Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C004208.839ON72572534790.0
NDAI0K004208.839ON77858523700.0
TDEL0B005808.839ON71363523670.0
KAFR0B039108.839ON72464523660.0
ZYRO0G14168g8.839ON76463923540.0
CAGL0M02959g8.839ON75859823160.0
Kpol_1068.98.839ON74564422600.0
Suva_13.4658.839ON73265522380.0
Smik_13.4908.839ON73265222370.0
YMR277W (FCP1)8.839ON73265322350.0
Skud_13.4498.839ON73465722340.0
TPHA0I002408.839ON73265021700.0
TBLA0D032608.839ON76868221610.0
KNAG0J002808.839ON74265521230.0
SAKL0D01496g8.839ON68863720830.0
Kwal_27.102638.839ON74363920230.0
Ecym_46108.839ON75164720100.0
ABL127W8.839ON72863919910.0
KLTH0C03894g8.839ON74561019690.0
KLLA0D01595g8.839ON71964519480.0
SAKL0G12870g5.202ON399601064e-04
NDAI0D018605.202ON514511064e-04
YLR019W (PSR2)5.202ON397431055e-04
Smik_12.825.202ON392431046e-04
NCAS0A068005.202ON4731331047e-04
Skud_12.875.202ON392451010.001
Kpol_478.165.202ON350921000.002
TPHA0E030705.202ON49451990.003
Kpol_1010.615.94ON932111990.003
Suva_10.995.202ON38542980.003
Skud_12.575.202ON41542980.003
NDAI0C032305.94ON103474970.007
ZYRO0B10428g5.202ON48240960.007
YLL010C (PSR1)5.202ON42740940.010
Suva_10.655.202ON41540940.011
Smik_12.535.202ON41440940.012
TPHA0N006705.202ON45242920.017
KAFR0E021405.94ON95165920.024
NDAI0I021705.202ON39140880.046
AAL158W5.202ON47840890.049
ZYRO0B15026g5.94ON1162113890.059
Kpol_1050.635.94ON105870880.069
NCAS0D027405.202ON39840860.090
Kpol_2002.1005.202ON47740860.090
CAGL0D05610g5.202ON44745860.093
SAKL0G15620g5.94ON879131870.094
TBLA0H019905.202ON68840870.097
NDAI0G016203.196ON73989860.11
TBLA0I014602.530ON393162850.11
TDEL0E042705.202ON45340850.12
CAGL0D03234g5.202ON41040850.12
Skud_8.492.530ON447109850.12
KNAG0M017405.202ON48140850.14
Smik_16.1728.527ON477100850.14
KLLA0F15620g5.202ON41440840.14
Ecym_71045.202ON49240850.14
TBLA0C060905.202ON484121850.14
KAFR0J009905.202ON48340840.17
Suva_16.2498.527ON480100840.17
KNAG0C058502.530ON443109830.20
KNAG0E005705.94ON981102840.21
SAKL0A09416g2.530ON385220820.24
CAGL0K02959g2.530ON464109820.30
Smik_8.532.530ON446162810.34
CAGL0L06644g5.94ON82875820.34
KAFR0A018302.530ON442109810.35
YPL063W (TIM50)8.527ON476100810.43
KLTH0B03388g5.202ON40960790.67
TPHA0H010705.94ON101595790.71
Kwal_33.151405.202ON41060790.74
KLTH0C01584g5.94ON91388790.85
Skud_16.2188.527ON480100780.93
YHR004C (NEM1)2.530ON446109780.96
TBLA0A005408.527ON485100761.5
KLLA0E23101g8.527ON480106761.5
NCAS0C022108.527ON491100761.5
Kwal_55.219147.518ON264259761.8
KLLA0E15621g5.94ON89188761.9
CAGL0B04609g2.170ON22173742.0
Suva_12.595.172ON34655742.2
Kpol_348.82.530ON422110742.9
YGL195W (GCN1)8.155ON2672110743.6
CAGL0H05159g8.527ON485100733.9
ADR369C7.46ON82789734.0
Suva_8.582.530ON452106724.1
KLTH0F11000g3.407ON97366734.5
Ecym_20665.94ON88079726.1
Kwal_27.119908.527ON474100708.0
KNAG0A020608.527ON450100708.1
SAKL0D01628g8.833ON295103698.8
KLTH0E12254g8.527ON476100709.3
TBLA0B073905.94ON103191709.6
TPHA0I020008.527ON478100699.7
TDEL0B031908.527ON477106699.7
Kwal_27.124913.319ON30635699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00420
         (725 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...  1344   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   917   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   916   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   915   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   911   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   896   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   875   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   866   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   866   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   865   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   865   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   840   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   837   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   822   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   806   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   783   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   778   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   771   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   763   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   754   0.0  
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    45   4e-04
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     45   4e-04
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    45   5e-04
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    45   6e-04
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    45   7e-04
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    44   0.001
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    43   0.002
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    43   0.003
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    43   0.003
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    42   0.003
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    42   0.003
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    42   0.007
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    42   0.007
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    41   0.010
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    41   0.011
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    41   0.012
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    40   0.017
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    40   0.024
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     39   0.046
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    39   0.049
ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa...    39   0.059
Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON} (138...    39   0.069
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    38   0.090
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    38   0.090
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    38   0.093
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    38   0.094
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    38   0.097
NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.1...    38   0.11 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    37   0.11 
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    37   0.12 
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    37   0.12 
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    37   0.12 
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    37   0.14 
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    37   0.14 
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    37   0.14 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    37   0.14 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.14 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    37   0.17 
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    37   0.17 
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    37   0.20 
KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94 ...    37   0.21 
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...    36   0.24 
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...    36   0.30 
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    36   0.34 
CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some ...    36   0.34 
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...    36   0.35 
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    36   0.43 
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    35   0.67 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    35   0.71 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    35   0.74 
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    35   0.85 
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    35   0.93 
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    35   0.96 
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    34   1.5  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    34   1.5  
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     34   1.5  
Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR...    34   1.8  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    34   1.9  
CAGL0B04609g Chr2 (446314..446979) [666 bp, 221 aa] {ON} highly ...    33   2.0  
Suva_12.59 Chr12 complement(79718..80758) [1041 bp, 346 aa] {ON}...    33   2.2  
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...    33   2.9  
YGL195W Chr7 (131525..139543) [8019 bp, 2672 aa] {ON}  GCN1Posit...    33   3.6  
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    33   3.9  
ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}...    33   4.0  
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    32   4.1  
KLTH0F11000g Chr6 (934247..937168) [2922 bp, 973 aa] {ON} some s...    33   4.5  
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    32   6.1  
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    32   8.0  
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    32   8.1  
SAKL0D01628g Chr4 complement(131292..132179) [888 bp, 295 aa] {O...    31   8.8  
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    32   9.3  
TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]...    32   9.6  
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    31   9.7  
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    31   9.7  
Kwal_27.12491 s27 (1239393..1240313) [921 bp, 306 aa] {ON} YBL03...    31   9.7  

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/725 (91%), Positives = 663/725 (91%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWF                 TA
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
           GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180
           EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI
Sbjct: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180

Query: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240
           HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG
Sbjct: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240

Query: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300
           LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL
Sbjct: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300

Query: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360
           FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE
Sbjct: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360

Query: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420
           KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE
Sbjct: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420

Query: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480
           YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA
Sbjct: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480

Query: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540
           DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT
Sbjct: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540

Query: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600
           KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK
Sbjct: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600

Query: 601 LAKRQLLATANENLSPANGTNSAELELFSGGMSWLXXXXXXXXXXXXXXXXXXXXXXXXX 660
           LAKRQLLATANENLSPANGTNSAELELFSGGMSWL                         
Sbjct: 601 LAKRQLLATANENLSPANGTNSAELELFSGGMSWLDDDEGDILDSDEEEEEDAEEEDEEQ 660

Query: 661 XXXXXQNNKEENMTNGKNTRGPTKRLHSDYNEEAIEAKKVRPSKXXXXXXXXXXXXXXXM 720
                QNNKEENMTNGKNTRGPTKRLHSDYNEEAIEAKKVRPSK               M
Sbjct: 661 EDGEGQNNKEENMTNGKNTRGPTKRLHSDYNEEAIEAKKVRPSKEEEEEESDSDLEDELM 720

Query: 721 NMLDS 725
           NMLDS
Sbjct: 721 NMLDS 725

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/585 (75%), Positives = 502/585 (85%), Gaps = 14/585 (2%)

Query: 64  SIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGEEVD 123
           ++RESIEFF+ PY G L SW V+ GD+I  PNQ L EI RPCNHDV+YGGLCTLCG+EVD
Sbjct: 108 TVRESIEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVD 167

Query: 124 EDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVIHCG 183
           E+D D   SG NLTISHTDTNLKISTREA+DIG +V+ RLR +KKL+LVVDLDQTVIHCG
Sbjct: 168 ENDID-DLSGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCG 226

Query: 184 VDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPGLKE 243
           VDPTIGEWK DP NPNFETLKDVK+F+LEEEPILP +YMGPKPP RKCWYYVKVRPGLK+
Sbjct: 227 VDPTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKD 286

Query: 244 FLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERLFPT 303
           F +K+APLFEMHIYTMATRAYASEIAKIIDP GDLFG+RILSRDENGS+TTKSLERLFPT
Sbjct: 287 FFQKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPT 346

Query: 304 DQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR-----S 358
           DQSMVI+IDDRGDVWNWSPNLIKV+PYNFFVGVGDINSNFLPKQQATMLQLGRR     S
Sbjct: 347 DQSMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGES 406

