Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
NCAS0C004108.840ON62562533920.0
NDAI0K004108.840ON62661722790.0
KNAG0J002708.840ON62561921270.0
TPHA0I002508.840ON62962121270.0
YMR278W (PGM3)8.840ON62262121140.0
Smik_13.4918.840ON62261821010.0
Suva_13.4668.840ON62262120970.0
TDEL0B005708.840ON63062320970.0
SAKL0D01474g8.840ON62462620620.0
Kpol_1068.88.840ON63262320630.0
Skud_13.4508.840ON62262220320.0
TBLA0B032508.840ON64363720200.0
CAGL0M02981g8.840ON61761920110.0
ZYRO0G14190g8.840ON61061820080.0
KAFR0B039208.840ON62461419450.0
KLTH0C03872g8.840ON62162918850.0
Kwal_27.102588.840ON62062418790.0
KLLA0D01573g8.840ON60762417960.0
Ecym_46118.840ON63062517730.0
ABL126W8.840ON62462317520.0
TBLA0B090102.445ON569295970.004
NCAS0F014702.445ON569370970.005
KLLA0D00858g6.11ON54180940.011
Kpol_1033.542.445ON570112920.016
ZYRO0F00506g6.11ON55055900.025
TBLA0I013802.445ON571563900.029
KLTH0C11506g6.11ON54475890.035
SAKL0E00902g6.11ON54448890.035
YEL058W (PCM1)6.11ON557107880.048
TDEL0G046006.11ON52845880.049
Smik_5.296.11ON55593880.056
Skud_5.316.11ON557118870.065
TBLA0G009806.11ON55849850.10
KAFR0L003406.11ON54060850.11
CAGL0K03421g2.445ON568375850.11
Kwal_56.223556.11ON54149850.12
NDAI0K028906.11ON56133850.12
NCAS0F002006.11ON54928850.12
TPHA0M002106.11ON545101850.13
CAGL0B03597g6.11ON54021840.14
KNAG0E009406.11ON53821840.16
Kpol_1032.26.11ON53949840.16
ABL029W2.445ON568300840.17
Suva_5.106.11ON55351830.18
KNAG0E023902.445ON569377830.22
ACR015W6.11ON55244820.24
CAGL0K07480g2.445ON567369810.31
ZYRO0G02508g2.445ON569610810.32
SAKL0E03630g2.445ON571380810.32
KLTH0D04796g2.445ON570380810.36
Kwal_26.76282.445ON570123810.39
KNAG0A062802.445ON570114790.64
Smik_13.2912.445ON569371790.67
Ecym_30146.11ON55166780.75
YMR105C (PGM2)2.445ON569372780.80
KAFR0D030102.445ON569382771.0
NDAI0H023502.445ON569370771.2
TDEL0A022102.445ON572614751.7
Skud_13.2632.445ON569376742.4
Skud_2.2918.518ON58041742.6
TPHA0G029002.445ON569111733.4
NCAS0A043502.445ON569108723.9
Suva_4.4158.518ON58541715.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= NCAS0C00410
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...  1311   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   882   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   823   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   823   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   818   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   813   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   812   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   812   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   798   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   799   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   787   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   782   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   779   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   778   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   753   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   730   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   728   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   696   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   687   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   679   0.0  
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    42   0.004
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    42   0.005
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    41   0.011
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    40   0.016
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    39   0.025
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    39   0.029
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    39   0.035
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    39   0.035
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    39   0.048
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.049
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    39   0.056
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    38   0.065
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    37   0.10 
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    37   0.11 
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    37   0.11 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    37   0.12 
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    37   0.12 
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    37   0.12 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    37   0.13 
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    37   0.14 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.16 
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    37   0.16 
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    37   0.17 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.18 
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    37   0.22 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    36   0.24 
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    36   0.31 
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    36   0.32 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    36   0.32 
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    36   0.36 
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    36   0.39 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               35   0.64 
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    35   0.67 
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    35   0.75 
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    35   0.80 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    34   1.0  
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    34   1.2  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    33   1.7  
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    33   2.4  
Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W ...    33   2.6  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   3.4  
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    32   3.9  
Suva_4.415 Chr4 (735132..736889) [1758 bp, 585 aa] {ON} YBR163W ...    32   5.0  

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 1311 bits (3392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/625 (100%), Positives = 625/625 (100%)

Query: 1   MDATQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTA 60
           MDATQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTA
Sbjct: 1   MDATQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTA 60

Query: 61  GLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIF 120
           GLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIF
Sbjct: 61  GLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIF 120

Query: 121 LRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQII 180
           LRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQII
Sbjct: 121 LRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQII 180

Query: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSS 240
           PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSS
Sbjct: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSS 240

Query: 241 HLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFP 300
           HLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFP
Sbjct: 241 HLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFP 300

Query: 301 NPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYY 360
           NPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYY
Sbjct: 301 NPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYY 360

Query: 361 EFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQ 420
           EFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQ
Sbjct: 361 EFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQ 420

Query: 421 EGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFG 480
           EGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFG
Sbjct: 421 EGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFG 480

Query: 481 VFKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTK 540
           VFKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTK
Sbjct: 481 VFKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTK 540

Query: 541 DNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATN 600
           DNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATN
Sbjct: 541 DNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATN 600

Query: 601 LARSTWDILKREWFRPEVTGLTTSF 625
           LARSTWDILKREWFRPEVTGLTTSF
Sbjct: 601 LARSTWDILKREWFRPEVTGLTTSF 625

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/617 (67%), Positives = 501/617 (81%), Gaps = 2/617 (0%)

Query: 10  NCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAG 69
           +CP NLRE I+LWLR D+ EETR EV+QLC++ NW ELH+RFD+RIVFGTAGLRSRMEAG
Sbjct: 11  DCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRMEAG 70

Query: 70  FSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFY 129
           FSRMN L+ILQ++QGLA YIK QFP NLTAVVGHDHRFHSK+FA++TAS+FLR GFKV+Y
Sbjct: 71  FSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFKVYY 130

Query: 130 LTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAE 189
           L P+D FVHTPLVPFSV +L AS+GVMITASHNPKMDNGYKVYY N CQIIPPHDKNIA 
Sbjct: 131 LNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190

Query: 190 MIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSS-HLSLKDVK 248
            I +NLEPWS+ W+WD+TF+K L+  KLV++++ MT KYL  MK +L+ SS      + K
Sbjct: 191 TIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNNNGK 250

Query: 249 TPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGAL 308
            P+FVYTPMHGVG  IF K+S  +L+  EN+DY VV EQ  PDP+FPTVSFPNPEEKGAL
Sbjct: 251 KPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEKGAL 310

Query: 309 SLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQ 368
           SLA KLA+EN +SLVIANDPDADRFS A  N+KTG+W+QL+GNEIGFL   +E + Y  Q
Sbjct: 311 SLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKYMSQ 370

Query: 369 DVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFG 428
           D+ +R+THPLAMINSTVSSQMIK+MA +  FHYEDTLTGFKWIGN+A+DL+ +GYYVPFG
Sbjct: 371 DIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYVPFG 430

Query: 429 FEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGY 488
           FEEAIGYMFP M  DKDG+SAA VFL AY +W+N     PFDI+E+GF KFG FKEYNGY
Sbjct: 431 FEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEYNGY 490

Query: 489 YILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPV 548
           YI  D   TK +FDF+R++Y ++   YP  IG E  + VFRDLT GYQSNT DN+PNLPV
Sbjct: 491 YIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPNLPV 550

Query: 549 DPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDI 608
           DP S+MIT+EA P +    +  VR TMRGSGTEPKLK+YIEA + +E+ A +LA   W++
Sbjct: 551 DPHSEMITIEAVPKQDIG-KSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEMWNV 609

Query: 609 LKREWFRPEVTGLTTSF 625
           LK+EW RP+VTGLTT+F
Sbjct: 610 LKKEWIRPDVTGLTTTF 626

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/619 (62%), Positives = 472/619 (76%), Gaps = 3/619 (0%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           L N PE L+  I  WLRLD+NEETR+EVL LC+ ++W EL+ RF  RI+FGTAGLRSRME
Sbjct: 9   LQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRME 68

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127
           AG +R+NSL+ILQ+TQGLA YI  QFP N  AVVGHDHRFHSKEFA VTA++FLRAGFKV
Sbjct: 69  AGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKV 128

Query: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187
            YL P D  VHTPLVPF+V +L ASVGVMITASHNPKMDNGYKVY+ N CQIIPPHD NI
Sbjct: 129 LYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNI 188

Query: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247
           A  I +NLEPW  SWDW    +   + +++V++KD MT+ Y    +  LI    +     
Sbjct: 189 ARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPG 248

Query: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307
             P+FVYTPMHGVG+EIF+++S ++L + EN DYL V EQ+ PDPSFPTVSFPNPEEKGA
Sbjct: 249 SGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGA 308

Query: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367
           L  AI+LA +NG++LVIANDPDADRFS AV + KT  WRQLTGNEIGFL  Y +F++Y+ 
Sbjct: 309 LDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKA 368

Query: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427
            D  F+K HPL ++NSTVSSQMIK+MA++ GFHYEDTLTGFKWIGN+A DL ++G++ PF
Sbjct: 369 MDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPF 428

Query: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487
           G+EEAIGYMF  ME DKDGISA+ +FL +Y HW+      P DI+E+G+ K+GVFKEYNG
Sbjct: 429 GYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNG 488

Query: 488 YYILKDLSITKTVFDFIRHEY-PSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNL 546
           YYI+ +  I K  FD+IR++  P T  +YP  IG+E  V  FRDLT+G+QS+T D+IP L
Sbjct: 489 YYIVDNPKIMKETFDYIRNDRKPGT--QYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTL 546

Query: 547 PVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTW 606
           PVDP SQMITV AKP+  +     VR T+RGSGTEPKLKVYIEACS SE  A  LA+  W
Sbjct: 547 PVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMW 606

Query: 607 DILKREWFRPEVTGLTTSF 625
           D L+  WFRP+ TGL T F
Sbjct: 607 DTLQEVWFRPQTTGLVTDF 625

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/621 (63%), Positives = 487/621 (78%), Gaps = 6/621 (0%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           LS+ PE+L+E I +W R D N+ET  EV +LC NK+  ELH+RFD RIVFGTAGLRSRME
Sbjct: 12  LSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRME 71

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127
           AGF+RMN+L +LQSTQGLA+YIK QFP+NLTAVVGHDHR+HSKEFA +TA++FL AGFKV
Sbjct: 72  AGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKV 131

