON} Anc_8.874
          YML095C
          Length = 205

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 18/34 (52%)

Query: 59 FYKILDGLSIHMVKSGGGSANKNKSPPPQANTTA 92
          F  IL G+     K GG   N+NK  PPQA TT 
Sbjct: 9  FQSILAGVKKLREKKGGEVINENKERPPQAETTT 42

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 286 MANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPP 324
           MA+ N A S   P  +P++  SM +PP+  +   + +PP
Sbjct: 353 MASFNLARSSKSPIMNPNYKMSMHRPPSLSKNSREMKPP 391

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 30/55 (54%)

Query: 11 QNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKILDG 65
          +    + +DP+S++   K  +A       +  +LI+SGK+L+D + ++   + DG
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDG 65

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 315 QQQQEDTRPPEERYEHQLRQLNDMGF-FDFDRNVAALRRSGGNVESALNAL 364
           +    D+R    +Y  QL +L DMG+  D  R   AL R+ G++  +L+ +
Sbjct: 186 RHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Kpol_1026.10 s1026 complement(20542..23088) [2547 bp, 848 aa] {ON}
           complement(20542..23088) [2547 nt, 849 aa]
          Length = 848

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%)

Query: 58  EFYKILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSAR 117
           E+ KI D    H   +   +AN ++  P Q++T  + V+P+M +G+   ++  S + S +
Sbjct: 631 EYSKITDHEMTHSTSAATSTANYSEPSPDQSSTNISGVSPSMTSGKFNAYSASSFIPSNK 690

Query: 118 YAG 120
             G
Sbjct: 691 SYG 693

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%)

Query: 327 RYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNAL 364
           +Y   ++ L  MG+ D D N  AL  + G++  A++ L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 23/108 (21%)

Query: 132 PDGGLNN--SGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFII--QANPQLQAMGPQAR 187
           PD G     S PN  E L+  +NP    +  E++ +PQ++  ++  Q+NPQ+  MGP   
Sbjct: 125 PDLGFGQMFSDPNMIEKLK--NNP----KTAELMKDPQLVSKVLQFQSNPQM--MGP--- 173

Query: 188 QILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPA 235
           +ILQ+P  R M     M+   + +      G D NG   A  S + PA
Sbjct: 174 EILQDP--RMMTIMAAMLGVDLSI------GGDSNGQEPAAPSKEAPA 213

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,420,621
Number of extensions: 1687456
Number of successful extensions: 5498
Number of sequences better than 10.0: 191
Number of HSP's gapped: 5525
Number of HSP's successfully gapped: 265
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)