Query: 359 REKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKK 418
           +  +K+ +DLL DIMD+EK L+ KI++EVKRQEE+L+HQ AT EEPPT+AGENKEEISKK
Sbjct: 407 KVSTKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKK 466

Query: 419 IEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGE- 477
           IEYSASLEVQQ+NRPLA LQKHFHDQRLLIDDD+ELYHLKDTL +IH KYY +L+K  E 
Sbjct: 467 IEYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANEN 526

Query: 478 ---LKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEK 534
              ++ DIK IMP MKQ VL +C FVFSGLIPLGT+IQ++DIVIWTN FGA ST+DIDE 
Sbjct: 527 KDSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDEN 586

Query: 535 TTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETEL 594
           TTHVITKTPGTYKARLAKS++P IKI+HPDWVFECL  WKHV+EKPYEL+VEQ VS+ EL
Sbjct: 587 TTHVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKEL 646

Query: 595 EEFKKKLAKR-QLLATANENLS---PANGTNSAELELFSGGMSWL 635
            +F +KL +R QL    +E L    P    +  E+ LF+GG SWL
Sbjct: 647 ADFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/39 (66%), Positives = 32/39 (82%)

Query: 3  TQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWF 41
          T I AP+GLPYPITID+L+  +G E+ K DRLLAYKFW+
Sbjct: 5  TVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWY 43

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/635 (67%), Positives = 516/635 (81%), Gaps = 10/635 (1%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T + +P  LPYPITIDQLI  +G  V+KG RL A+KFW+                   
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHR--- 57

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KK++RESIEFFE+P++G L+SWNVD+GDE+ +PNQ + EI RPCNHD+VYGGLCTLCG+
Sbjct: 58  -KKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116

Query: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180
           EVDE +        NL ISHTD NLK+S +EA DI  N++TRLR+ KKLVLVVDLDQTVI
Sbjct: 117 EVDESEQ----FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVI 172

Query: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240
           HCGVDPTIGEWK D  NPN+E LKDV+ F+L+EEPILP LYMGPKPP+RKCWYYVKVRPG
Sbjct: 173 HCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPG 232

Query: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300
           LKEF +K+APLFEMHIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLERL
Sbjct: 233 LKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERL 292

Query: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360
           FPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLP+QQ TMLQLGR +R+
Sbjct: 293 FPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARK 352

Query: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420
           K++++++L+ DIMD+EKKL+EKID+EVKRQEE+L+HQ A+ EE P  A E+K++++KK+E
Sbjct: 353 KTQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVP--APESKDQLAKKLE 410

Query: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480
           YSASLEVQQQNRPLA LQKH H+QRLL+DDDDEL +L++ L ++HD+YY  L +D E KA
Sbjct: 411 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKA 470

Query: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540
           DIK ++P MK  V ++C FVFSGLIPLGT+I RADIV+WTN FGA S+ +ID+ TTHVIT
Sbjct: 471 DIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVIT 530

Query: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600
           +TPGTYKAR+AK+FN  IK++HPDWVFECL SWKHVDEKPYELIVEQ  ++ EL ++K+K
Sbjct: 531 RTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQK 590

Query: 601 LAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635
           LA+R       E         +  + LF+GG SWL
Sbjct: 591 LARRSSALAEQEMELAMESAKNGTINLFAGGTSWL 625

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  915 bits (2366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/645 (68%), Positives = 528/645 (81%), Gaps = 14/645 (2%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T +LAP GLPYPITID+LI  +G  ++KG RL AYKFW+                 T 
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 61  G---KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117
               KK IRESIEFF++P++G LISWN+D+GDE++S +QV+ EI RPCNHD+VYGGLCT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177
           CG+EVDE  ++ S  G+N T+SHTDTNLKIS +EALDIG + + RLR EKKLVLVVDLDQ
Sbjct: 121 CGKEVDE--SEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQ 178

Query: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237
           TVIHCGVDPTIGEWK+DP NPN++TLKDV+ F+LEEEP+LP +YMGPKP  RKCWYYVKV
Sbjct: 179 TVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKV 238

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297
           RPGLKEF +K+APLFEMHIYTMATRAYA EI KIIDP G+LFG+RILSRDENGS+T+KSL
Sbjct: 239 RPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSL 298

Query: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357
           ERLFPTDQSMVI+IDDRGDVWNWSPNLIKVVPY+FFVGVGDINSNFLPKQQ TMLQLGRR
Sbjct: 299 ERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRR 358

Query: 358 SREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISK 417
           SREK+K+ ++LL DIMD+EKKL+EKID+EVKRQE+ LSHQ   TEE  + + E KEE +K
Sbjct: 359 SREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEE--SVSNETKEEWTK 416

Query: 418 KIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVL--KKD 475
           K+E+SAS+EVQQQNRPLAALQ+H H+QRLLIDDDDELY LKDTL ++H++YY++L  K  
Sbjct: 417 KLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSL 476

Query: 476 GELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKT 535
            E  ADIKLIMP +KQ+V + C FVFSGLIPL TDI+RADIV+WT+ FGA S+S+I+E T
Sbjct: 477 DESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVT 536

Query: 536 THVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELE 595
           THVITKTPGT+KARLAKSFN  IKI+HPDWVFECL  W HVDEKPY LIVE+P+S+ EL+
Sbjct: 537 THVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELK 596

Query: 596 EFKKKLAKRQLLATANE-NLSPANGT----NSAELELFSGGMSWL 635
           +F++ L  R+L    NE N     GT        ++LF+ G SWL
Sbjct: 597 KFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWL 641

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/639 (66%), Positives = 516/639 (80%), Gaps = 10/639 (1%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T ++AP  LPYPITIDQLI  +G  V+KG RL AYKFW+                   
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KK++RESIEFFESP++G L+SW VD GDE+AS  QV+ EI+RPCNHDVVYGGLCT+CG+
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180
           EVDE+D       ANL ISHTDTNLK+S +EA D+   ++ RLR+ KKLVLVVDLDQTVI
Sbjct: 121 EVDENDQ----MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVI 176

Query: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240
           HCGVDPTIGEWK DP NPN+ETLKDV+ FSLEEEPI+P +YMGP+ P RKCWY+VKVRPG
Sbjct: 177 HCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPG 236

Query: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300
           L+EF  ++APL+EMHIYTMATR YA EIAKIIDP+G LFGDRILSRDENGS+T KSLERL
Sbjct: 237 LREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERL 296

Query: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360
           FPTDQSMVIVIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLP+QQ+ +LQLGRR+ +
Sbjct: 297 FPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHK 356

Query: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420
           K +++++LL DIMD+EK+L+EKID+EVKRQEE+LSHQ  T +EP    GE+KE+++KK+E
Sbjct: 357 KPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEP--VQGESKEQLTKKLE 414

Query: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480
           YSASLEVQQQNRPLA LQKH H+QRLL+DDDDELY+LKDTL +IH KYY +L +  E  A
Sbjct: 415 YSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSA 474

Query: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540
           DI+ ++P MK  V  +C FVFSGLIPLGT+I+RADIV+WT  FGAI++S+IDE TTHVIT
Sbjct: 475 DIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVIT 534

Query: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600
           KTPGTYKAR+AK FN  +K++HPDWVFECL +W HVDEKPYELI++ P +E E+++FK+K
Sbjct: 535 KTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFKRK 594

Query: 601 LAKRQLLATAN----ENLSPANGTNSAELELFSGGMSWL 635
           + +R L+        E+ +       + L LF+GG SWL
Sbjct: 595 IEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/598 (71%), Positives = 498/598 (83%), Gaps = 10/598 (1%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXX--- 57
           MST +L P+GLPYPIT+D+L+  +G  V+KG RL AYKFW+                   
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 58  XTAGKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117
               K+ +RESIEF+E+P++G L+SWNVD  DEIA PN  + EI RPCNHD+VYGGLCT+
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177
           CG+EVDE D       ANLTISHTDTNL++S +EA+D+   + TRL+ EKKLVLVVDLDQ
Sbjct: 121 CGKEVDEYDQ----VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQ 176

Query: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237
           TVIHCGVDPTIGEWK DP NPN+ETLKDVK FSLEEEPILP +YMGPKPP+R CWYYVK+
Sbjct: 177 TVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKI 236

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297
           RPGLKEF EKIAPL+EMHIYTMATRAYA EIAKIIDP+  LFGDRILSRDENGS+T KSL
Sbjct: 237 RPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSL 296

Query: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357
            RLFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFLPKQQ TMLQLGRR
Sbjct: 297 TRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRR 356

Query: 358 SREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISK 417
           +R+K K++E+LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE  ++  E+KE+I+K
Sbjct: 357 TRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEE--STDQESKEKIAK 414

Query: 418 KIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGE 477
           K+E+SASLEVQQQNRPLA LQKH HDQRLLIDDDDEL++LKDTL  IH ++Y++L+   +
Sbjct: 415 KLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASD 474

Query: 478 L-KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536
             +ADI +++P +K+ V   C FVFSGLIPLGTDI+RADIVIWT+ FGA STSDIDE TT
Sbjct: 475 QNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTT 534

Query: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETEL 594
           HV+TKTPGTYKARLAK+FNP IK++HPDW+FECL SWK +DEKPY LIVEQPVSE EL
Sbjct: 535 HVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDEL 592

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/644 (64%), Positives = 504/644 (78%), Gaps = 16/644 (2%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           MST + AP+GLPYPITI +LI  +G  V+KG RL AYKFW+                   
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KKSIRESIEFF+SP++G L+SWNVD+GDEI  PNQ + EI+RPCNHD+VY G+CT+CG+
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180
           EVDE D       ANLTISHTDTNLK+S REA DIG  ++ RL +EKKL+LVVDLDQTVI
Sbjct: 121 EVDESDQ----VSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVI 176