Query: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187
           +YL P+D+FVHTP+VPF +    AS+GVMITASHNP+MDNGYKVYY+N CQIIPPHDKNI
Sbjct: 132 YYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNI 191

Query: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247
           AE I+KNLEP S +W+ +A   K +E  KL++ K+ + ++Y++ + + +I   ++SL   
Sbjct: 192 AECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYII-PKNISLGTT 250

Query: 248 ---KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304
              K P+FVYTPMHGVG +IF ++SS  LNL E++DY+ V EQ +PDPSFPTVSFPNPEE
Sbjct: 251 IKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPNPEE 310

Query: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364
           KGAL L IK A+++ + LV+ANDPDADRFS AV N  T +++QLTGNEIGFL  Y+ ++ 
Sbjct: 311 KGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFLWEQ 370

Query: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424
           Y      F+   PLAMINSTVSSQMIK+MA++ GF+YEDTLTGFKWIGNKA +L +EGYY
Sbjct: 371 YSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKEGYY 430

Query: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484
           VPFGFEEAIGYMFP MECDKDGI+A  VFLQAY  W    + S FDI+E GF K+GVFKE
Sbjct: 431 VPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKKYGVFKE 490

Query: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544
           YNGYYI+ DLS+TK +FD IR E  +  +KY S IG E  V  FRDLT+GYQS+T  N+P
Sbjct: 491 YNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTIGNVP 549

Query: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604
            LPVDP+SQMIT+   P+      G+VR T+RGSGTEPKLKVYIEA +K+E  A  LA+ 
Sbjct: 550 TLPVDPSSQMITMTIIPTSLPE-NGSVRFTIRGSGTEPKLKVYIEANAKTEAEANRLAKL 608

Query: 605 TWDILKREWFRPEVTGLTTSF 625
           TWD+LKREWF  E TGLTT+F
Sbjct: 609 TWDVLKREWFSSEKTGLTTNF 629

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/621 (60%), Positives = 480/621 (77%), Gaps = 1/621 (0%)

Query: 5   QSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64
           Q  L   P +L++PI+LW + D+N +T +EV  LC+  +W ELH+RFD+RI FGTAGLRS
Sbjct: 3   QGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRS 62

Query: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124
           +M+AGFSRMN+L+++Q++QGLA Y+++QFP+NL AVVGHDHRFHSKEFA  TA+ FL  G
Sbjct: 63  QMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKG 122

Query: 125 FKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHD 184
           FKV YL PD +FVHTPLVPF+V  LKASVGVMITASHNPKMDNGYKVYY N CQIIPPHD
Sbjct: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 185 KNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSL 244
             I++ I  NLEPW+  WD+D    K L+  KL++ ++ M + YL ++ + L+  + L L
Sbjct: 183 HAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKL 242

Query: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304
           +    P+FVYTPMHGVG +IF+ +  + L L E  DYL V EQ+ PDPSFPTV FPNPEE
Sbjct: 243 EVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364
           KGAL + I LA+++ + L++ANDPDADRFS AV + ++G+WRQLTGNEIGFL  +YE+Q 
Sbjct: 303 KGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQK 362

Query: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424
           Y+  D  F+  HPLAM+NSTVSSQMIK+MA++ GFHYEDTLTGFKWIGN+AI L ++GYY
Sbjct: 363 YKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYY 422

Query: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484
           VPFGFEEAIGYMFP ME DKDGISA+ VFLQAYC W   + + P +++E GF K+GVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKE 482

Query: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544
           YNGYY++ + ++TK +FD+IR+ Y      YPS IG E+ V  +RDLT GYQS+T ++ P
Sbjct: 483 YNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKP 542

Query: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604
            LPVDPTSQMITV A+PS  S  E  +R T+RGSGTEPKLKVYIEAC+  E+ A+ LA+ 
Sbjct: 543 TLPVDPTSQMITVSARPSNGSENE-HIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKL 601

Query: 605 TWDILKREWFRPEVTGLTTSF 625
           TW++L+REWFRP+   + T F
Sbjct: 602 TWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/618 (60%), Positives = 476/618 (77%), Gaps = 1/618 (0%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           L   P NL+E I+LW   DQN ET +EV  LC+  +W ELH+RFD+RI FGTAGLRS+M+
Sbjct: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127
           AGF+RMN+L+I+Q++QGLA Y K+QFPNNL AVVGHDHRFHSKEFA  TA+ FL  GFKV
Sbjct: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125

Query: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187
            YL PD +FVHTPLVPF+V  LKASVGVM+TASHNPKMDNGYKVYY N CQIIPPHD  I
Sbjct: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185

Query: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247
           ++ I  NLEPW+  W++D    KGL+  KL++ ++ + + YL ++ + L+ +  L  +  
Sbjct: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLKFEVK 245

Query: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307
             P+FVYTPMHGVG +IF+ +  + ++L E  DYL V EQ+ PDPSFPTV+FPNPEEKGA
Sbjct: 246 AKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKGA 305

Query: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367
           L L I LA+ +G++L+IANDPDADRFS A+ + ++G+WRQLTGNEIGFL   +EFQ ++ 
Sbjct: 306 LDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFKS 365

Query: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427
            +  F+  HPLAM++STVSSQMIK+MA++ GFHYE+TLTGFKWIGN+AI L +EGYYVPF
Sbjct: 366 MEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVPF 425

Query: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487
           GFEEAIGYMFP ME DKDG+SA+ VFLQAYC W   + + P  I+E+GF K+GVFKEYNG
Sbjct: 426 GFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYNG 485

Query: 488 YYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLP 547
           YYI+    +T  +FD+IR+ Y      YPS IG E+ V  +RDLT+GYQS+T ++ P LP
Sbjct: 486 YYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTLP 545

Query: 548 VDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWD 607
           +DP+SQMITV AKPS+  N    +R T+RGSGTEPK+KVYIEAC+  E+ AT LA+ TW+
Sbjct: 546 IDPSSQMITVSAKPSD-GNEGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAKLTWN 604

Query: 608 ILKREWFRPEVTGLTTSF 625
           +LKREWFRPE   + T F
Sbjct: 605 VLKREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/621 (61%), Positives = 473/621 (76%), Gaps = 1/621 (0%)

Query: 5   QSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64
           Q  L   P +L+ PI+LW   D+N ET +EV  LC+N +W ELH+RFDTRI FGTAGLRS
Sbjct: 3   QQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRS 62

Query: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124
            M+AGFSRMN+L+I+Q+TQGLA YIK+QFP+NL  VVGHDHRFHSKEFA  TA+ FL  G
Sbjct: 63  EMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKG 122

Query: 125 FKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHD 184
           FKV YL PD +FVHTPLVPF+V  LKASVGVMITASHNPKMDNGYKVYY N CQIIPPHD
Sbjct: 123 FKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHD 182

Query: 185 KNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSL 244
             I++ I  NLEPW+  W +     K L+  KL++ ++ M   Y  ++ + L+ ++ L L
Sbjct: 183 HAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKL 242

Query: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304
           +    P+FVYTPMHGVG  IF+ +  + ++L E  DYL V EQ+ PDPSFPTV FPNPEE
Sbjct: 243 EIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEE 302

Query: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364
           KGAL + ++LA+E+ ++L++ANDPDADRFS AV + ++ KWRQLTGNEIGFL  ++EFQ 
Sbjct: 303 KGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQR 362

Query: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424
           Y+ +D  F+++HPLAM++STVSSQMIK+MA++ GF YEDTLTGFKWIGN+AI L +EGYY
Sbjct: 363 YKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYY 422

Query: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484
           VPFGFEEAIGYMFP ME DKDGISAA V LQAYC W     + P DI+E GF K+GVFKE
Sbjct: 423 VPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKE 482

Query: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544
           YNGYY++    +T  +F++IR+ Y  T   YP  IG E+ V  +RDLT GYQS+T D+ P
Sbjct: 483 YNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKP 542

Query: 545 NLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARS 604
            LPVDPTSQMIT+  KPS+  N    +R T+RGSGTEPKLKVYIEAC+ +E+ A+ LA+ 
Sbjct: 543 VLPVDPTSQMITLSGKPSD-GNGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKL 601

Query: 605 TWDILKREWFRPEVTGLTTSF 625
           TWD+L+R WFRPE+  +TT F
Sbjct: 602 TWDVLRRGWFRPEIMNITTDF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/623 (61%), Positives = 481/623 (77%), Gaps = 11/623 (1%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           +++ P +L + +  WL  D N++TR E+L LC+ K+W ELH+R DTRI+FGTAGLRSRME
Sbjct: 14  INSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRME 73

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127
           AGFSRMN+L++LQ+TQGLA +IK+QFP+ LTAVVGHDHRF+S+EFA+ T + FL+AGFKV
Sbjct: 74  AGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKV 133

Query: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187
            +L   D+FVHTP+VPF+V  + ASVGVMITASHNPKMDNGYKVYY N CQIIPPHD  I
Sbjct: 134 IFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEI 193

Query: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247
           A+ I++NL  W  +W WD   K+GL+T  LV+  + M E+Y  +M + L+  + +S +  
Sbjct: 194 AQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAEKE 253

Query: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307
             P+FVYTP+HGVG +IF +++ E +NL    DYL V EQ+LPDPSFPTV FPNPEEKGA
Sbjct: 254 GKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEKGA 313

Query: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367
           L +AI +A +NG+SLV+ANDPDADRFSAAV + KTG WRQLTGNEIG L  +YEFQ Y++
Sbjct: 314 LDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKYQK 373

Query: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427
           ++  +++ HPLAM+NSTVSSQ+I +MA++  FHY DTLTGFKWIGN+ +DL    YYVPF
Sbjct: 374 KNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYVPF 433

Query: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487
           GFEEAIGYMFP ME DKDGISAA+VFLQ Y  W+   + +   ++E+ F K+GVFKEYNG
Sbjct: 434 GFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEYNG 493

Query: 488 YYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLP 547
           YY + D  + K VFDFIR++Y  T+  YPS IG EL V  FRDLT+GYQS+T +  P+LP
Sbjct: 494 YYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPDLP 553

Query: 548 VDPTSQMITV-----EAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLA 602
           VDP SQMIT       AKP E      +VR T+RGSGTEPKLKVYIEACSKSEE A+ LA
Sbjct: 554 VDPNSQMITAWTKVNGAKPYE------SVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607

Query: 603 RSTWDILKREWFRPEVTGLTTSF 625
           + TW +LKREWFRP+VTGLTT+F
Sbjct: 608 QLTWRVLKREWFRPDVTGLTTTF 630

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/626 (60%), Positives = 467/626 (74%), Gaps = 12/626 (1%)

Query: 7   SLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRM 66
           S +  P++L+E +NLWL  D+N ETR E+L L E K+W ELH R D RI FGTAGLRSRM
Sbjct: 4   SYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRM 63

Query: 67  EAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFK 126
           EAGFSRMN+L +LQ++QGLA+YIK QFP NL+ +VGHDHR+HS EFA VT + FL+ GFK
Sbjct: 64  EAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFK 123

Query: 127 VFYLT-----PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIP 181
           V+YL        + FVHTP+VPF++  L AS G+MITASHNPKMDNGYKVYY N CQIIP
Sbjct: 124 VYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183

Query: 182 PHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSH 241
           PHD+ I+E I +NL PW+ +WD D   K  +E+  L  +K+ +T KY+  +   L+    
Sbjct: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243

Query: 242 LSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPN 301
           L   D   P+FVYTPMHGVG EIF +++   L L E   Y+ V EQR PDP+FPTVSFPN
Sbjct: 244 L---DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300

Query: 302 PEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYE 361
           PEEKGAL L+I LA+E  + LVIANDPDADRFS AV  K   +W QLTGNEIGFL  YY+
Sbjct: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAV--KNGDRWSQLTGNEIGFLFAYYQ 358

Query: 362 FQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQE 421
           +Q Y++   +F+K HPLAMINSTVSSQMIK +A+   FHYEDTLTGFKW+GN+A +L  +
Sbjct: 359 WQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQ 418

Query: 422 GYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGV 481
           GYYVPF +EEAIGYMFP++E DKDGISAA VFLQ YC W+++ +M+P  +++EGFGK+GV
Sbjct: 419 GYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGV 478

Query: 482 FKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKD 541
           FKEYNGYYI+  LS+TK VFD+IR +Y  +   YP  IG+E  V  FRDLT GYQS+T D
Sbjct: 479 FKEYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTID 538

Query: 542 NIPNLPVDPTSQMITVEAKPS--EFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESAT 599
           N+PNLPVD +SQMIT   +PS  + S     VR T+RGSGTEPKLKVYIEA S  E+ A 
Sbjct: 539 NVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598

Query: 600 NLARSTWDILKREWFRPEVTGLTTSF 625
           +LAR TW +L+REWFRPE TGL T F
Sbjct: 599 HLARETWQVLRREWFRPERTGLETKF 624

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/623 (60%), Positives = 470/623 (75%), Gaps = 3/623 (0%)

Query: 6   SSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSR 65
           S L   P +LR+ +  WL  D+N ET  EV++LC+  +  ELH+RFD RI+FGTAGLRS+
Sbjct: 10  SVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSK 69

Query: 66  MEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGF 125
           MEAGFSRMN+L++LQ+TQGLA YIK+QFP+NL AV+GHDHR+HSKEFA +  S+FL AGF
Sbjct: 70  MEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGF 129

Query: 126 KVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185
            V+ L P   FVHTPLVPF+V  + ASVGVMITASHNPKMDNGYKVYY N CQIIPP D 
Sbjct: 130 TVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDA 189

Query: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHL-SL 244
           +IA+ I +NLEPWS SWD     + GL   KL+++++ M   Y  ++   +I    +   
Sbjct: 190 SIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF 249

Query: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304
            + + P+FVYTPMHGVG EIF  +  E +NL EN DYL V EQ +PDP+FPT+SFPNPEE
Sbjct: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309

Query: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364
           KGAL +AI LA+EN +SLVIANDPDADRFSAA+ N  +G+W+QLTGNEIGFL GYY F  
Sbjct: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369

Query: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424
           Y   D  F+K HPLAM+NSTVSS+M+K MAD   F + DTLTGFKWIGNKAIDL++EGY+
Sbjct: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429

Query: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484
           V FG+EEAIGYMFP ME DKDGI+A+ VFLQAY  W N  +++  DI+E+G  K+G FKE
Sbjct: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489

Query: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544
           YNGYY++ +  +T  +F +IR+EYP    +YP  IG  L V  FRDLT G+QS+T DNIP
Sbjct: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549

Query: 545 NLPVDPTSQMITVEAK--PSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLA 602
           +LPVDP+SQMIT+ AK    E+   +  VR TMRGSGTEPKLK+YIE  SK   +A+ +A
Sbjct: 550 SLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIA 609

Query: 603 RSTWDILKREWFRPEVTGLTTSF 625
           + TWD+LK+EW RPEVTG+TTS+
Sbjct: 610 KLTWDVLKKEWIRPEVTGVTTSY 632

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/622 (60%), Positives = 479/622 (77%), Gaps = 1/622 (0%)

Query: 4   TQSSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLR 63
           +Q  L   P +L+ PI+LW   D++ ET +EV  LC+  +W ELH+RFDTRI FGTAGLR
Sbjct: 2   SQQFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLR 61

Query: 64  SRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRA 123
           S+M+AGFSRMN+L+I+Q++QGLA YI++QFPNNL AVVGHDHRFHSK+FA  TA+ FL  
Sbjct: 62  SQMQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLK 121

Query: 124 GFKVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPH 183
           GFKV YL P  +FVHTPLVPF+V  L ASVGVMITASHNPKMDNGYKVYY N CQIIPPH
Sbjct: 122 GFKVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 184 DKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLS 243
           D+ I+  I  NLEPW+ +W++D    K L+  KL++ ++ M + YL ++   L+ ++ L 
Sbjct: 182 DQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK 241

Query: 244 LKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPE 303
           L+    P+FVYTPMHGVG +IF+ +  + + L E  DYL V EQ+ PDPSFPTV FPNPE
Sbjct: 242 LEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPE 301

Query: 304 EKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQ 363
           EKGAL++ ++LA+++ +SL+IANDPDADRFS A+ + ++G W+QLTGNEIGFL  ++EF+
Sbjct: 302 EKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFE 361

Query: 364 LYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGY 423
            ++  D  F++THPLAM++STVSSQMIKRMA++ GFHYEDTLTGFKWIGN+AI L +EGY
Sbjct: 362 KFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGY 421

Query: 424 YVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFK 483
           YVPFGFEEAIGYMFP ME DKDGISA+ VFLQAYC W     + P +++E GF K+GVFK
Sbjct: 422 YVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFK 481

Query: 484 EYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNI 543
           EYNGYYI+ +  +TK +F +IR  Y   N  YP  IG E+ V  +RDLT GYQS+T D+ 
Sbjct: 482 EYNGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHK 541

Query: 544 PNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLAR 603
           P LPVDPTSQMITV A+P++ SN    +R T+RGSGTEPKLKVYIE  +  E  A+ LA+
Sbjct: 542 PTLPVDPTSQMITVFARPND-SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAK 600

Query: 604 STWDILKREWFRPEVTGLTTSF 625
            TWD+L+REWFRPE T +TT+F
Sbjct: 601 LTWDVLRREWFRPEKTNITTNF 622

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/637 (58%), Positives = 481/637 (75%), Gaps = 23/637 (3%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           + + PE+L++ + LWL  D+++ TRKE++ LC++ N  ELH+RFD+RI FGTAGLRS ME
Sbjct: 11  IKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTME 70

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNN---LTAVVGHDHRFHSKEFAIVTASIFLRAG 124
           AGFSRMN+L +LQ++QGLA Y+K    N    L AV+GHDHR+HSKEFA + A++FL AG
Sbjct: 71  AGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAG 130

Query: 125 FKVFYLTPD-------DQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNAC 177
           FKV+YL  D       ++FVHTP+VPF+V NLKASVGVM+TASHNPKMDNGYKVYY N C
Sbjct: 131 FKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGC 190

Query: 178 QIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLI 237
           QIIPPHD  I++ I  NLEPW  SW++            L++ +D+M   Y+ Q++  L 
Sbjct: 191 QIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLT 250

Query: 238 HSS--HLSLK-DVKT-PFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPS 293
                HLS K DVK+ P+FVYTPMHGVG EIF K+S+E+L++ E  D++VV EQ+ PDP 
Sbjct: 251 SKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPG 310

Query: 294 FPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKT-GKWRQLTGNE 352
           FPTVSFPNPEEKGA+ + IKLA++NG+SLVIANDPDADRFS AV +K + G W Q TGNE
Sbjct: 311 FPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNE 370

Query: 353 IGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIG 412
           IG+L  Y+EFQ Y+   ++ +  H L M+NSTVSSQMIK+MA++ GF+YE+TLTGFKWIG
Sbjct: 371 IGYLFAYFEFQKYK---ISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIG 427

Query: 413 NKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIM 472
           N+AIDL  +G  VPFG+EEAIGYMFP ME DKDGI+A  +F+QA+ +W    +M P++I+
Sbjct: 428 NRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEII 487

Query: 473 EEGFGKFGVFKEYNGYYILKDLSITKTVFDFIRHEY----PSTNKKYPSEIGNELIVTVF 528
           + GF K+GVF EYNGYY   DL ITK +FD++R++Y       NKKYP  IG E  +  +
Sbjct: 488 QLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKY 547

Query: 529 RDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYI 588
           RDLT GYQS+T DN P LPVDP+SQMITVE  P++ +  +G++RLT+RGSGTEPKLKVYI
Sbjct: 548 RDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTD-NESDGSIRLTIRGSGTEPKLKVYI 606

Query: 589 EACSKSEESATNLARSTWDILKREWFRPEVTGLTTSF 625
           EACS+S   A+ LA+  W++LKREW RPE TG+TT+F
Sbjct: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/619 (60%), Positives = 460/619 (74%), Gaps = 3/619 (0%)

Query: 7   SLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRM 66
           S ++ P  LR  I  WL+LD+NEETR EV++LC ++NW ELH+RFD+RIVFGTAGLR+RM
Sbjct: 2   STTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARM 61

Query: 67  EAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFK 126
           EAG +R+N L+ILQ++QGLA YIK++FP NLTAVVGHDHR+HS+EFA VTA+ F+RAGFK
Sbjct: 62  EAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121

Query: 127 VFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKN 186
           V+YL P D+FVHTP+VP+SV +L ASVGVMITASHNPKMDNGYKVYY N CQIIPPHD  
Sbjct: 122 VYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHG 181