Query: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240
           HCGVDPTI EWKNDP NPNFETL+DVK F LEEEPILP +YMGPKPP  KCWYYVK+RPG
Sbjct: 177 HCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPG 236

Query: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300
           LKEF E+++ L+EMHIYTMATR+YA EIAKIIDP+G LF DRILSR+ENGS+T KSLERL
Sbjct: 237 LKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERL 296

Query: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360
           FPTDQSMV+VIDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQLGRR+ +
Sbjct: 297 FPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHK 356

Query: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420
           K++DT++LL DIMD+EKKL+EKID+EVKRQEE LSHQSA   E   S+   KE+I+KKIE
Sbjct: 357 KTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGE-EISSQVRKEDITKKIE 415

Query: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480
           +SASLEVQQQNRPLA LQKH H+Q+LL DDDDEL++LKD L  +  KYY  LK D E++ 
Sbjct: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKEIQ- 474

Query: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540
            I+ +MP +K+ VL+ C FVFSGLIPLGT+IQ+ADIV+WTN FGA S++DI E TTHVIT
Sbjct: 475 -IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVIT 533

Query: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600
           KTP TYKA++AK+F   IK+LHPDWVFECL +WK++ E PYE  +    ++ EL EFK+ 
Sbjct: 534 KTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEA 593

Query: 601 L------AKRQLLATANENL---SPANGTNSAELELFSGGMSWL 635
           L        +  +  + E+L   S +  +  A ++LF+ G SWL
Sbjct: 594 LERRKKKETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWL 637

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/655 (64%), Positives = 511/655 (78%), Gaps = 32/655 (4%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+TQI +P GLPYPI ID+LI  VG  +Q+GDRLL YKFW+                 + 
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 61  GK----------KSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVV 110
           G           K +RESIEFFESPY+G LISWNVD+GDEIA+ NQV+ EI RPCNHD+V
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 111 YGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLV 170
           YGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KKL+
Sbjct: 121 YGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDKKLI 175

Query: 171 LVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG-----PK 225
           LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM      PK
Sbjct: 176 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPK 235

Query: 226 PP-LRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRIL 284
           PP +RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDRIL
Sbjct: 236 PPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRIL 295

Query: 285 SRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFL 344
           SRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNFL
Sbjct: 296 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 355

Query: 345 PKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEP 404
           PKQ   MLQLGR++R+KS+++++L+ DIMD+EKKL+EKID EVKRQEE+L+HQ AT EEP
Sbjct: 356 PKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATAEEP 415

Query: 405 PTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRI 464
             SA E+KEE++KK+EYSASLEVQQQNRPLA LQKH HDQ+LL+DDDDEL++L  TL+ I
Sbjct: 416 --SANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNI 473

Query: 465 HDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFG 524
           H  YY +L + GE++ ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TFG
Sbjct: 474 HKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFG 533

Query: 525 AISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELI 584
           A STSDI+  TTH+ITK PGTYKARLAK FNP+IK++HPDW+FECL +WK VDEKPY LI
Sbjct: 534 ATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLI 593

Query: 585 VEQPVSETELEEFKKKLAKRQ-LLATANEN---LSPANGTNSAELELFSGGMSWL 635
           V+ P+S+ EL+ F+K+L K+Q  L   +E    L P    N     LF+ G SWL
Sbjct: 594 VDSPISDDELQSFQKQLQKKQEYLDEHHEQQHMLMPQENIN-----LFAAGTSWL 643

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/652 (64%), Positives = 503/652 (77%), Gaps = 25/652 (3%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+TQI +P GLPYPI ID+LI  VG  + +GDRLL YKFW+                 + 
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 61  G-----------KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDV 109
           G            K +RESIEFFESPY+G LISWNVD+GDE+A+ NQV+ EI RPCNHD+
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 110 VYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKL 169
           VYGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KKL
Sbjct: 121 VYGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRTGKALKEHLRRDKKL 175

Query: 170 VLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPK---- 225
           +LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM       
Sbjct: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVL 235

Query: 226 --PPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRI 283
             PP+RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G LFGDRI
Sbjct: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFGDRI 295

Query: 284 LSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNF 343
           LSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNF
Sbjct: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355

Query: 344 LPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403
           LPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE
Sbjct: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEE 415

Query: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463
           PP  A E+KEE++KK+EYSASLEVQQQNRPLA LQKH HDQ+LL+DDDDELY+L  TL  
Sbjct: 416 PP--ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523
           IH  YY +L ++ E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TF
Sbjct: 474 IHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTSTF 533

Query: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583
           GA STSDID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY L
Sbjct: 534 GATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYTL 593

Query: 584 IVEQPVSETELEEFKKKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635
           IV+ P+S+ EL+ F+ +L KRQ     N+       T+   L LF+ G SWL
Sbjct: 594 IVDSPISDEELQNFQSQLQKRQEYLEENQE-QQHMLTSQENLNLFATGTSWL 644

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/653 (64%), Positives = 503/653 (77%), Gaps = 27/653 (4%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+TQI +P GLPYPI ID+LI  VG  + +GDRLL YKFW+                 + 
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 61  G-----------KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDV 109
           G            K +RESIEFFESPY+G LISWNVD+GDE+A+ NQV+ EI RPCNHD+
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 110 VYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKL 169
           VYGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KKL
Sbjct: 121 VYGGLCTQCGKEVSADAFD----GVPLDVV-GDVDLQISETEAIRTGKALKEHLRRDKKL 175

Query: 170 VLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPK---- 225
           +LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM       
Sbjct: 176 ILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSML 235

Query: 226 --PPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRI 283
             PP+RKCWYYVKVRPGLKEF  K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDRI
Sbjct: 236 RPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRI 295

Query: 284 LSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNF 343
           LSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSNF
Sbjct: 296 LSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNF 355

Query: 344 LPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403
           LPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT EE
Sbjct: 356 LPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAEE 415

Query: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463
           PP  A E+KEE++KK+EYSASLEVQQQNRPLA LQKH HDQ+LL+DDDDELY+L  TL  
Sbjct: 416 PP--ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSN 473

Query: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523
           IH  YY++L +  E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+TF
Sbjct: 474 IHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 533

Query: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583
           GA ST DID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY L
Sbjct: 534 GATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTL 593

Query: 584 IVEQPVSETELEEFKKKLAKRQ-LLATANENLSPANGTNSAELELFSGGMSWL 635
           IV+ P+S+ EL+ F+ +L KRQ  L    E       T+   L LF+ G SWL
Sbjct: 594 IVDSPISDEELQNFQTQLQKRQEYLEETQEQQHML--TSQENLNLFAAGTSWL 644

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/657 (63%), Positives = 505/657 (76%), Gaps = 34/657 (5%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+TQI +P GLPYPI ID+L+  VG  + +GDRL+ YKFW+                   
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 61  GK------------KSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHD 108
                         K +RESIEFFESPY+G LISWNVD+GDEIA+ NQV+ EI RPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 109 VVYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKK 168
           +VYGGLCT CG+EV  D  D    G  L +   D +L+IS  EA+  G  ++  LR++KK
Sbjct: 121 IVYGGLCTQCGKEVSADAFD----GVPLDVV-GDMDLQISETEAIRSGEALKEHLRRDKK 175

Query: 169 LVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPK--- 225
           L+LVVDLDQT+IHCGVDPTI EWKNDP NPNFETL+DVK F+L+EE +LP +YM      
Sbjct: 176 LILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSV 235

Query: 226 ---PPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDR 282
              PP+RKCWYYVKVRPGLKEF +K+APLFEMHIYTMATRAYA +IAKI+DP G+LFGDR
Sbjct: 236 LKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDR 295

Query: 283 ILSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSN 342
           ILSRDENGS+TTKSL +LFPTDQSMV+VIDDRGDVWNW PNLIKVVPYNFFVGVGDINSN
Sbjct: 296 ILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSN 355

Query: 343 FLPKQQATMLQLGRRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTE 402
           FLPKQ   MLQLGR++R+KS+++++LL DIMD+EKKL+EKID+EVKRQEE+L+HQ AT E
Sbjct: 356 FLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLATAE 415

Query: 403 EPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLV 462
           EP  SA E+KEE++KK+EYSASLEVQQQNRPLA LQKH HDQ+LL+DDDDELY+L  TL 
Sbjct: 416 EP--SANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 473

Query: 463 RIHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNT 522
            IH+ YY ++ +  E + ++  I+P++KQ V  NC FVFSGLIPLGTDIQR+DIVIWT+T
Sbjct: 474 NIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTST 533

Query: 523 FGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYE 582
           FGA STSDID  TTH+ITK P TYKARLAK FNP+IKI+HPDW+FECL +WK VDEKPY 
Sbjct: 534 FGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYT 593

Query: 583 LIVEQPVSETELEEFKKKLAKRQLLATANEN----LSPANGTNSAELELFSGGMSWL 635
           LIV+ P+S+ EL+ F+K+L KRQ     N+     L+P    N     LF+ G SWL
Sbjct: 594 LIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLN-----LFAAGTSWL 645

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/650 (63%), Positives = 504/650 (77%), Gaps = 20/650 (3%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T +  P G+PYPITI +LI  VG  + KGDRL AYKFW+                   
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 61  G---KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117
           G   KK+IRESI+FF++P++G +I WNVD+GDEI  P +++ E+ RPC+HD+VY G+CT+
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 118 CGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177
           CG+EVDE D       ANLTISHTDTNLK+S +EA +IG   ++RL + KKL+LVVDLDQ
Sbjct: 121 CGKEVDERDQ----VSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQ 176