Query: 187 IAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKD 246
           IAE I  NLEPWST W++           K+ +++  M   YL  +   LI     +  D
Sbjct: 182 IAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD-FAAPD 240

Query: 247 VKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKG 306
            K P+FVYTPMHGVG +IF+ + +E LNL +N+DY+ V EQ+ PDPSF TVSFPNPEEKG
Sbjct: 241 EK-PWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299

Query: 307 ALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYE 366
           AL+LAI LA+ NG+ LV+ANDP+ADRFS AV +    +W+QLTGNEIG L  +YEF++Y+
Sbjct: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359

Query: 367 QQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVP 426
           +      K  PLAM+NSTVS+Q+IKRMA+  GF Y+DTLTGFKWIGN+A  L ++GY+VP
Sbjct: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419

Query: 427 FGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYN 486
           FG+EEAIGYMFP ME DKDG+SAA VFLQAY +W+ Q   +P DI+ E + K+GV  EYN
Sbjct: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWL-QSSSNPIDIIHECYDKYGVSAEYN 478

Query: 487 GYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNL 546
           GYYI+ D S T  VF+ IR  Y S    +P  IG    VT FRDLT+G+ S T D  P L
Sbjct: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538

Query: 547 PVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTW 606
           PVD  SQMIT+ A PS  SN   +VR T+RGSGTEPKLKVYIE  S +E  A  LA+S W
Sbjct: 539 PVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLW 598

Query: 607 DILKREWFRPEVTGLTTSF 625
           + LK EWF+P   GL+T F
Sbjct: 599 ETLKHEWFKPSSNGLSTDF 617

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/618 (60%), Positives = 471/618 (76%), Gaps = 11/618 (1%)

Query: 9   SNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEA 68
           SN PENL++PI+LWL  D+NE+T KE+ +LC+ +NW ELH+R ++R+ FGTAGLR+RMEA
Sbjct: 3   SNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEA 62

Query: 69  GFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVF 128
           GFSRMN+L+++Q+TQGLA YIK+QFP++L AVVGHDHRF+S +FA  TA++ L+AGF+V 
Sbjct: 63  GFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122

Query: 129 YLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIA 188
           YL   D +VHTP+VPF+V  +KASVGVMITASHNPK+DNGYKVYY N CQIIPPHD  IA
Sbjct: 123 YLNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182

Query: 189 EMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDVK 248
             I+ NLEP +  WDWD T ++  +  KL++ +D M E+Y+  +K   +  + L      
Sbjct: 183 RSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFV--TELDSLPKG 240

Query: 249 TPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGAL 308
            P+FVYTPMHGVG ++F +++S++L L  N D+LVVSEQ  PDP FPTV FPNPEEKGAL
Sbjct: 241 KPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGAL 300

Query: 309 SLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQ 368
            LAIKLA+ +G+ LVIA+DPDADRFS A   K    W+QL+GN+IGFL  YYE Q Y   
Sbjct: 301 DLAIKLAENHGIKLVIASDPDADRFSVAF--KGPHGWQQLSGNDIGFLFAYYELQKYRGF 358

Query: 369 DVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFG 428
           D  ++K+HPLAM+NSTVSSQMI  MA + GFH+EDTLTGFKWIGN+A++L   GYYVPFG
Sbjct: 359 DAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFG 418

Query: 429 FEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGY 488
           FEEAIGYMFP  E DKDGISAA VFLQAY  W++Q + SP DI++E   K+GVF+EYNGY
Sbjct: 419 FEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNGY 477

Query: 489 YILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPV 548
           Y++ + S+T   F +IR +Y    + YP  IG +L V  FRDLT GYQS+T +NIPNL V
Sbjct: 478 YLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHV 536

Query: 549 DPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDI 608
           DP+SQMIT+ A+P    + E  VR T+RGSGTEPKLKVYIEA ++S+  A  LAR TWDI
Sbjct: 537 DPSSQMITIVAQPKGGGSGE-HVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDI 595

Query: 609 LKREWF-RPEVTGLTTSF 625
           L+ EWF RP   GLTT F
Sbjct: 596 LREEWFNRP---GLTTKF 610

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/614 (58%), Positives = 456/614 (74%), Gaps = 5/614 (0%)

Query: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71
           PE L+   + WLR DQNEETR E+L +   K+W EL  R + RI FGTAGLR RMEAGF+
Sbjct: 16  PERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRMEAGFT 75

Query: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYLT 131
           RMNSL+ILQ++QGLA YI E+FP NL+ VVGHDHR+HSKEFA +T + FL AGFKVFYL 
Sbjct: 76  RMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFKVFYLN 135

Query: 132 PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMI 191
            +++FVHTPLVP+SV  L+++ GVMITASHNPK DNGYKVYY N CQIIPPHDKNIA  I
Sbjct: 136 TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTI 195

Query: 192 QKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDVKTPF 251
           +KNL PWS  W+W   F        L F  + M   Y+  + R +  +    LK  K P+
Sbjct: 196 EKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKTGK-PW 254

Query: 252 FVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLA 311
           FVYTPMHGVG +IF +++ ++L L ENVDY  V EQ  PDPSFPTVSFPNPEEKGAL +A
Sbjct: 255 FVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEKGALDMA 314

Query: 312 IKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVA 371
           I+LA+  GL+L+IANDPDADRFSAAV +K++ +WRQL+GNEIG L   ++ Q ++++  A
Sbjct: 315 IQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEHKEK-AA 373

Query: 372 FRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEE 431
            RK  PLAM+NSTVSSQM+K+MA + GFHYE+TLTGFKWIGN+A+ L Q+GY V FG+EE
Sbjct: 374 SRK--PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDVCFGYEE 431

Query: 432 AIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGYYIL 491
           AIGYMFP ME DKDGI A+ VFL  Y  W+    + P D+++  F K+GVF EYNGYY +
Sbjct: 432 AIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEYNGYYTV 491

Query: 492 KDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPT 551
           ++ ++ ++VF +IR EY    + YP ++G E  +T FRDLT+GYQS+T D  P LPVD +
Sbjct: 492 EEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPTLPVDAS 551

Query: 552 SQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTWDILKR 611
           SQMIT   KP      E  +R T+RGSGTEPKLKVYIE+ + ++E+A NLA  TW++L+R
Sbjct: 552 SQMITATLKPERTVGHE-EIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLTWNVLRR 610

Query: 612 EWFRPEVTGLTTSF 625
           EWFRPE+TGL TSF
Sbjct: 611 EWFRPEITGLKTSF 624

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/629 (56%), Positives = 456/629 (72%), Gaps = 20/629 (3%)

Query: 7   SLSNC--PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64
           SL+N   PE+L+  +  WL+ D+NE+TR ++++L E+K+W EL  R + RI FGTAGLRS
Sbjct: 3   SLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRS 62

Query: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124
           RMEAGF+RMN+L +LQ++QGLA YI   FP+NL+ VVGHDHRF+SK+FA VT   FL+ G
Sbjct: 63  RMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLG 122

Query: 125 FKVFYL-----TPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQI 179
           FKV+ L        D  VHTP+VPF + +L+AS G+MITASHNPKMDNGYKVYY N CQI
Sbjct: 123 FKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182

Query: 180 IPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHS 239
           IPPHD+ I++ I  NLEPW  +WD  A   + +++  L+  K ++ ++Y+  ++R L+ +
Sbjct: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242

Query: 240 SHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSF 299
           +   +   K P+FVYTP+HGVG EIF K+ S    L +  DYL V EQ+ PDP+FPTVSF
Sbjct: 243 N---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSF 299

Query: 300 PNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGY 359
           PNPEEKGAL  AI+LA+++ ++ V+ NDPDADRFS A   K  G+WRQLTGNEIGFL   
Sbjct: 300 PNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQ 357

Query: 360 YEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLR 419
           Y+++ Y  +   F+ T+PLAMINSTVSSQMIK+MA++ GFHYEDTLTGFKW+GN+A +L 
Sbjct: 358 YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELE 417

Query: 420 QEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKF 479
             GY+VPF +EEAIGYMF D+  DKDGISAA VFLQ    W  Q  ++PFD+++  + K+
Sbjct: 418 NAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQ-ALTPFDVLQRAYQKY 476

Query: 480 GVFKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNT 539
           GVFKEYNGYYI+ DLS+T  VF  IR  +       P+ IG E  V  + DLT GYQSNT
Sbjct: 477 GVFKEYNGYYIVPDLSLTDKVFSGIRSGF----SLQPTHIGQEFRVESYTDLTTGYQSNT 532

Query: 540 KDNIPNLPVDPTSQMITVEAKPSEFSNLEG---TVRLTMRGSGTEPKLKVYIEACSKSEE 596
            D+ P LPVDP+SQMIT    P+  +  +G   +VR T RGSGTEPKLKVYIEA S SEE
Sbjct: 533 PDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEE 592

Query: 597 SATNLARSTWDILKREWFRPEVTGLTTSF 625
            A+ LA+  WD+L+REWF+PE TGL T+F
Sbjct: 593 LASALAKKAWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/624 (57%), Positives = 440/624 (70%), Gaps = 20/624 (3%)

Query: 11  CPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGF 70
            P +L+  +  W   D+NEETR E+LQL   +NW ELH+R D RI FGTAGLRS+MEAGF
Sbjct: 8   IPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGF 67

Query: 71  SRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL 130
           SRMN+L +LQ++QGLA YI E+FP N T  VGHDHRF+S++FA VT+  FL+  FKV+ L
Sbjct: 68  SRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSL 127

Query: 131 T-----PDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185
                   D FVHTP+VPF++  L AS GVMITASHNPKMDNGYKVYY N CQIIPPHD+
Sbjct: 128 GFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDR 187

Query: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLK 245
            IA+ I  NL PW  +WD  A   +  E    V +K  M + Y+ ++   L+ S    + 
Sbjct: 188 LIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD---IG 244

Query: 246 DVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEK 305
           D   P+FVYTP+HGVG EIF +++SE+L L E  DY  VSE + PDP+FPTVSFPNPEE 
Sbjct: 245 DRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEA 304

Query: 306 GALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLY 365
           GAL LAI LA +NG+S V+ NDPDADRFSAAV  K  GKWRQLTGNEIGFL   + ++ Y
Sbjct: 305 GALDLAIALADKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFAQFVWEKY 362

Query: 366 EQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYV 425
           +++   F+  +PLA+INSTVSSQMIK++A +  FHYEDTLTGFKW+GN+A  L   GYYV
Sbjct: 363 QKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYV 422

Query: 426 PFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEY 485
           PF +EEAIG+MF D+  DKDG+SAA VFLQ    W  Q  +SP D+++  FGK+GVFKEY
Sbjct: 423 PFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQ-ALSPIDVLQSAFGKYGVFKEY 481

Query: 486 NGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPN 545
           NGYY + DLS+T  +F  IR  Y S    YP  IGN+  V  F DLT G+QS+T DN P 
Sbjct: 482 NGYYTVPDLSLTDRIFSDIRSSYDS----YPKHIGNQFDVVSFTDLTKGFQSDTADNTPR 537

Query: 546 LPVDPTSQMITVEAKPSEFSNLEGT----VRLTMRGSGTEPKLKVYIEACSKSEESATNL 601
           LPVDP+SQMI     PS  S   G     VR T RGSGTEPKLKVYIEA S  E  A++L
Sbjct: 538 LPVDPSSQMIQATLVPST-SGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDL 596

Query: 602 ARSTWDILKREWFRPEVTGLTTSF 625
           AR+TW++L+ EWF+P+ TGL+T F
Sbjct: 597 ARTTWNVLRDEWFKPKETGLSTKF 620

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/624 (57%), Positives = 440/624 (70%), Gaps = 30/624 (4%)

Query: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67
           + + P +L+  +  WL+ D+ EETR E+LQLC   +  ELH+R DT I FGTAGLR RME
Sbjct: 7   IESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRME 66

Query: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127
           AGF+RMN+L + Q++QGLA YIK+QFP NLT VVGHDHR +S+ F  VT   FL+ GFKV
Sbjct: 67  AGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKV 126

Query: 128 FYLTPDDQ--FVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185
           F+L  +++   VHTPLVPF+V    ASVG+MITASHNPKMDNGYKVYY N CQIIPPHDK
Sbjct: 127 FHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186

Query: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLK 245
            IAE I  NLEP+S+            +T  ++  K+ MT+KY+  +   LI  +    K
Sbjct: 187 LIAESIIHNLEPFSSP-----------QTGTIIDCKEKMTKKYIDAIGSTLIDGA--VNK 233

Query: 246 DVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEK 305
               P+FVYTPMHGVG EIF  +S +LL+L E  DYLVV EQ+ PD  FPTVSFPNPEEK
Sbjct: 234 KTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEK 293

Query: 306 GALSLAIKLAQENG-LSLVIANDPDADRFSAAVLNKK---TGKWRQLTGNEIGFLLGYYE 361
           GAL LA++  ++N  + L+IANDPDADRFS AV +     T  WRQLTGNEIGFL  YYE
Sbjct: 294 GALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYE 353

Query: 362 FQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQE 421
           ++ Y+   +      PLAM+NSTVSSQMIKRMA++ GFHYEDTLTGFKW+GN+A++L QE
Sbjct: 354 WERYKHSPI----DEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQE 409

Query: 422 GYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGV 481
           GYY PF +EEAIGYMF  +  DKDGISAA VFLQAY  W    Q +  DI+     K+G 
Sbjct: 410 GYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQ-TVLDILATASLKYGH 468

Query: 482 FKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKD 541
           FKE+NGYYI+ DL+ITK VFD IR    S    YP ++G+   +  FRDLT GYQS+T D
Sbjct: 469 FKEFNGYYIVPDLAITKQVFDAIR----SIESPYPKKLGSSFEIIKFRDLTNGYQSDTPD 524

Query: 542 NIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNL 601
           +IP L  DP+SQMIT E    E       VR T+RGSGTEPKLKVYIEA + +E ++  L
Sbjct: 525 HIPELASDPSSQMITCEMLLVE--QPTSRVRFTIRGSGTEPKLKVYIEARTNTEPNSIAL 582

Query: 602 ARSTWDILKREWFRPEVTGLTTSF 625
           A+ TWD+L++EWF+PE+TGL T F
Sbjct: 583 AKFTWDVLRQEWFKPELTGLLTPF 606

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/625 (54%), Positives = 438/625 (70%), Gaps = 19/625 (3%)

Query: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71
           P++LR+ I+ W + D+N +T  E+  L +++NW EL  R   RI FGTAGLR+RMEAGF+
Sbjct: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73

Query: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL- 130
           RMN+L ++Q++QGLA YIK QFPNNL  VVGHDHR++SK FA V  + FL+ GF+V+YL 
Sbjct: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133

Query: 131 -TPDDQ----FVHTPLVPFSVLNLK--ASVGVMITASHNPKMDNGYKVYYDNACQIIPPH 183
             P ++    +VHTP+VPF+V N++  AS G+MITASHNPKMDNGYKVYY N CQI PPH
Sbjct: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193

Query: 184 DKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLS 243
           DK IA  I  NL PW  +WD     +     N+L  +K  + + Y+ +++  L+ ++  S
Sbjct: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTN--S 251

Query: 244 LKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPE 303
           L D    +FVYTPMHGVG EIF  + +  L+L E+  YLVV  Q+ PDP F TVSFPNPE
Sbjct: 252 LADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPE 311

Query: 304 EKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQ 363
           E+GAL+LAI+LA  +G  LV+ANDPDADRFSAAV  K   KW+QLTGN++G+L    + +
Sbjct: 312 EEGALNLAIELAARSGAELVLANDPDADRFSAAV--KDGNKWKQLTGNQLGYLFAVGQLE 369

Query: 364 LYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGY 423
            +  Q+       PLAM+ STVSSQMI +MAD+ GF + +TLTGFKW+ N+AIDL  +G+
Sbjct: 370 KFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGF 426

Query: 424 YVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFK 483
           YVPF +EEAIGYMF  +  DKDG+SAAT FLQ    W  + + +P D++  G+ K+G F 
Sbjct: 427 YVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGK-TPLDVLNAGYEKYGNFV 485

Query: 484 EYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNI 543
           EYNGYY ++DLSI   VF +IR+     +  YPS IGNE  V  FRDLTVGYQS+T ++I
Sbjct: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545

Query: 544 PNLPVDPTSQMITVEAKPSEFSNLEGT---VRLTMRGSGTEPKLKVYIEACSKSEESATN 600
           PNLPV P S MIT   KP      + +   VR T+RGSGTEPKLKVYIE+ +  +E AT 
Sbjct: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605

Query: 601 LARSTWDILKREWFRPEVTGLTTSF 625
           LA+ TWD+LKREWFRPEVTGL T F
Sbjct: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/623 (53%), Positives = 437/623 (70%), Gaps = 16/623 (2%)

Query: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRMEAGFS 71
           P +L++ +  WL  D+N ET+ E+ +L  N  W EL +R   RI FGTAGLR+RMEAGFS
Sbjct: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68

Query: 72  RMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKVFYL- 130
           RMN+L ++Q++QGLA YIK QFP++L  V+GHDHRFHS+EFA  T + FL+  + ++YL 
Sbjct: 69  RMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYLN 128

Query: 131 -----TPDDQFVHTPLVPFSVLNLKA---SVGVMITASHNPKMDNGYKVYYDNACQIIPP 182
                + +D FVHTP+VPF++ N++    S GVMITASHNPKMDNGYKVYY N CQIIPP
Sbjct: 129 YVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPP 188

Query: 183 HDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHL 242
           HD+ I   I  NLEPW+ +WD  A  ++ +++ KL  ++  M +KY   ++ +L+  S  
Sbjct: 189 HDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQS-- 246

Query: 243 SLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNP 302
           +LK    P+FVYTPMHGVG E F +  + +L + E+ DY+VV EQ+ PDP FPTVSFPNP
Sbjct: 247 NLKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306

Query: 303 EEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEF 362
           EE+GAL +A+K+A  NG+++V+ANDPDADRFS AV  K  G+W QLTGN+IG L    E 
Sbjct: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364

Query: 363 QLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEG 422
           Q Y ++    RK   LAM+ S VSSQ++++MA+  GF   +TLTGFKW+GN+A +L  EG
Sbjct: 365 QSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEG 422

Query: 423 YYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVF 482
           YYVPF +EEAIGYMF  +  DKDGI+AA VFLQ  C+   +   S  ++++E + K+G F
Sbjct: 423 YYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQM-CYEWKKVAKSSQEVLQECYEKYGYF 481

Query: 483 KEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDN 542
            +YNGYYI    ++TK VFD+ R+EY    K YPS IG E  V   RDLTVGYQS+T  N
Sbjct: 482 VDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATN 541

Query: 543 IPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLA 602
           IP+LPVD  SQMIT   KP +      +VR T RGSGTEPKLKVYIE+C+ + + A++L+
Sbjct: 542 IPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601

Query: 603 RSTWDILKREWFRPEVTGLTTSF 625
              WD+LKREWFRP  TGL T+F
Sbjct: 602 HLAWDVLKREWFRPTETGLQTNF 624

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 117/295 (39%), Gaps = 38/295 (12%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      N       T+     I +  P    + T VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMDEPNY------TENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASV--GVMITASHNPKM---DNGY 169
             A+I    G K   +   +  + TP     +   K  V  G+++TASHNP     D G 
Sbjct: 73  KIAAIGAANGVKKLIIG-QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMI---QKNLEPWSTSWDWDATFKKGLETNK-----LVFIK 221
           K    N      P  + + + I    K L  +    D+       +  NK     LV I 
Sbjct: 132 KYNLGNGA----PAPEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDII 187

Query: 222 DLMTEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHE 277
           D  TE Y+  MK +    LI    +S ++ K    ++  ++GV       + ++   L  
Sbjct: 188 D-STEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGLPA 246

Query: 278 NVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR 332
           +     V +  +P P F  +  P+P    A +L  ++ +E  +    A+D D DR
Sbjct: 247 D----EVLQNYVPKPDFGGLH-PDPNLTYAKTLVSRVDKEK-IEFGAASDGDGDR 295

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 90/370 (24%), Positives = 141/370 (38%), Gaps = 42/370 (11%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      N       T+     I +  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHNP---KMDNGY 169
             A+I    G K   +      + TP           K   G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QRGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNK-----LVFIKDLM 224
           K    N      P    I E I K +  +    D+     + L  NK     LV + D  
Sbjct: 132 KFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVID-T 189

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVD 280
           T+ Y+  +K++    LI       +D K    ++  M+GV       +  + L L  +  
Sbjct: 190 TKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPAD-- 247

Query: 281 YLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNK 340
              V +Q  P P F  V  P+P    A +L  ++ +EN +    A+D D DR     +  
Sbjct: 248 --EVLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDREN-IEFGAASDGDGDR----NMIY 299