Query: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237
           TVIHCGVDPTI EWKNDP NPN+ETL++VK F LEEE ILP +YMGPKPP+ KC YYVKV
Sbjct: 177 TVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKV 236

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297
           RPGLKEF EK+AP++EMHIYTMATRAYA EIAKIIDP+G LFG+RILSRDENGS+T KSL
Sbjct: 237 RPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSL 296

Query: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357
           ERLFPTDQSMV++IDDRGDVWNWSPNLIKV PYNFFVG+GDINSNFLP+QQATMLQ+GRR
Sbjct: 297 ERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRR 356

Query: 358 SREK--SKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEI 415
           +      K++E+LL DI+D+EKKL+EKID+EVKRQE +L+H+SA   E   +   N  +I
Sbjct: 357 NHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNG-DI 415

Query: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLK-K 474
           +KKIE+SASLEVQQQNRPLA LQKH H+Q+LL DDDDEL +LK+ L  +  ++Y  L+ K
Sbjct: 416 TKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELK 475

Query: 475 DGEL-KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDE 533
           +G      I+ +MP +K++V  +C FVFSGLIPLGTDIQ+ADIV+WT  FGA STS+I E
Sbjct: 476 NGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITE 535

Query: 534 KTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETE 593
            TTHVITKTPGT KAR+AKSFNP IK++HPDWVFECL++WKHVDEK +EL V+Q  SE E
Sbjct: 536 NTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASERE 595

Query: 594 LEEFKKKLAKR---QLLATANENLSPANGTNSAE-----LELFSGGMSWL 635
           LEEFKK L KR   +L    N +    NGT +       ++LF+GG SWL
Sbjct: 596 LEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/682 (62%), Positives = 504/682 (73%), Gaps = 55/682 (8%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           MST +L+P  LP+PITIDQLIT +G  V+KG RL AYKFW+                 ++
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 61  G------------------KKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEII 102
                              KKSIRESIEFFESP++G LI WNVD GDEI S NQ+L +I 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 103 RPCNHDVVYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTR 162
           RPCNHD+VY G+CT CG+EVD    D+    A+L+ISHTDTNLKIS +EA DI  +  +R
Sbjct: 121 RPCNHDIVYAGICTQCGKEVD----DSDIMDASLSISHTDTNLKISRKEARDIDQSSMSR 176

Query: 163 LRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYM 222
           L+K KKL+LVVDLDQTVIHCGVDPTIGEWKNDPKNPN+ETLKDV+ FSL+EEPILP  YM
Sbjct: 177 LKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYM 236

Query: 223 GPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDR 282
           GP+PP+RKCWYYVKVRPGLKEF  KIAPL+EMHIYTMATRAYA EIAKIIDP+G LFG R
Sbjct: 237 GPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSR 296

Query: 283 ILSRDENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSN 342
           ILSRDENGS+T KSLERLFPTDQSMVI+IDDRGDVWNW  NLIKV+PYNFFVG+GDINSN
Sbjct: 297 ILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSN 356

Query: 343 FLPKQQATMLQLGRRSREK--------SKD--------------TEDLLIDIMDSEKKLK 380
           FLP+QQ+TMLQLG RS +K        S+D              TE+LL DIMD+EKKL+
Sbjct: 357 FLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQ 416

Query: 381 EKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKH 440
           +KID+EV+RQE++L        +  +    N  E+SKKIE+SASLEVQQQNRPLA LQ+H
Sbjct: 417 KKIDEEVRRQEKKLIKDEMPKRKSISDESSNN-ELSKKIEFSASLEVQQQNRPLATLQRH 475

Query: 441 FHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFV 500
             +QRLLIDDDDEL++LKD L  +HD +Y  L +D      I+ +MP +K +V     FV
Sbjct: 476 RQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFV 535

Query: 501 FSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKI 560
           FSGLIPLGTDI+RADIV+WTN FGA ST+DIDE TTHVITKT GTYKARLAK+FNP+IK+
Sbjct: 536 FSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKV 595

Query: 561 LHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK-------LAKRQLLATANEN 613
           +HPDW+FECL SWK + EKPYELI+EQP SE ELEEFKKK       L KR++   A   
Sbjct: 596 VHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEAQ-- 653

Query: 614 LSPANGTNSAELELFSGGMSWL 635
              A  T    ++LF+ G SWL
Sbjct: 654 -FEALNTRDPAIDLFASGTSWL 674

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/655 (62%), Positives = 502/655 (76%), Gaps = 24/655 (3%)

Query: 3   TQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA-- 60
           T +++  GLPYP+T+D+LI  VGD V +GDRL AYKFW+                 T   
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KKS+RES+EFFESP++G ++SW+VD GDEI  P   L  + RPCNHDVVY GLCTLCG 
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 121 EVDEDD-----NDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDL 175
           EVDE +       + G G NLT+SH DTNL+IS  EA  + L ++ RLR  +KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 176 DQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPL-RKCWYY 234
           DQTV+HCGVDPTIGEWK DP+NPN+E L+DV+ F+LEEEPILP LY+G K P  RKCWYY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 235 VKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTT 294
           VKVRPGLK+F +++APLFEMHIYTMATRAYA EIAKIIDP+  LFGDRILSRDENGS+T 
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 295 KSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQL 354
           KSLERLFPTDQSMV VIDDRGDVWNW  NLIKVVPYNFFVGVGDINSNFLPKQQ TMLQ+
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 355 GRRSR-----EKSKDTED------LLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403
           GRRS+      +SK  +D      LL DIM++EK+L+EKIDQEVKRQE +L+  +A  +E
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463
             T  G++KEE +KK+E+SAS+EVQQ+NRPLA LQKH H+Q+LL+D+DDEL++LKD L  
Sbjct: 427 QQT-PGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485

Query: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523
           +H +YY+ LK++ +   +I+ IM  +K  V  +C FVFSGLIPL T++Q ADIVIWTN F
Sbjct: 486 LHKRYYSTLKENPQ-DTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKF 544

Query: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583
           GA +T+D+DE TTH+ITKTPGT KARLAK+FNP IKI+HPDW+FECL  W+ VD KPY L
Sbjct: 545 GATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLL 604

Query: 584 IVEQPVSETELEEFKKKLAKRQLLA---TANENLSPANGTNSAELELFSGGMSWL 635
           IVE PVSE ++ EFK+KL +++  A   T+   L PAN     +++LF+GG+SWL
Sbjct: 605 IVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/637 (62%), Positives = 484/637 (75%), Gaps = 15/637 (2%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T +  P  LPYPITI QL    GD ++KG RL AYK+W                  T 
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYW-----EFQDVVTSPNDTSTK 55

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KK   + I  F+SP +G L+S+N+ +GDE  + N V+AEI + C HDV YGGLC +CG+
Sbjct: 56  PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115

Query: 121 EVDE-DDNDASGSGAN-LTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQT 178
            V+E   N AS    N LT+SHT+TN+KIS R+A  I    + +LRK KKLVLVVDLDQT
Sbjct: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQT 175

Query: 179 VIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVR 238
           VIHCGVDPTIGEW  DPKNPN+E LKD+K F+L EEPILP  YMGPKPP RKCWYYVK+R
Sbjct: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235

Query: 239 PGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLE 298
           PGLKEF EKIAP FE+HIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLE
Sbjct: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295

Query: 299 RLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRS 358
           RLFP DQSMV++IDDRGDVWNW  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML LGRR 
Sbjct: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRH 355

Query: 359 REKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKK 418
           R+K+++ E+LL DI+D+EKKL+EKID+EVKRQEE+L   S  TEE       +KE+++KK
Sbjct: 356 RKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKL---SKMTEEKQPEDTNSKEDLAKK 411

Query: 419 IEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGEL 478
           +E+SASLEVQQQNRPLA LQKH H+Q+LLIDDDDEL HL   L+++H KYY  L K    
Sbjct: 412 LEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSS- 470

Query: 479 KADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHV 538
             +IK +MP +K+ V   C FVFSGLIPLGTD+++ADI +WT+ FGA +T+DIDE TTH+
Sbjct: 471 PPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHI 530

Query: 539 ITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFK 598
           ITKTPGT+KARLAK+FNP+IK++HPDW+FECL +WK VDEK YEL++EQPVSE EL++FK
Sbjct: 531 ITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFK 590

Query: 599 KKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635
           KKL   +  A   E +   +  +S E+ L +G  SWL
Sbjct: 591 KKLENEKKDAQIQEEV---DRVSSDEINLLAGNDSWL 624

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/639 (60%), Positives = 476/639 (74%), Gaps = 18/639 (2%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T I  P  LP+PITI +L    G+ V KG RL  YK+W                   +
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYW------ELQDVITAPNEEAS 54

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KK   + I  F+SP +G L+S  V +GDE  + + ++AE+ +PC+H+V YG LC +CG+
Sbjct: 55  KKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGK 114

Query: 121 EVDEDDNDASGSGAN---LTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQ 177
            VDEDD++ SGSG +   LT++H +TN+K+S R+A  I    +  LR+ KKLVLVVDLDQ
Sbjct: 115 AVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQ 174

Query: 178 TVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKV 237
           TVIHCGVDPTI EW NDP NPN++ LK+VK FSL+E+PILP  YMGP+PP R+C YYVK+
Sbjct: 175 TVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKL 234

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSL 297
           RPGL+EF +K+AP FE+HIYTMATRAYA EIAKIIDP   LFGDRILSRDENGS+T KSL
Sbjct: 235 RPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSL 294

Query: 298 ERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRR 357
           ERLFP DQSMV++IDDRGDVW+W  NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +GRR
Sbjct: 295 ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRR 354

Query: 358 SREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISK 417
            R+K+++ E+LL DIMD+EKKL+EKIDQEVK+QEE+    +  +EE       +KE+++K
Sbjct: 355 HRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKF---NKISEENQPDRSMSKEDLTK 410

Query: 418 KIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGE 477
           K+E++ASLEVQQQNRPLA LQKH ++Q+LLIDDDDEL HL + L+ +H  YY  L K  E
Sbjct: 411 KLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAK-TE 469

Query: 478 LKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTH 537
           +  DIKL+MP MK  V   C FVFSGLIPLGT+I+ ADIV+WTN FGA ++SDIDE TTH
Sbjct: 470 VFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTH 529

Query: 538 VITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEF 597
           VITKTPGT+KARLAKS+NP IKI+HPDW+FECL  W   DEKPYELI+EQ VS  ELEEF
Sbjct: 530 VITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEF 589

Query: 598 KKKLAKRQLL-ATANENLSPANGTNSAELELFSGGMSWL 635
           ++ L KRQ+    A E+L    G    EL L +G   WL
Sbjct: 590 QRNLKKRQMAEKAARESLQQETG---EELNLLAGNDMWL 625

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/647 (59%), Positives = 477/647 (73%), Gaps = 22/647 (3%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           MST I  P  LPYPIT+ QL    GD V++G RL AYK+W                  +A
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYW------DFEQIVTSPGDESA 54

Query: 61  GKKSIRESIEF---FESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTL 117
           G KS R+ I+    F+SP  GQ++S N+ +GDE  +    +AEI +PC HDV YGGLC  
Sbjct: 55  GGKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 118 CGEEVDEDDNDAS--GSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDL 175
           CG+ V+++    S   + A LT+SHT+ N++IS ++A  +  + + +LR+ +KLVLVVDL
Sbjct: 115 CGQTVEDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174

Query: 176 DQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYV 235
           DQTVIHCGVDPTIGEW  DP NPN+E+LKDV+ FSL EEP+LP  YMGPKPP RKCWYYV
Sbjct: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYV 234

Query: 236 KVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTK 295
           K+RPGL++F   IAP FE+HIYTMATR YA EIAKIIDP+G LFGDRILSRDENGS+T K
Sbjct: 235 KLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQK 294

Query: 296 SLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLG 355
           SLERLFP DQSMV++IDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ +ML LG
Sbjct: 295 SLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLG 354

Query: 356 RRSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEI 415
           RR+R+K K  E+LL DI+D+EKKLK KI +EVKRQEEE+  Q  + E+ P     +KE+I
Sbjct: 355 RRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEM--QKLSEEKIPDHTT-SKEDI 411

Query: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKD 475
           +KK+E++ASLEVQQQNRPLA LQKH H++RLLIDDDDEL HL D L+R+H  YY+ L+K+
Sbjct: 412 AKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKN 471

Query: 476 ----GELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDI 531
                EL  DIK ++P++K+ V   C FVFSGLIPL T+I RADIV+WTNTFGA +T +I
Sbjct: 472 KHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINI 531

Query: 532 DEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSE 591
           D  TTH+ITKTPGT KARLA SFN  IKI+HPDW+FEC+ +WK VDEKPYELIVE+PVS+
Sbjct: 532 DYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSK 591

Query: 592 TELEEFKKKL---AKRQLLATANENLSPANGTNSAELELFSGGMSWL 635
             LE FKK+L    K +    AN +       N A + L  G  SWL
Sbjct: 592 EYLENFKKELEETEKSKNSVDANISSQKYETFNDAMI-LLGGSDSWL 637

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/639 (59%), Positives = 472/639 (73%), Gaps = 21/639 (3%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           MST I  P  LPYPITI QL    GD V+KG RLLAYK+W                    
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYW----DLVDVITAPGEEEAGK 56

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            +K   + +  F+SP  G ++S +V +GDE  +  + + EI + C HDV YGGLC  CG+
Sbjct: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116

Query: 121 EVDEDDNDASG-SGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTV 179
            V+++   A G   A LT+SHT+T++++S R+A  +G + + +LR+ +KLVLVVDLDQTV
Sbjct: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176

Query: 180 IHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRP 239
           IHCGVDPTIGEW  DP NPN+E LKDV+ FSL+EEP+LP  YMGPKPP RKCWYYVK+RP
Sbjct: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236

Query: 240 GLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLER 299
           GLKEF  KIAP FE+HIYTMATRAYA EIAKIIDP+G LFGDRILSRDENGS+T KSLER
Sbjct: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296

Query: 300 LFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSR 359
           LFP DQSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP QQ +ML LGRR+R
Sbjct: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356

Query: 360 EKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKI 419
           +K K  E+LL DI+D+EKKLKEKI++EVKRQE+++ H+    + P T       +I+KK+
Sbjct: 357 KKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQM-HRLTDEKLPDT------RDIAKKL 409

Query: 420 EYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKK--DGE 477
           E++ASLEVQQQNRPLA LQKH  ++RLL DDDDEL HL + L+++H  YY+ L++   GE
Sbjct: 410 EHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGE 469

Query: 478 LK-ADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536
               DIK++MP +K+ V + CRFVFSGLIPL T+I+RADIV+WTN FGA +T+++D  TT
Sbjct: 470 DPIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTT 529

Query: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596
           H+IT+TPGT KARLAKSFNP IKI+HPDW+FECL  W+ V+E PYELIVE+PV E  LE 
Sbjct: 530 HLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLEN 589

Query: 597 FKKKLAKRQLLATANENLSPANGTNSAELELFSGGMSWL 635
           FK+ LA+      A + + P    + + L L  G  SWL
Sbjct: 590 FKRDLAE------AQKKVDPPAQDSRSSLLLLDGNGSWL 622

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/610 (60%), Positives = 466/610 (76%), Gaps = 18/610 (2%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           M+T I  P  LP+P+TI +L    GD V+KG RL  YK+W                   A
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYW-------ELQDIITAPNEEA 53

Query: 61  GKKSIR-ESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCG 119
            KK  R + I  F+SP +G L+S N+ +GDE  +   V+AE+ + C+H+V YGGLC +CG
Sbjct: 54  PKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCG 113

Query: 120 EEVDEDDNDASGSG---ANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLD 176
           + V+EDD + S +G   + LT++H +TN+K+S R+A  I    +  LR+ KKLVLVVDLD
Sbjct: 114 KTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLD 173

Query: 177 QTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVK 236
           QTVIHCGVDPTI EW NDP NPN++ LK+VK FSL+E+PILP  YMGP+PP RKC YYVK
Sbjct: 174 QTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVK 233

Query: 237 VRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKS 296
           +RPGL+EF +KIAP FE+HIYTMATRAYA EIAKIIDP G+LFGDRILSRDENGS+T KS
Sbjct: 234 LRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKS 293

Query: 297 LERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGR 356
           LERLFP DQSMV++IDDRGDVW+W  NLIKVVPYNFFVGVGDINSNFLP+QQ +ML LGR
Sbjct: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGR 353

Query: 357 RSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTE-EPPTSAGENKEEI 415
           R+R+K+++ E+LL DIMD+EKKL+EKIDQEVK+QEE+ +  +   + E P S    KE++
Sbjct: 354 RNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPIS----KEDL 408

Query: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKD 475
           +KK+E++ASLEVQQQNRPLA LQKH ++Q+LL DDDDEL HL + L+ +H  YY+ L + 
Sbjct: 409 TKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQ 468

Query: 476 GELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKT 535
           G+   DIK +MP MK  V   C FVFSGLIPLGT++++ADIV+WT+ FGA ++ D+DE T
Sbjct: 469 GQ-PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEAT 527

Query: 536 THVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELE 595
           THVITKTPGT+KARLAK++NP IK++HPDW+FECL  W  V+EKPYEL  EQ VS  ELE
Sbjct: 528 THVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELE 587

Query: 596 EFKKKLAKRQ 605
           EFKK+L K++
Sbjct: 588 EFKKRLDKKK 597

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/645 (57%), Positives = 465/645 (72%), Gaps = 31/645 (4%)

Query: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFXXXXXXXXXXXXXXXXXTA 60
           + T +     LPYPIT+ QL    GD V+KG RL AY++W                    
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYW--------DFQDVLVKYEEK 54

Query: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120
            KK   + +  F+SP  G +  W+  + DE AS N  +  I + CNHD+ YGGLC  CG 
Sbjct: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114

Query: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180
            VDE+DN       NLTISH +TN+K+S ++A  +  +  TRLR+EKKLVLVVDLDQTVI
Sbjct: 115 TVDEEDN-----SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVI 169

Query: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240
           HCGVDPTIGEW  DPKNPN++ L+DVK F+LE+EPI+P+ Y GPKPP RK WYYVK+RPG
Sbjct: 170 HCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPG 229

Query: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300
           LKEF E ++P FEMHIYTMATR+YA EIAKIIDP G+LFGDRILSRDENGS+TTKSLERL
Sbjct: 230 LKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERL 289

Query: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360
           FP DQSMV+VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L LGR  R 
Sbjct: 290 FPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRR 349

Query: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSH--QSATTEE--PPTSAGENKEEIS 416
           K ++ E L+ DI+D+EKKLKEKID+EVKRQEE +SH     T +E  PP     NKE+IS
Sbjct: 350 KQEE-EKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPP-----NKEDIS 403

Query: 417 KKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDG 476
           KK+E+SASLEVQQQNRPLA LQKH H+Q LLIDDDDEL HL   L+R+H +Y+N   +  
Sbjct: 404 KKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAP 463