Query: 341 KTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFH 400
             G      G+ +  +  Y     Y      F K     +  S  +S  I R+A  +G +
Sbjct: 300 GAGPAFVSPGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSSAIDRVAKAHGLN 353

Query: 401 YEDTLTGFKW 410
             +  TG+K+
Sbjct: 354 CYEVPTGWKF 363

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 40/80 (50%), Gaps = 14/80 (17%)

Query: 123 AGFKVFYLTPDDQFVHTPLVP-FSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180
           AGF+      D     T +V     + LK+  VGVMITASHNP  DNG KV        +
Sbjct: 22  AGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPPEDNGVKV--------V 73

Query: 181 PPHDKNIAEMIQKNLEPWST 200
            P+     EM+ +N EP +T
Sbjct: 74  EPY----GEMLVQNWEPIAT 89

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 13/112 (11%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +   S  N       T+     I    PN   N T VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKNY------TENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASV---GVMITASHNP 163
               I    G +   +   +  + TP   + + N K S    G+++TASHNP
Sbjct: 73  KIMQISAANGVRKLVIG-QNGILSTPAASYIIRNYKESCNGGGIILTASHNP 123

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 119 IFLRAGFKVFYLTPDDQFVHTP-LVPFSVLNLKASV-GVMITASHNPKMDNGYKV 171
           ++  AGF+    T D     T  L     L LK  V GVM+TASHNP +DNG KV
Sbjct: 23  VYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHNPPVDNGVKV 77

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 127/563 (22%), Positives = 211/563 (37%), Gaps = 85/563 (15%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNL---TAVVGHDHRFHSKEFAI 114
           GT+GLR +  A F +  +      T+     I E  P      T VVG D R+++     
Sbjct: 20  GTSGLRKKT-AIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL---KASVGVMITASHN---PKMDNG 168
             A+I    G K   +   +  + TP     +      + + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVKKL-IVGQNGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 169 YKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNK-----LVFIKDL 223
            K    N      P  + I E   K L+ +    D+     K L  NK     LV + D 
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVID- 190

Query: 224 MTEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENV 279
             E Y+  +K +    LI     + +  K    ++  M+GV       +  + L L  + 
Sbjct: 191 TCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPAD- 249

Query: 280 DYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR-----FS 334
               V +   P P F     P+P    A SL  ++ +E  +    A+D D DR     + 
Sbjct: 250 ---EVLKDWHPSPDFGG-HHPDPNLTYAKSLVDRVDKEK-IEFGAASDGDGDRNMIYGYG 304

Query: 335 AAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMA 394
            A ++          G+ +  +  Y     Y      F+K     +  S  ++  I R+A
Sbjct: 305 PAFVS---------PGDSVAIIAEYASDIPY------FKKNGIYGLARSFPTASSIDRVA 349

Query: 395 DMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFL 454
             +G    +  TG+K+   K  D ++    V    EE+ G     +  +KDG+ A   +L
Sbjct: 350 KAHGLKAYEVPTGWKFF-CKLFDSKK----VSICGEESFGTGSNHVR-EKDGVWAIIAWL 403

Query: 455 Q---AYCHWMNQYQMSPFDIMEEGFGKFG--VFKEYNGYYILKDLSITKTVFDFIRHEYP 509
                Y     + + S   I +E + K+G   F  Y+ Y  ++     + V    +    
Sbjct: 404 NILAIYNQKNPEKEASIKTIQDEFWLKYGRTFFTRYD-YEKVESQKANQIVAKLRKFVLD 462

Query: 510 STNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEG 569
            +NK  P     + I+T   D +                  T    TV +    +  L  
Sbjct: 463 PSNKGKPFPTNKDWIITESGDFSY-----------------TDLDGTVSSHQGCYIKLSN 505

Query: 570 TVRLTMRGSGTEPK---LKVYIE 589
             R+ +R SGT      +++YIE
Sbjct: 506 GARMVLRLSGTGSAGATIRLYIE 528

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 15/75 (20%)

Query: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKG 211
           +VGVMITASHNP  DNG K        I+ P      EM++++ E ++T     AT    
Sbjct: 57  TVGVMITASHNPPEDNGVK--------IVDPK----GEMLEQSWESYATDLANSATQSF- 103

Query: 212 LETNKLVFIKDLMTE 226
             T  L ++++L++E
Sbjct: 104 --TAFLAYLQNLVSE 116

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 12/48 (25%)

Query: 153 VGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200
           VGVMITASHNP  DNG K        I+ P      EM+ +  EP++T
Sbjct: 58  VGVMITASHNPPQDNGVK--------IVDPK----GEMLDQAWEPFAT 93

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 517 SEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMR 576
           +++ N+L+  +  D +V   SN +  +    V P      +++   EF +     R  +R
Sbjct: 457 TDLPNKLVKVIVPDRSVFKTSNAERQL----VSPKGLQEKIDSTVQEFEH----GRSFVR 508

Query: 577 GSGTEPKLKVYIEACSKSEESATNLARSTWDILKR 611
            SGTE  ++VY EA +K  E A  LA S  D++ R
Sbjct: 509 ASGTEDAVRVYAEAATK--EKADRLAASVSDLVSR 541

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 45/107 (42%), Gaps = 14/107 (13%)

Query: 123 AGFKVFYLTPDDQFVHTPLVP-FSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180
           AGF+      D     T ++     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79

Query: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEK 227
            P       M+    EP++      A+F    E  ++   K +  EK
Sbjct: 80  EPD----GSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 146 VLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEM 190
           VLN K  VGVMITASHNP  DNG KV   +   +I   +    E+
Sbjct: 51  VLNGKP-VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL 94

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 38/93 (40%), Gaps = 14/93 (15%)

Query: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 28  AGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79

Query: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLE 213
            P       M+    EP++      A+F    E
Sbjct: 80  EPD----GSMLLATWEPYAMQLANTASFASNFE 108

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 47/118 (39%), Gaps = 14/118 (11%)

Query: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 28  AGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79

Query: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIH 238
            P       M+  + EP++      A+F    E      +K +  EK  +    V  H
Sbjct: 80  EPD----GSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDLGASNVAPH 133

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 12/49 (24%)

Query: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200
           +VGVM+TASHNP +DNG K        I+ P+      M+ ++ EP +T
Sbjct: 61  AVGVMVTASHNPPVDNGVK--------IVEPN----GSMLSQDWEPIAT 97

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 123 AGFKVFYLTPDDQFVHTPLVPF--SVLNLKASVGVMITASHNPKMDNGYKVYYDNACQII 180
           AGF+    T D     T +V    S++     +GVMITASHNP  DNG K+   +   +I
Sbjct: 27  AGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 84/375 (22%), Positives = 142/375 (37%), Gaps = 52/375 (13%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTA---VVGHDHRFHSKEFAI 114
           GT+GLR + +    + N +      +     + E  P        VVG D R+++     
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169
             A+I    G K   +   +  + TP           K + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDW-DATFKKGLETNK----LVFIKDLM 224
           K    N      P    I E I K L  +    D+ +    K +E  K    LV + D  
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVID-T 188

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVD 280
           T+ Y+  +K +    LIH      +  K    +   M+GV       +  +   L    D
Sbjct: 189 TDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGL----D 244

Query: 281 YLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR-----FSA 335
              V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR     +  
Sbjct: 245 SKEVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVNKEK-IEFGAASDGDGDRNMIYGYGP 302

Query: 336 AVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMAD 395
           A ++          G+ +  +  Y     Y      F+K     +  S  ++  I R+A 
Sbjct: 303 AFVS---------PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAK 347

Query: 396 MNGFHYEDTLTGFKW 410
            +G +  +  TG+K+
Sbjct: 348 KHGLNCYEVPTGWKF 362

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 12/49 (24%)

Query: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200
           +VGVMITASHNP  DNG K        I+ P      EM++++ E ++T
Sbjct: 57  TVGVMITASHNPPEDNGVK--------IVDPK----GEMLEQSWEVYAT 93

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 148 NLKASVGVMITASHNPKMDNGYKVYYDNACQII 180
           N  +++GVM+TASHNP  DNG K+   N   ++
Sbjct: 63  NKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 153 VGVMITASHNPKMDNGYKVYYDNACQII 180
           VGVM+TASHNP +DNG KV       +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 119 IFLRAGFKVFYLTPDDQFVHTPLVPF--SVLNLKASVGVMITASHNPKMDNGYKVYYDNA 176
           ++  AGF+      D   V T L+    S+     +VGVMITASHN   DNG K      
Sbjct: 22  VYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVK------ 75

Query: 177 CQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKL 217
             I+ P       M+ ++ EP++T     A+F    +  KL
Sbjct: 76  --IVEPD----GSMLDQSWEPFATELANKASFCHSTQEFKL 110

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 151 ASVGVMITASHNPKMDNGYKV 171
           A VGVMITASHNP  DNG K+
Sbjct: 52  APVGVMITASHNPPRDNGVKI 72

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 151 ASVGVMITASHNPKMDNGYKV 171
           A VGVM+TASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 12/49 (24%)

Query: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWST 200
           +VGVMITASHNP  DNG K        I+ P+      M+ ++ EP +T
Sbjct: 53  AVGVMITASHNPPEDNGVK--------IVEPN----GAMLDQSWEPMAT 89

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 118/300 (39%), Gaps = 49/300 (16%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +  F +         T+     I E  P    N   V+G D R+++     
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHNPKM-DNGYKV 171
             A +    G +   +   +  + TP     +     K + G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIG-QNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 172 YYDNACQIIPPHDKNIAEMIQ--KNLEPWSTS-----WDWDATFKKGLETNKLVFIKDLM 224
            Y N     P  +K    M +  +NL  +  +      D     +     N LV + D  
Sbjct: 132 KY-NLANGAPAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLVDVID-P 189

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAKVSSELLNLH 276
           TE Y+  MK +    LI       +       ++  ++G+    G  IF           
Sbjct: 190 TEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIF----------- 238

Query: 277 ENVDYLVVSEQRL----PDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR 332
             VD L +SE  L    P P F  +  P+P    A +L  ++ +EN ++   A+D D DR
Sbjct: 239 --VDELGLSEDSLQNFVPKPDFGGLH-PDPNLTYAHTLVSRVDREN-IAFGAASDGDGDR 294

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 123 AGFKVFYLTPDD-QFVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKV 171
           AGF+      D   F    L     L L+   VGVMITASHNP  DNG K+
Sbjct: 28  AGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKI 78