Query: 477 ELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTT 536
           +   DIK ++P MK  V   C FVFSGLIPL TD+++ADIV+WT+ FGA ++SDI+ KTT
Sbjct: 464 KNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTT 523

Query: 537 HVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596
           H+IT T  T+KARLAKSFNP IKI+HPDW+FECL  W+ V E PYEL+++ PV E +++E
Sbjct: 524 HIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKE 583

Query: 597 FKKKLAKRQLLATANENLSPANGTN------SAELELFSGGMSWL 635
           FK+KL K+  ++  + +++P    N        E  L +G  SWL
Sbjct: 584 FKEKLDKK--ISNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWL 626

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGD----LFGDRILSRDEN 289
           YV  RPG+ EFLE++  L+E+ ++T +   Y   +  I+DP G     LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRIL 284
           YV  RPG+ EFLEK+  LFE+ I+T +   Y   +   +DP G     R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 29/43 (67%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNG 276
           YV  RPG+ EFL +++ L+E+ ++T +   YA+ +   +DPNG
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNG 307

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNG 276
           YV  RPG+ EFL ++  L+E+ ++T +   YA+ +   +DPNG
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNG 302

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 32/133 (24%)

Query: 156 GLNVRTRLRKEKKLV----LVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSL 211
           G N     + EKKL+    LV+DLD+T++H                   +T   V   ++
Sbjct: 286 GFNTLLPPKTEKKLIGKKCLVLDLDETLVHSSFK-------------YLQTADFVLPVNI 332

Query: 212 EEEPILPTLYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKI 271
           +E+                   YV  RPG++EFL+++  LFE+ ++T +   Y   +  I
Sbjct: 333 DEQ---------------IHNVYVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDI 377

Query: 272 IDPNGDLFGDRIL 284
           +DP   L   R+ 
Sbjct: 378 LDPGRQLIHHRLF 390

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDL 278
           YV  RPG+ EFL +++ ++E+ ++T +   YA+ +   +DPNG +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMT 293
           YV  RPG+  FL+  + LFE+ I+T +   Y + +  I+D   DL   R+  RD   +  
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF-RDACYNYN 275

Query: 294 TKSLERLFPTDQSM--VIVIDDRGDVWNWSPN 323
              ++ L    + +  +I++D+    + + PN
Sbjct: 276 GNYIKNLAQLGRPLSDIIILDNSPTSYLFHPN 307

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRIL 284
           YV  RPG+ EFL++++ L+E+ ++T +   Y   +  I+DP   +   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 12/111 (10%)

Query: 491 QNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAI--STSD-IDEKTTHVITKTPG--T 545
           +++L +C    S  +       R + ++++    A+  S SD I  KTTH+I+  P    
Sbjct: 120 RHILKDCTIYVSRTV-----FNRTENILYSELINALGGSVSDMISNKTTHLISSDPTDPA 174

Query: 546 YKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEE 596
             A +A   + +IK ++P W+ +C    K+VDEK +  I++  +S  + EE
Sbjct: 175 LIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNF--ILDSSLSPEDAEE 223

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN 275
           YV  RPG+ EFL +++ L+E+ ++T +   YA+ +   +DPN
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN 294

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN 275
           YV  RPG++EFLE++  LFE+ ++T +   Y   +  I+D N
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN 324

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 521 NTFGAISTSDIDEKTTHVITKT---PGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVD 577
           N+ G   T  I+ KTTH+I      P     +     N  IK ++P W+ +C    K++D
Sbjct: 158 NSLGGTITHVINNKTTHLIAIAIDDPAIIAIKEKGQNNTIIKSVYPTWLVQCFKERKYID 217

Query: 578 EKPYELIVEQPVSE 591
           E P+ +  +Q  SE
Sbjct: 218 ESPHLITEDQNNSE 231

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 55/115 (47%), Gaps = 13/115 (11%)

Query: 484 LIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTP 543
           L+    K+ +  +   + +     G   QR+ I   T   G IST+++ ++ TH++++ P
Sbjct: 347 LLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHLVSRMP 404

Query: 544 GTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFK 598
              K   AK +  + ++++  W+           E+ Y+  ++Q  + +E ++FK
Sbjct: 405 VGKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+K+  LFE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG++EFLE++  LFE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG++EFLE++  LFE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG++EFLE++  LFE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN 275
           YV  RPG+ EFL+ +  L+E+ ++T +   Y + +  I+DP+
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPH 361

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 521 NTFGAISTSDIDEKTTHVITKTPG-TYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEK 579
           ++ G     +I+ KTTH+IT  P  +    L ++    IK ++P W+  C+   + +DE 
Sbjct: 150 HSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIYPTWLIHCVKESQLIDES 209

Query: 580 PYELI 584
            +E++
Sbjct: 210 EHEIV 214

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL ++A L+E+ ++T +   Y   +  I+D
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILD 298

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  LFE+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>ZYRO0B15026g Chr2 complement(1222480..1225968) [3489 bp, 1162 aa]
           {ON} weakly similar to uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 1162

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 4/113 (3%)

Query: 483 KLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKT 542
           KLI    K+ +L+  + + +     G   QR  I    N  G  +TS++  + TH++ + 
Sbjct: 336 KLIFSPFKRKLLETNQLITAYTNFFGQ--QRFYIQRLVNALGGFTTSELSRRNTHLLCRF 393

Query: 543 PGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELE 595
           P   K   AK++  K  I +  W+ EC      +D  P     +Q   E EL+
Sbjct: 394 PFGKKFETAKNWGDKCVITNYLWLEECYRQSTRLD--PLTPCFQQLPVEGELQ 444

>Kpol_1050.63 s1050 (138268..141444) [3177 bp, 1058 aa] {ON}
           (138268..141444) [3177 nt, 1059 aa]
          Length = 1058

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%)

Query: 512 QRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLT 571
           QR  I   TN  G ++T+ +      ++   P   K + A+ +  K+ I+ P+W+ EC  
Sbjct: 360 QRTYIKTLTNALGGVTTATLSHINNCLVYGIPEGMKYKTAEKWGDKLIIVGPNWLEECYK 419

Query: 572 SWKHVDEKPY 581
           + K +D K +
Sbjct: 420 ANKKLDPKLF 429

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  L+E+ ++T +   Y   +  I+D
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILD 305

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  +FE+ ++T +   Y   +  I+D
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILD 384

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 28/45 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDL 278
           YV  RPG+ EFL+++  L+E+ ++T +   Y   +  ++D + ++
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLDKSNNI 359

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 38.1 bits (87), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 483 KLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKT 542
           KL++  ++  +      + S    LG   QR  I       G  ST+++ +K THV++  
Sbjct: 330 KLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVLSCM 387

Query: 543 PGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVD-------EKPYELIVEQPVSETELE 595
           P   K + A  ++   K+++  W+ EC    K +D       E P    ++  + +  LE
Sbjct: 388 PYGQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIPVRGGLKNVLGQLSLE 447

Query: 596 EFKKKLAKRQL 606
           ++++   K++L
Sbjct: 448 DYEENTGKQEL 458

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 38/95 (40%), Gaps = 3/95 (3%)

Query: 490 KQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKAR 549
           + +VL NC+   S      T+      +I  NT G      +  + TH+IT  P      
Sbjct: 115 QAHVLKNCQIYISKQSISATECSFYISLI--NTLGGFCIDFLSSRATHIITLDPQDPAIA 172

Query: 550 LAKSFNPK-IKILHPDWVFECLTSWKHVDEKPYEL 583
                  K IK + P W+       +HVDE P+ L
Sbjct: 173 AVTHIGKKDIKFVLPTWLVSVFKKGQHVDETPHLL 207

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ +FLE ++ +FE+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.196
           YBR007C
          Length = 739

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 42/89 (47%), Gaps = 12/89 (13%)

Query: 173 VDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCW 232
           + +D+ V+HC VDP   E KN+         +D   + +  EP+ P LY      L+   
Sbjct: 607 ISIDKDVLHCHVDPMEIEKKNN--------FRDKSMYQIMREPLAPALYECGISYLKGFG 658

Query: 233 Y-YVKVRPGLKEFLEKIAPLFEMHIYTMA 260
             +V    GLK FLEK A L   HI +M 
Sbjct: 659 VEHVDEMKGLK-FLEKAASL--GHIDSMC 684

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 74/162 (45%), Gaps = 25/162 (15%)

Query: 163 LRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKD--VKQFSLEEEPILPTL 220
           L+  K+  L++DLD+T+IH              +N +  T+ +  + +         PT 
Sbjct: 187 LKTNKRKKLILDLDETLIHSMS-----------RNISSSTISNYHLIEVKFPTPTSAPTS 235

Query: 221 YMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP--NGD- 277
             GP  PL    YYV  RP    FL  ++  +++ I+T + + YA  +   ++   NG+ 
Sbjct: 236 APGPSLPLSSL-YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNF 294

Query: 278 ---LFGDRILSRDENGSMTTKSLERLFPTDQSM---VIVIDD 313
              L+ +  + RD  G +  K L  L   +QS    +I+ID+
Sbjct: 295 QKRLYRNHCILRDGIGYI--KDLSVLNTDNQSTLNELILIDN 334

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  L+E+ ++T +   Y   +  I+D
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILD 360

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  L+E+ ++T +   Y   +  I+D
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 22/109 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           ++ L  +KK  LV+DLD+T+IH     T         N +   L +VK F +   P L  
Sbjct: 243 KSILNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISGIPTL-- 293

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                        Y++  RP    FL K++  +++ I+T + + YA  +
Sbjct: 294 -------------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPV 329

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL ++  L+E+ ++T +   Y   +  I+D
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILD 388

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  FE+ +++     Y+ +IA+ +DP     + +LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL +I  L+E+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILD 321