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 142/377 (37%), Gaps = 56/377 (14%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNL---TAVVGHDHRFHSKEFAI 114
           GT+GLR +  A F+          T+     + E  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKT-AVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169
             A+I    G +   +   +  + TP           K + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIG-QNGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDA----TFKKGLETNKLVFIKDLMT 225
           K    N      P    I E + K L+ +    D       T  + ++   L+      T
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTT 190

Query: 226 EKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAKVSSELLNLHE 277
             Y+  +K +    LI S     +  K    ++  M+GV    G  IF            
Sbjct: 191 RDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVD---------- 240

Query: 278 NVDYLVVSEQRL----PDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRF 333
             ++ + +E+ L    P P F  +  P+P    A SL  ++ +EN +    A+D D DR 
Sbjct: 241 --EFELPAEEVLQNWHPQPDFGGIH-PDPNLTYARSLVDRVDREN-IEFGAASDGDGDR- 295

Query: 334 SAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRM 393
               +    G      G+ +  +  Y     Y      F K     +  S  ++  I R+
Sbjct: 296 ---NMIYGAGPAFVSPGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTASAIDRV 346

Query: 394 ADMNGFHYEDTLTGFKW 410
           A+ +G    +  TG+K+
Sbjct: 347 AEKHGLKCYEVPTGWKF 363

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 8/44 (18%)

Query: 151 ASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKN 194
           A VGVM+TASHNP  DNG K        ++ PH + +A   +K+
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKH 91

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 80/369 (21%), Positives = 143/369 (38%), Gaps = 40/369 (10%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      N       T+     I +  P    +   VVG D RF++     
Sbjct: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHN---PKMDNGY 169
             A+I    G +   +   +  + TP     + +   K + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIG-QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDW-DATFKK-GLETNKLVFIKDLM--T 225
           K    N      P    + E + K L  +    D+    F K G +      + D++  T
Sbjct: 130 KYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 226 EKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDY 281
           E Y+  MK +    LI       ++ K    ++  ++G+       +  +  +L  +   
Sbjct: 189 EDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPAD--- 245

Query: 282 LVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKK 341
             V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR     +   
Sbjct: 246 -EVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVDREK-IEFGAASDGDGDR----NMIYG 298

Query: 342 TGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHY 401
            G      G+ +  +  Y +   Y      F+K     +  S  +S  I R+A   G + 
Sbjct: 299 AGPAFVSPGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAKAQGLNC 352

Query: 402 EDTLTGFKW 410
            +  TG+K+
Sbjct: 353 YEVPTGWKF 361

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 132/610 (21%), Positives = 232/610 (38%), Gaps = 116/610 (19%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNL---TAVVGHDHRFHSKEFAI 114
           GT+GLR R +      N       T+     I E  P  +     +VG D R+++     
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPL---VPFSVLNLKASVGVMITASHNPKM-DNGYK 170
             A+I    G K   +   +  + TP    V  S    K + G+++TASHNP   +N + 
Sbjct: 73  KIAAIGAANGVKRL-VVGQNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 171 VYYDNACQIIPPHD-KNIAEMIQKNLEPWSTSWDWDATFKKGL-ETNKLVFIKDLM--TE 226
           + Y+ A     P +  N      K L  +    D+       L E        D++  T+
Sbjct: 132 IKYNLANGGPAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDSTK 191

Query: 227 KYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYL 282
            Y+  +K +    LI S     ++ K    ++  ++GV       + ++ L L E+    
Sbjct: 192 AYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPED---- 247

Query: 283 VVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKT 342
            V +   P P F  +  P+P    A +L  ++ +EN ++   A+D D DR     +    
Sbjct: 248 EVLQNCHPKPDFGGLH-PDPNLTYARTLVDRVDREN-IAFGAASDGDGDR----NMIYGA 301

Query: 343 GKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYE 402
           G      G+ +  +  Y     Y      F++     +  S  +SQ I  +A  +     
Sbjct: 302 GPAFVSPGDSVAIIAEYASEIPY------FQREGIYGLARSFPTSQAIDLVAKHHNLSCY 355

Query: 403 DTLTGFKWIGNKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMN 462
           +  TG+K+      D ++    +    EE+ G     +  +KDG       L A   W+N
Sbjct: 356 EVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHIR-EKDG-------LWAIIAWLN 402

Query: 463 QYQMSPFDIMEEGFGKFGVFKEYNGYYILKDLSITKTVFD----------FIRHEYPSTN 512
                             +   Y+     KD+SI KT+ D          F R++Y + +
Sbjct: 403 ------------------ILAIYHKRNPEKDVSI-KTIQDEFWDKYGRTFFTRYDYENVS 443

Query: 513 KKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEGT-- 570
                E  N  ++  F++     Q   K +  N P+D +  +  V+A   E+ +L+G+  
Sbjct: 444 ----GEAANR-VIEFFQNFVS--QPGVKGS--NFPLDES--LKVVDAGDFEYKDLDGSVS 492

Query: 571 ------------VRLTMRGSGTEPK---LKVYIEACSKSEESATNLARSTWDILKREWFR 615
                       VR  +R SGT      +++Y+E  S           S + +   E+ R
Sbjct: 493 SNQGLFLKLSNGVRTVLRLSGTGSAGATIRLYVEQYSDDA--------SKYGLTAEEFLR 544

Query: 616 PEVTGLTTSF 625
           P +  L + F
Sbjct: 545 PAIQQLVSFF 554

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 151/380 (39%), Gaps = 61/380 (16%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      N       T+     + +  P    + T VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVL---NLKASVGVMITASHNP---KMDNG 168
             A+I    G     +   +  + TP     +    + K + G+++TASHNP   K D G
Sbjct: 73  KIAAIGAANGVHKLVIG-QNGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 169 YKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATF------KKGLETNKLVFIKD 222
            K    N     P  +    ++ +K+ +   TS+   A F      KKG +      + D
Sbjct: 132 IKYNLSNGG---PAPESVTNKIFEKSKQ--LTSYKIVANFPQLDLSKKGTDQRYGPLLVD 186

Query: 223 LM--TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAKVSSEL 272
           ++  TE Y+  MK +    LI     + K+      ++  ++GV    G  +F  V    
Sbjct: 187 IIDSTEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALF--VDELG 244

Query: 273 LNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR 332
           L+  E++      +  +P P F  +  P+P    A +L ++   ++ ++   A+D D DR
Sbjct: 245 LSAEESL------QNYVPKPDFGGLH-PDPNLTYAHTL-VERVDKDKIAFGAASDGDGDR 296

Query: 333 FSAAVLNKKTGKWRQLT--GNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMI 390
                 N   G        G+ +  +  Y     Y      F K     +  S  +S  I
Sbjct: 297 ------NMIYGYGPAFVSPGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAI 344

Query: 391 KRMADMNGFHYEDTLTGFKW 410
            R+A  +G +  +  TG+K+
Sbjct: 345 DRVAKAHGLNCYEVPTGWKF 364

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 146/380 (38%), Gaps = 62/380 (16%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +     MN       T+     I E  P    +   VVG D R+++ E   
Sbjct: 19  GTSGLRKKTKV---FMNEP---HYTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHN---PKMDNGY 169
               I    G K   +   +  + TP     + +   K++ G+++TASHN   P+ D G 
Sbjct: 73  KIGEIGAANGVKKL-IVGQNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMI---QKNLEPWSTSWDWD----ATFKKGLETNKLVFIKD 222
           K    N      P  +++   I    K L  + T  ++     +   K  E   L+    
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVI 187

Query: 223 LMTEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAK----VSS 270
            +T +Y+  MK +    LI       +  K    ++  ++G+    G  IFA      + 
Sbjct: 188 DVTAEYVKLMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKAIFADELGLPAE 247

Query: 271 ELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDA 330
           E+L  +E            P P F  +  P+P    A +L  ++ +E  ++   A+D D 
Sbjct: 248 EVLQNYE------------PKPDFGGLH-PDPNLTYAHTLVERVDKEQ-IAFGAASDGDG 293

Query: 331 DRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMI 390
           DR     +    G      G+ +  +  Y     Y      F+K     +  S  +S  I
Sbjct: 294 DR----NMIYGCGPAFVSPGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTSAAI 343

Query: 391 KRMADMNGFHYEDTLTGFKW 410
            R+A   G +  +  TG+K+
Sbjct: 344 DRVAKAQGLNCYEVPTGWKF 363

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 55/123 (44%), Gaps = 13/123 (10%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      +       T+     I E  P    N T VVG D R+++ E   
Sbjct: 19  GTSGLRKKTKVFKDEPHY------TENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHNPKM-DNGYKV 171
           +  +I    G +   L   +  + TP     + +   K + G+++TASHNP   +N + +
Sbjct: 73  IIGAIAAANGVRKMILG-QNGILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGI 131

Query: 172 YYD 174
            Y+
Sbjct: 132 KYN 134

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 53/114 (46%), Gaps = 18/114 (15%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIK---EQFP---NNLTAVVGHDHRFHSKE 111
           GT+GLR +         + + ++      N+I+   E  P    + T V+G D RF++  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 112 FAIVTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLK--ASVGVMITASHNP 163
                A+I    G +   +   +  + TP   + + + K  A+ G+++TASHNP
Sbjct: 71  VINKIAAISAANGVRKLVIG-QNGLLSTPATSYIIRSYKDKATGGIILTASHNP 123

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 138/371 (37%), Gaps = 44/371 (11%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +    + N       T+     I E  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169
             A+I    G K   +      + TP           K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWD----ATFKKGLETNKLVFIKDLMT 225
           K    N     P    N+   I K L  +    D+     AT  K  +   L+     +T
Sbjct: 132 KYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 226 EKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDY 281
           + Y+  +K +    LI     + +  K    ++  M+GV       +  +   L  +   
Sbjct: 191 KDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAD--- 247

Query: 282 LVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKK 341
             V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR      N  
Sbjct: 248 -EVLQNWHPSPDFGGMH-PDPNLTYASTLVKRVDREK-IEFGAASDGDGDR------NMI 298

Query: 342 TGKWRQLT--GNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGF 399
            G        G+ +  +  Y     Y      F K     +  S  +S  I R+A  +G 
Sbjct: 299 YGYGPSFVSPGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGL 352

Query: 400 HYEDTLTGFKW 410
           +  +  TG+K+
Sbjct: 353 NCYEVPTGWKF 363

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 136 FVHTPLVPFSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKN 194
           F    L     ++LK   VG MITASHNP  DNG K        ++ P      EM+++ 
Sbjct: 40  FTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVK--------LVDPK----GEMLKQE 87

Query: 195 LEPWST 200
            E ++T
Sbjct: 88  WEVYAT 93

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 87/372 (23%), Positives = 137/372 (36%), Gaps = 46/372 (12%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +      N       T+     I E  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169
             A+I    G K   +      + TP           K + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIG-QHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNK-----LVFIKDLM 224
           K    N     P    N    I K L  +    D+       +  NK     LV I D+ 
Sbjct: 132 KYNLSNGGP-APESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDI- 189

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVD 280
           T+ Y+  +K +    LI     + +  K    ++  M+GV       +  +   L  +  
Sbjct: 190 TKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAD-- 247

Query: 281 YLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNK 340
              V +   P P F  +  P+P    A SL  ++ +E  +    A+D D DR      N 
Sbjct: 248 --EVLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDREK-IEFGAASDGDGDR------NM 297

Query: 341 KTGKWRQLT--GNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNG 398
             G        G+ +  +  Y     Y      F K     +  S  +S  I R+A  +G
Sbjct: 298 IYGYGPSFVSPGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSGAIDRVAKAHG 351

Query: 399 FHYEDTLTGFKW 410
            +  +  TG+K+
Sbjct: 352 LNCYEVPTGWKF 363

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 83/382 (21%), Positives = 145/382 (37%), Gaps = 66/382 (17%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQS----TQGLANYIKEQFP---NNLTAVVGHDHRFHSK 110
           GT+GLR +           +I +     T+     I E  P   +  T VVG D R+++ 
Sbjct: 19  GTSGLRKKT----------VIFKDEPNYTENFIQAIMESIPEGSDGATLVVGGDGRYYND 68

Query: 111 EFAIVTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL--KASVGVMITASHN---PKM 165
                 A I    G K   +   +  + TP     + +   K + G+++TASHN   PK 
Sbjct: 69  VILEKIAKIGAANGVKKL-VVGQNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKN 127

Query: 166 DNGYKVYYDNACQIIPPHDKNIAEMI---QKNLEPWSTSWDWDATFKKGLETNK-----L 217
           D G K    N      P  +++ + I    K L  +    D        +  N+     L
Sbjct: 128 DMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPIL 183

Query: 218 VFIKDLMTEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELL 273
           + + D+ T+ Y+  +K +    LI     + +  K    ++  ++G+       +  +  
Sbjct: 184 IDVIDV-TKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEF 242

Query: 274 NLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR- 332
            L EN     V +   P P F  +  P+P    A SL  ++ +E  +    A+D D DR 
Sbjct: 243 ELPEN----EVLQNYHPQPDFGGLH-PDPNLTYARSLVDRVDKEK-IEFGAASDGDGDRN 296

Query: 333 ----FSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQ 388
               +  A ++          G+ +  +  Y     Y      F K     +  S  +S 
Sbjct: 297 MIYGYGPAFVS---------PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSA 341

Query: 389 MIKRMADMNGFHYEDTLTGFKW 410
            I R+A  +G    +  TG+K+
Sbjct: 342 AIDRVAKAHGLECYEVPTGWKF 363

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 140/370 (37%), Gaps = 42/370 (11%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR +      +         T+     I +  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHNP---KMDNGY 169
             A+I    G K   +      + TP           K + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKL-VVGQHGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNK-----LVFIKDLM 224
           K    N      P    I E I K +  +    D+     + L  NK     LV + D+ 
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDI- 189

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVD 280
           T+ Y+  +K +    LI     + ++ K    ++  M+GV       +  +   L  +  
Sbjct: 190 TKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPAD-- 247

Query: 281 YLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNK 340
              V +Q  P P F  V  P+P    A +L  ++ +E  +    A+D D DR     +  
Sbjct: 248 --EVLQQWHPQPDFGGVH-PDPNLTYAKALVDRVNREK-IEFGAASDGDGDR----NMIY 299

Query: 341 KTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFH 400
             G      G+ +  +  Y     Y      F+K     +  S  ++  I R+A  +G +
Sbjct: 300 GAGPAFVSPGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTASSIDRVAKAHGLN 353

Query: 401 YEDTLTGFKW 410
                TG+K+
Sbjct: 354 CYQVPTGWKF 363

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 127/614 (20%), Positives = 226/614 (36%), Gaps = 139/614 (22%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +    +         T+     I +  P    + T VVG D R+++ +   
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNL------KASVGVMITASHNPKM-DN 167
           + ASI    G     +      + TP     +         K + G+++TASHNP   DN
Sbjct: 73  IIASISAANGVGKLVIG-QHGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 168 GYKVYYD-NACQIIPPHDKNIAEMIQKNLEPWST-----SWDWDATFKKGLETNKLVFIK 221
              + Y+ +     P    N    I K L  +         D     +K L   ++  + 
Sbjct: 132 DIGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEIDVVD 191

Query: 222 DLMTEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHE 277
             +T+ Y+  +K +    LI     + +  K    ++  ++GV       +  + L L E
Sbjct: 192 --VTQAYVEFLKEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDELGLPE 249

Query: 278 NVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADR----- 332
           N     V +   P P F  +  P+P    A +L  ++ +E  +    A+D D DR     
Sbjct: 250 N----EVLQNCHPKPDFGGI-HPDPNLTYARTLVERVDKEK-IEFGAASDGDGDRNMIYG 303

Query: 333 FSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKR 392
           +  A ++          G+ +  +  Y +   Y      F K     +  S  +S  I R
Sbjct: 304 YGPAFVS---------PGDSVAIIAEYAKEIPY------FAKQGIYGLARSFPTSSAIDR 348

Query: 393 MADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATV 452
           +A   G +  +  TG+K+      D ++    +    EE+ G     +  +KDG+     
Sbjct: 349 VAAEQGLNCYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHVR-EKDGV----- 397

Query: 453 FLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNGYYILKDLSITKTVFD---------- 502
              A   W+N                  +   YN ++  K+ SI KT+ D          
Sbjct: 398 --WAIIAWLN------------------ILAIYNKHHPQKEASI-KTIQDEFWLKYGRTF 436

Query: 503 FIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNLPVD--PTSQMITV-EA 559
           F R+++     +  +EI   L   V              N PN+     P+   +TV EA
Sbjct: 437 FTRYDFEHVTTEKANEIVKHLDSFV--------------NSPNVVGSKFPSDNSVTVAEA 482

Query: 560 KPSEFSNLEGTV--------------RLTMRGSGTEPK---LKVYIEACSKSEESATNLA 602
              ++++L+G+V              R  +R SGT      +++YIE  S          
Sbjct: 483 GDFQYTDLDGSVSSNQGLYVKLSSGARFVLRLSGTGSSGATIRLYIEKYSDD-------- 534

Query: 603 RSTWDILKREWFRP 616
           ++ + +   E+ RP
Sbjct: 535 KTKYGLTAEEYLRP 548

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 142/376 (37%), Gaps = 54/376 (14%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFP---NNLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +    + N       T+     I E  P      T VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVP--FSVLNLKASVGVMITASHN---PKMDNGY 169
             A+I    G K   +      + TP           + + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIG-QYGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 170 KVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNK-----LVFIKDLM 224
           K    N     P    N    I K L  +    D+     K +  NK     L+ + D+ 
Sbjct: 132 KYNLSNGGP-APESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVIDI- 189

Query: 225 TEKYLMQMKRV----LIHSSHLSLKDVKTPFFVYTPMHGV----GAEIFAKVSSELLNLH 276
           T+ Y+  +K++    LI     + +  K    ++  M+GV    G  IF  V    L   
Sbjct: 190 TKAYVDFLKKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIF--VDEFGLPAE 247

Query: 277 ENVDYLVVSEQRLPDPSFPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAA 336
           E      V +   P P F  +  P+P    A SL  ++ +E  +    A+D D DR    
Sbjct: 248 E------VLQNWHPSPDFGGMH-PDPNLTYASSLVKRVDREK-IEFGAASDGDGDR---- 295

Query: 337 VLNKKTGKWRQLT--GNEIGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMA 394
             N   G        G+ +  +  Y     Y      F K     +  S  +S  I R+A
Sbjct: 296 --NMIYGYGPSFVSPGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVA 347

Query: 395 DMNGFHYEDTLTGFKW 410
             +G +  +  TG+K+
Sbjct: 348 KAHGLNCYEVPTGWKF 363

>Skud_2.291 Chr2 (533122..534864) [1743 bp, 580 aa] {ON} YBR163W
           (REAL)
          Length = 580

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFD 52
           P NL+ P  + ++L Q ++ R  V QLC  +NW EL   +D
Sbjct: 109 PRNLQNPY-IDIQLKQLKKERMSVTQLCSTQNWCELRNFYD 148

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 12/111 (10%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPN---NLTAVVGHDHRFHSKEFAI 114
           GT+GLR + +   +  N       T+     I +  P    N T VVG D RF++     
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 115 VTASIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASV--GVMITASHNP 163
           + A I    G +   +      + TP     +      V  G+++TASHNP
Sbjct: 73  LIAEIGAANGVRKLIIG-QAGILSTPAASHIIRTYHEEVTGGIILTASHNP 122

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 6/108 (5%)

Query: 58  GTAGLRSRMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTA 117
           GT+GLR +     +  N        Q + + I E    + T VVG D RF++       A
Sbjct: 19  GTSGLRKKTAIFMNEPN--YTENFIQAMLDAIPEG-SQDATLVVGGDGRFYNDVIMNKIA 75

Query: 118 SIFLRAGFKVFYLTPDDQFVHTPLVPFSVLNLKASV--GVMITASHNP 163
           +I    G K   +   +  + TP     + + +  V  G+++TASHNP
Sbjct: 76  AISAANGVKKLIIG-QNGLLSTPAASHIIRSYEEKVTGGIILTASHNP 122

>Suva_4.415 Chr4 (735132..736889) [1758 bp, 585 aa] {ON} YBR163W
           (REAL)
          Length = 585

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 12  PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFD 52
           P++L+ P  + ++L+Q +  R  V QLC  +NW EL   +D
Sbjct: 109 PQSLKNPY-MDIQLNQLKRKRLSVTQLCTTQNWCELRNFYD 148

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,298,745
Number of extensions: 3033878
Number of successful extensions: 7903
Number of sequences better than 10.0: 66
Number of HSP's gapped: 8066
Number of HSP's successfully gapped: 70
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)