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL ++  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 55/121 (45%), Gaps = 27/121 (22%)

Query: 164 RKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG 223
           + + K  L++DLD+T++H        ++ N   NP+F     +    +E+  I       
Sbjct: 308 KDKHKKCLILDLDETLVHSSF-----KFIN---NPDF-----ILPIEIEDGQIHNV---- 350

Query: 224 PKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRI 283
                     YV  RPG+  FL ++   +E+ I+T +   YA+ +  ++D + +L   R+
Sbjct: 351 ----------YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRL 400

Query: 284 L 284
            
Sbjct: 401 F 401

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 25/40 (62%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIID 273
           YV  RPG+ EFL+++  +FE+ ++T +   Y   +  ++D
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  FE+ +++     Y+ +IA+ +DP     + +LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 318

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 22/109 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           ++ L +EKK  LV+DLD+T+IH     ++      P N +   + +VK FS+     L  
Sbjct: 241 KSILNREKKKTLVMDLDETLIH-----SVSRGTTHP-NSSQGHIVEVK-FSISGVSTL-- 291

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                        YYV  RP    FL K++  +++ I+T + + YA  +
Sbjct: 292 -------------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYADPV 327

>KNAG0E00570 Chr5 (95945..98890) [2946 bp, 981 aa] {ON} Anc_5.94
           YHR154W
          Length = 981

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 3/102 (2%)

Query: 469 YNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAIST 528
           +N+   D       K+I   +KQ+V+ +   + S     G  +QR+ I   T   G +ST
Sbjct: 324 FNMWSLDSFTLPSSKIIWGPLKQSVVRSDELILSFTNYFG--LQRSYIQRITERLGGVST 381

Query: 529 SDIDEKTTHVITKTPGTYKARLAKSF-NPKIKILHPDWVFEC 569
           + + ++ TH++++     K  LAK +   + ++++  W+ EC
Sbjct: 382 TSLTKRNTHLVSRMAIGKKFELAKQWGGQRCRVVNHLWLEEC 423

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 89/220 (40%), Gaps = 45/220 (20%)

Query: 117 LCGEEVDEDDNDASGSGANLTISHTDTNLKISTREALDIG-------------------L 157
           L G+E+    +   GS + ++ S     +K STR ++  G                   L
Sbjct: 130 LAGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTALGSRRMGRFLFPKKL 189

Query: 158 NVRTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPIL 217
             ++ L  EKK +LV+DLD+T+IH     T     +         + +VK F++     L
Sbjct: 190 IPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGH------MVEVK-FAVSGISSL 242

Query: 218 PTLYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN-G 276
                          Y+V  RP    FL K+A  + + ++T + + YA  +   ++ +  
Sbjct: 243 ---------------YFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFS 287

Query: 277 DLFGDRILSRD---ENGSMTTKSLERLFPTDQSMVIVIDD 313
             F  R+  +D    +G    K L  +     + +I++D+
Sbjct: 288 GSFSQRLYRQDCILRDGVGYIKDLSLISKKSLNEIIIVDN 327

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 22/109 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           R+ L  EKK  LV+DLD+T+IH     T         N +   + +V+ F++     L  
Sbjct: 263 RSILYSEKKKTLVIDLDETLIHSVSRGTTHS------NSSQAHIIEVR-FAISGVSTL-- 313

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                        YYV  RP    FL K+   + + I+T + + YA  +
Sbjct: 314 -------------YYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPV 349

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 67/162 (41%), Gaps = 29/162 (17%)

Query: 108 DVVYGGLCTLCGEEVDEDDNDASGSGANLTISHTDTNLKIST----REALDIGLNVRTRL 163
           D V G L  L  + V       S S  +LT +H+ TN    T    R      L  ++ L
Sbjct: 190 DNVKGSL--LRAQSVKLRSRSYSKSEVSLT-NHSSTNTVFGTKRMGRFLFPKKLIPKSVL 246

Query: 164 RKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMG 223
             +KK  LV+DLD+T+IH     T         N +   L +VK F +     L      
Sbjct: 247 NTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGISGIRTL------ 293

Query: 224 PKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265
                    Y++  RP    FL K++  +E+ I+T + + YA
Sbjct: 294 ---------YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>CAGL0L06644g Chr12 (750307..752793) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154w
          Length = 828

 Score = 36.2 bits (82), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 13/75 (17%)

Query: 520 TNTFGAISTSDIDEKTTHVITKTPGTYKAR-------LAKSFNPKIKILHPDWVFECL-- 570
           T T G I+ + I +KTTH++ KT      +       L +  NP +KI+   W+ +C   
Sbjct: 146 TQTLGGITQNFISDKTTHIVIKTFDDPLVKEMDDNVILKEVLNPTMKIVSYQWLLDCFKT 205

Query: 571 TSW----KHVDEKPY 581
            SW    K+    PY
Sbjct: 206 VSWANEIKYSSPGPY 220

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 22/109 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           R+ L  E+K  LVVDLD+T+IH     T         N +   L +VK FS+     L  
Sbjct: 235 RSILCNERKKTLVVDLDETLIHSVSRGTTHV------NSSQGHLVEVK-FSINGISTL-- 285

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                        YYV  RP    FL K++  + + I+T + + YA  +
Sbjct: 286 -------------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPV 321

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  +E+ +++     Y+ +IA+ +DP     + +LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPN----GDLFGDRILSRDEN 289
           YV  RPG+ +FL  +  L+E+ ++T +   Y   +  ++D N      LF D   + D N
Sbjct: 277 YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHRLFRDSCYNYDGN 336

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 4/95 (4%)

Query: 521 NTFGAISTSDIDEKTTHVITKTPG--TYKARLAKSFNPKIKILHPDWVFECLTSWKHVDE 578
           N  G  +   I   TTH+IT  P      A +A      I  ++P W+ +C  S   V+E
Sbjct: 145 NALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

Query: 579 KPYELIVEQPV--SETELEEFKKKLAKRQLLATAN 611
             + + ++     S+  L++    + + Q L T N
Sbjct: 205 SDHLINIQSSAEDSKNRLQDLWNMVEESQPLRTLN 239

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 234 YVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP----NGDLFGDRILSRDEN 289
           YV  RPG+ EFL+ +  L+E+ ++T +   Y   +  ++D     +  LF D   + D N
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDSCYNYDGN 337

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 482 IKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITK 541
            KL++  ++  V +  + + S    LG   QR  I       G +ST+++ +K TH++T 
Sbjct: 329 FKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVSTTELTKKNTHLLTC 386

Query: 542 TPGTYKARLAKSFNPKIKILHPDWVFEC 569
            P   K   A  +    KI +  W+ +C
Sbjct: 387 LPLGQKYEAALRWEGTCKIANHLWLEDC 414

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG + FL  ++  +E+ +++     Y+ + A+ +DP     + +LF +  + +D    +
Sbjct: 221 RPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEHCVYKD---GV 277

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D S VI+ID   + +   P N I + P+N
Sbjct: 278 HIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 48/109 (44%), Gaps = 22/109 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           ++ L  +KK  LV+DLD+T+IH     T         N +   L +VK F L     L  
Sbjct: 243 KSVLNTQKKKKLVIDLDETLIHSASRSTTHS------NSSQGHLVEVK-FGLSGIRTL-- 293

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                        Y++  RP    FL K++  +++ I+T + + YA  +
Sbjct: 294 -------------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYADPV 329

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG+  FL  ++  +E+ +++     Y+  IA+ +DP     + +LF +  L +D    +
Sbjct: 222 RPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLDPIHAFVSYNLFKEHCLYKD---GV 278

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D+  V++ID   + +   P N I + P++
Sbjct: 279 HIKDLSKL-NRDEKKVLIIDVDPNSYKLQPENAIPMKPWD 317

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 232 WYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSR 286
           W   K RPG+  FL  ++  +E+ +++     YA +IA+ +DP       +LF +  L +
Sbjct: 216 WRTAK-RPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFITYNLFKEHCLYK 274

Query: 287 DENGSMTTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
           D    +  K L +L   D   V++ID   + +   P N I + P++
Sbjct: 275 D---GVHIKDLSKL-NRDLGKVLIIDTDENSFKLQPENAIYLEPWD 316

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG+  FL  ++  +E+ +++     Y  +IA+ +DP     + +LF +  + +D    +
Sbjct: 229 RPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLDPLHAFISYNLFKEHCVYKD---GV 285

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D + V++ID   + +   P N I V P++
Sbjct: 286 HIKDLSKL-NRDVNKVLIIDTEPNNYKLQPENAIPVKPWD 324

>Kwal_55.21914 s55 (1034239..1042167) [7929 bp, 2642 aa] {ON} YLR454W
            - Hypothetical ORF [contig 124] FULL
          Length = 2642

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 237  VRPGLKEFLEKIAPLFEMHIYTMATRA-----YASEIAKIIDPNGDLFGDRILSRDENG 290
            VR G    ++ ++P F +H+YT++  A     + S + ++ DP+ DL G + LS    G
Sbjct: 1627 VRRGPLFGMDSVSPKFGVHLYTISYHADVSPLFISHMHRVFDPDEDLRGKQSLSSKHVG 1685

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 520 TNTFGAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKI-LHPDWVFECLTSWKHVDE 578
            + FG      +  K TH+IT        +  + F+    I L P+W+ +CL   +++ E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 579 KPYELIVEQPVSETELEEFKKKLAKRQL 606
             Y + V +   +  L+E  +KL  R L
Sbjct: 206 DEYLINVNE--DDLALKEKSQKLWDRTL 231

>CAGL0B04609g Chr2 (446314..446979) [666 bp, 221 aa] {ON} highly
           similar to uniprot|P53930 Saccharomyces cerevisiae
           YNL107w YAF9
          Length = 221

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 3/73 (4%)

Query: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDD---DDELYHLKDT 460
           PPTS       +S+ + Y  + +   +NRP  A  +H H   + +     DD  Y +K  
Sbjct: 3   PPTSKRIKTLSVSRAVIYGNTAKKIGENRPPNAPSEHTHLWTIFVRSPTGDDISYFIKKV 62

Query: 461 LVRIHDKYYNVLK 473
           + ++H+ Y N ++
Sbjct: 63  VFKLHETYPNPVR 75

>Suva_12.59 Chr12 complement(79718..80758) [1041 bp, 346 aa] {ON}
           YJL023C (REAL)
          Length = 346

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 438 QKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYN-------VLKKDGELKADIKLI 485
           QKHF++ R+L  D+ EL  ++ T+ R+  ++ N        L++D +LK  I  I
Sbjct: 159 QKHFNESRILKTDEAELTKIQATMARLASRHRNNIPSEFAYLRRDLKLKVKIPFI 213

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 24/110 (21%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFET-LKDVKQFSLEEEPILP 218
           R+ L   +K  LV+DLD+T+IH     T       P + N +  L +VK F +     L 
Sbjct: 184 RSILHSGRKKKLVLDLDETLIHSISRST-------PNSNNAQAHLVEVK-FPISGISTL- 234

Query: 219 TLYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEI 268
                         YYV  RP    FL K+   +++ I+T + + YA  +
Sbjct: 235 --------------YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPV 270

>YGL195W Chr7 (131525..139543) [8019 bp, 2672 aa] {ON}  GCN1Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn20p; proposed to stimulate Gcn2p activation by
           an uncharged tRNA
          Length = 2672

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 14/110 (12%)

Query: 138 ISHTDTNLKISTREALDIGLNVRTRLRKE-KKLVLVVDLDQTVIH-------C-GVDPTI 188
           IS+TDT L+  T+   +I  N+++ L  + K L+  + ++  + H       C G+ P I
Sbjct: 364 ISNTDTTLEDLTKLIDEIFKNIKSNLNADYKSLISKILIEIPLTHYEVSEKICKGLSPYI 423

Query: 189 GEWKNDPKNPNFETLKDVKQFSLEE-----EPILPTLYMGPKPPLRKCWY 233
           G+  N+           V  FSL +     + I+   +   KP L+KCW+
Sbjct: 424 GKEGNEAALTLMLNAFFVHYFSLGKPIEDLDKIISAGFADKKPALKKCWF 473

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  +E+ +++     YA +IA+ +DP     + +LF +  + +D    +
Sbjct: 224 RPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVYKD---GV 280

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D   V++ID   + +   P N I + P++
Sbjct: 281 HIKDLSKL-NRDLKKVMIIDTDENSYKLQPENAIPMDPWD 319

>ADR369C Chr4 complement(1362309..1364792) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR346W
           (REV1)
          Length = 827

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 6/89 (6%)

Query: 493 VLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVITKTPGTYKARLAK 552
           +   CR   +G      +  R +IV+   TF        D   TH++ +     K RL  
Sbjct: 43  IFRGCRVHVNGHTDPDREELRREIVMHGGTFVHYLARPSD--VTHIVAEHVPVAKRRLWH 100

Query: 553 SFNPKIKILHPDWVFECLTSWKHVDEKPY 581
           +     K++ P WV  CL S + V  KPY
Sbjct: 101 A----CKVVRPAWVSACLCSGELVPWKPY 125

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 22/106 (20%)

Query: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPT 219
           ++ L  +KK  LV+DLD+T+IH     T         N +   L +VK F +     L  
Sbjct: 248 KSILNTQKKKKLVIDLDETLIHSASRGTTHS------NSSQGHLVEVK-FGISGISTL-- 298

Query: 220 LYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265
                        Y++  RP    FL K +  +++ I+T + + YA
Sbjct: 299 -------------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331

>KLTH0F11000g Chr6 (934247..937168) [2922 bp, 973 aa] {ON} some
           similarities with uniprot|Q06836 Saccharomyces
           cerevisiae YPR095C SYT1 Suppressor of Ypt3
          Length = 973

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 426 EVQQQNRPLAALQKHFHDQR---LLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKADI 482
           E QQ +R L A  K ++ Q     + D D+++Y +  +L+ +H   +NV  K    K D 
Sbjct: 427 ESQQIDRVLTAFSKSYYKQNNKVCIWDTDEDVYSIVFSLLMLHTDAFNVNNKTKMTKQDF 486

Query: 483 KLIMPA 488
             +M A
Sbjct: 487 VKLMRA 492

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 523 FGAISTSDIDEKTTHVITKTPGTYKARLAKSFNP-KIKILHPDWVFECLTSWKHVDEKPY 581
            G      +  K TH+IT  P      + K FN  ++  +   W+ EC    ++V E  Y
Sbjct: 146 MGGCCMDYLSTKVTHIITSDPKDQAVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAY 205

Query: 582 ELIVEQPVSETELEEFKKK 600
             +V   +S  E+    +K
Sbjct: 206 --LVGSEMSNEEVTALAEK 222

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG+  FL  ++  +E+ +++     Y+ ++A+ +DP       +LF +  L +D    +
Sbjct: 213 RPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFITYNLFKEHCLYKD---GV 269

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D    ++ID   + +   P N I + P++
Sbjct: 270 HIKDLSKL-NRDLGKTVIIDCDPNAYKLQPENAIPMKPWD 308

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG+  FL  ++  +E+ +++     Y+  IA+ +DP     + +LF +  + +D    +
Sbjct: 212 RPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDPLHAFISYNLFKEHCVYKDH---V 268

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D   V+++D   + +   P N + + P++
Sbjct: 269 HIKDLSKL-NRDVRKVVIMDTDANSYKLQPENALPMAPWD 307

>SAKL0D01628g Chr4 complement(131292..132179) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P49017 Saccharomyces
           cerevisiae YML110C COQ5 2-hexaprenyl-6-methoxy-1 4-
           benzoquinone methyltransferase involved in ubiquinone
           (Coenzyme Q) biosynthesis located in mitochondria
          Length = 295

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 5/103 (4%)

Query: 518 IWTNTFGAISTSDIDE--KTTHVITKTPGTYKA-RLAKSFNPKIKILHPDW--VFECLTS 572
           ++T +FG  + +DI     T + + K  G +     +K  NP I  ++  W      + S
Sbjct: 181 VYTVSFGIRNFTDIQAGLNTAYRVLKPGGIFFCLEFSKIDNPLIDTVYQQWSKALPVMGS 240

Query: 573 WKHVDEKPYELIVEQPVSETELEEFKKKLAKRQLLATANENLS 615
               D   Y+ +VE      E E+FK  + K    +   ENLS
Sbjct: 241 IIANDYDSYQYLVESIQKFPEQEDFKSMIEKAGFKSAGYENLS 283

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG+  FL  ++  +E+ +++     Y+ ++A+ +DP       +LF +  L +D    +
Sbjct: 214 RPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDPIHAFITYNLFKEHCLYKD---GV 270

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
             K L +L   D    I++D   + +   P N I + P++
Sbjct: 271 HIKDLSKL-NRDLGKTIIVDCDPNAYKLQPENAIPMRPWD 309

>TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]
           {ON} Anc_5.94 YHR154W
          Length = 1031

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 511 IQRADIVIWTNTFGAISTSDIDEK-TTHVITKTPGTYKARLAKSFNPK---IKILHPDWV 566
           +QR  + +     GA S+ ++ +K T  +I K P   K   AK +N K   IKIL+  W+
Sbjct: 386 VQRYYLQLLIYLLGANSSVNLTKKFTNFLIVKKPIGKKFESAKLWNSKGQDIKILNHRWL 445

Query: 567 FECLTSWKHVDEKPYELIVEQPVSETELEEF 597
            +C    K++   P  LI  +   E+  + F
Sbjct: 446 HDCYIQNKNLKLIPKYLIFPKDNEESIFDSF 476

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  +E+ +++     Y+ +IA+ +DP     + +L+ +  + ++     
Sbjct: 218 RPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLYKEHCVYKEGTHIK 277

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSP-NLIKVVPYN 331
               L R    D   V++ID   + + + P N I V P+N
Sbjct: 278 DLSKLNR----DLDKVLIIDCDPNNYKFQPENAIPVKPWN 313

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 238 RPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDP-----NGDLFGDRILSRDENGSM 292
           RPG   FL  ++  +E+ +++     YA +IA+ +DP     + +LF +  + +D    +
Sbjct: 209 RPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 265

Query: 293 TTKSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGD 338
             K + +L   D   V+ ID   + +   P     +P + + G  D
Sbjct: 266 HIKDISKL-NRDLGKVVTIDTDPNTYKLQPE--NAIPMDPWTGEAD 308

>Kwal_27.12491 s27 (1239393..1240313) [921 bp, 306 aa] {ON} YBL033C
           (RIB1) - GTP cyclohydrolase II [contig 260] FULL
          Length = 306

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%)

Query: 436 ALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYN 470
            LQ HF     LI +D   +  KDTLVRIH + Y 
Sbjct: 90  GLQLHFDKDGELIVEDQTTWSKKDTLVRIHSECYT 124

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,124,888
Number of extensions: 3540449
Number of successful extensions: 16516
Number of sequences better than 10.0: 350
Number of HSP's gapped: 16795
Number of HSP's successfully gapped: 374
Length of query: 725
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 608
Effective length of database: 40,065,477
Effective search space: 24359810016
Effective search space used: 24359810016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)